Replace pyparsing with lark for better error messages - #124
Open
pkienzle wants to merge 19 commits into
Open
Conversation
added 14 commits
March 5, 2026 15:45
Collaborator
Author
|
Most of the error messages are an improvement over the old parser, though some of them are still confusing. Here's a mix of accepted and rejected formulas along with the associated error messages. Note that lines marked with ## didn't parse in the old parser. $ python -m periodictable.lark_parse
# === Composite tests ===
*** Co
=> Co @ 8.90
*** H2SO4
=> H₂SO₄
*** CaCO3
=> CaCO₃
*** CaCO₃
=> CaCO₃
*** (Co@5) ##
=> Co @ 5.00
*** (((Co@5)@6)) ##
=> Co @ 6.00
*** CaCO3+6H2O
=> CaCO₃(H₂O)₆
*** CaCO3 6H2O
=> CaCO₃(H₂O)₆
*** CaCO3(H2O)6
=> CaCO₃(H₂O)₆
*** CaCO3 (H2O)6
=> CaCO₃(H₂O)₆
*** (Ca(CO3)((H2O)6))
=> CaCO₃(H₂O)₆
*** CaCO₃·6H₂O ##
=> CaCO₃(H₂O)₆
!!! Bl2Oh # bad symbol
Element Bl doesn't exist
!!! (Co # mismatched LPAR
Expected one of @DENSITY[ni] NUMBER SYMBOL in
(Co
^
!!! Co) # mismatched RPAR
Expected one of @DENSITY[ni] COUNT SYMBOL in
Co)
^
!!! ((Co) # mismatched LPAR
Expected one of @DENSITY[ni] NUMBER SYMBOL in
((Co)
^
!!! ₃H2O # badly placed subscript
Expected one of NUMBER SYMBOL aa:SEQ in
₃H2O
^
# === Isotope tests ===
*** DHO
=> DHO
*** H[1]
=> ¹H @ 0.07
*** ¹⁸O₂
=> ¹⁸O₂ @ 1.28
!!! Fe[56O2 # bad isotope syntax
Expected ] in
Fe[56O2
^
!!! Co[181] # bad isotope
'181 is not an isotope of Co'
# === Valence tests ===
*** Ca{2+}
=> Ca²⁺ @ 1.55
*** Ca{++}
=> Ca²⁺ @ 1.55
*** Ca⁺⁺ ##
=> Ca²⁺ @ 1.55
*** O{2-}
=> O²⁻ @ 1.14
*** O{--}
=> O²⁻ @ 1.14
*** O²⁻ ##
=> O²⁻ @ 1.14
*** H{+}
=> H⁺ @ 0.07
*** H{-}
=> H⁻ @ 0.07
*** HO{1-} # HO- applies to the group, but valence is attached to O
=> HO⁻
*** H[1]{1-}O
=> ¹H⁻O
*** ²H⁺ # D{+} ##
=> D⁺ @ 0.14
*** O²H⁻ # no ambiguity since valence requires a trailing + or - ##
=> OD⁻
*** O²⁻H⁺ # O{2-}H{+} ##
=> O²⁻H⁺
*** O²⁻²H⁺ # O{2-}D{+} ##
=> O²⁻D⁺
!!! Ca{2} # missing charge in valence
Expected CHARGE[+-] in
Ca{2}
^
!!! Ca{2++} # can't use number++
Use 2+ instead of 2++ for valence
!!! Ca{2+O2 # missing close brace on valence
Expected } in
Ca{2+O2
^
!!! Co{17-} # bad valence value
valence 17- is not valid for Co
!!! Ca ⁺⁺ # extra space before valence
Expected one of @DENSITY[ni] NUMBER SYMBOL in
Ca ⁺⁺
^
!!! Ca++ # missing braces in valence: the + is acting as SEPARATOR
Expected one of NUMBER SYMBOL in
Ca++
^
!!! Ca2+ # missing braces in valence: the 2 is acting as COUNT and the + as SEPARATOR
Expected one of NUMBER SYMBOL in
Ca2+
^
!!! O² # Should be looking for SUPERCHARGE (e.g., O²⁻) or SYMBOL (e.g., O²H)
Expected SYMBOL in
O²
^
# === Density tests ===
*** H2O@1 # density is 1, where H and O use natural abundance
=> H₂O @ 1.00
*** H2O @ 1 # spaces allowed around '@' ##
=> H₂O @ 1.00
*** D2O@1n # natural density "n" is 1 so isotopic density is 1.11
=> D₂O @ 1.11
*** [email protected] # isotopic density is 1.11
=> D₂O @ 1.11
*** [email protected] # default is "i" for isotopic density
=> D₂O @ 1.11
*** C3H4H[1][email protected] # another natural density example
=> C₃H₄¹HNO @ 1.29
*** 78.2H2O[16] + 21.8H2O[18] @1n # density applies to composite
=> (H₂¹⁶O)₇₈.₂(H₂¹⁸O)₂₁.₈ @ 1.02
!!! 3g Ca@ // 5g Si # missing density value
Expected @DENSITY[ni] in
3g Ca@ // 5g Si
^
!!! Ca@i # missing density value ##
Expected @DENSITY[ni] in
Ca@i
^
!!! H2O@1h # bad density mode
Expected @DENSITY[ni] in
H2O@1h
^
# === Mixture tests ===
*** 50 wt% Co // Ti # mix by mass; final component does need percentage
=> CoTi₁.₂₃₁₁₈₆₂₈₇₀₀₃₅₇₂₆ @ 6.01
*** 33 wt% Co // 33% Fe // Ti # intermediate components need percentage
=> CoFe₁.₀₅₅₂₉₉₃₈₂₂₁₈₆₄₁Ti₁.₂₆₈₄₉₄₉₆₂₃₆₇₃₁₇₂ @ 6.50
!!! 93 wt% Co // 33% Fe // Ti # more than 100 wt%
Total weight 126% is more than 100% in wt% mixture
!!! 93 vol% Co // 33% Fe // Ti # more than 100 vol%
Total volume 126% is more than 100% in vol% mixture
*** 20 vol% (10 wt% [email protected] // H2O@1) // D2O@1n
=> NaCl(H₂O)₂₉.₁₉₅₅₅₅₀₁₀₈₂₄₃₁(D₂O)₁₂₂.₇₈₉₅₃₅₈₈₉₁₄₅₈₅ @ 1.10
*** 5g NaCl // 50mL H2O@1 # volume components need density to determine mass fraction
=> NaCl(H₂O)₃₂.₄₃₉₅₀₅₅₆₇₅₈₂₅₇
*** 5g [email protected] // 50mL H2O@1 # need component densities to estimate mixture density
=> NaCl(H₂O)₃₂.₄₃₉₅₀₅₅₆₇₅₈₂₅₇ @ 1.05
*** NaCl(H2O)29.1966(D2O)[email protected] # mixture rendered as formula
=> NaCl(H₂O)₂₉.₁₉₆₆(D₂O)₁₂₂.₇₉₄ @ 1.10
!!! 5g NaCl // 50mL H2O # need density for H2O to convert volume to mass
Need the mass density of H2O
*** (10 wt% NaCl // H2O)@1.07n # set density of a mixture
=> NaCl(H₂O)₂₉.₁₉₅₅₅₅₀₁₀₈₂₄₃₁ @ 1.07
*** 50 mL (45 mL H2O@1 // 5 g NaCl)@1.0707 // 20 mL D2O@1n
=> (H₂O)₂₉.₁₉₅₅₅₅₀₁₀₈₂₄₃₁NaCl(D₂O)₁₂.₁₁₈₉₈₉₆₅₈₁₉₈₄₀₂ @ 1.08
*** 1 cm Si // 5 nm Cr // 10 nm Au
=> Si₁₁₉₉₉₂₂.₉₇₃₇₄₆₂₄₉₅CrAu₁.₄₁₇₂₁₈₀₀₉₃₁₂₁₃₆ @ 2.33
!!! 4 nm [email protected]// 50 g Si # can't use mass in layer mixture
Expected UNIT[mm] in
4 nm [email protected]// 50 g Si
^
!!! 3..5 mg NaCl # bad number format
Expected one of SYMBOL UNIT[mL] UNIT[mg] UNIT[mm] vol% wt% in
3..5 mg NaCl
^
!!! 5 Mg NaCl // 50mL H2O@1 # bad units
Expected one of UNIT[mL] UNIT[mg] UNIT[mm] vol% wt% in
5 Mg NaCl // 50mL H2O@1
^
!!! 3.5 fm Si # bad units; expecting wt%/vol% or LENGTH, VOLUME, MASS
Expected one of UNIT[mL] UNIT[mg] UNIT[mm] vol% wt% in
3.5 fm Si
^
!!! 3.5 mm Si // 2.5 nm SiO2 // # missing final component of mixture
Expected NUMBER in
3.5 mm Si // 2.5 nm SiO2 //
^
!!! 3.5 mm Si // 2.5 nm SiO2 // 35 mm cG # bad final component of mixture
Expected :SEQ in
3.5 mm Si // 2.5 nm SiO2 // 35 mm cG
^
!!! // 3g Ca # // is not a comment
Expected one of NUMBER SYMBOL aa:SEQ in
// 3g Ca
^
!!! 37 vol% H2O@1 / 5% D2O@1 # missing /
Expected one of // @DENSITY[ni] in
37 vol% H2O@1 / 5% D2O@1
^
!!! 37 vol% H2O@1 /// 5% D2O@1 # extra /
Expected one of NUMBER SYMBOL aa:SEQ in
37 vol% H2O@1 /// 5% D2O@1
^
!!! 37 vol% [email protected] // H2O@1 // D2O@1 # percent missing in middle part
Expected end of formula in
37 vol% [email protected] // H2O@1 // D2O@1
^
!!! 37 vol% H2O@1 // 5% D2O@1 # percent not allowed in last part
Expected one of // @DENSITY[ni] in
37 vol% H2O@1 // 5% D2O@1
^
!!! 37 vol% H2O@1 // 5 vol% D2O@1 # only % in subsequent parts
Expected % in
37 vol% H2O@1 // 5 vol% D2O@1
^
!!! 37% H2O@1 // D2O@1 # missing vol% or wt%
Expected one of SYMBOL UNIT[mL] UNIT[mg] UNIT[mm] vol% wt% in
37% H2O@1 // D2O@1
^
!!! 37 val% H2O@1 // D2O@1 # bad spelling of vol%
Expected one of UNIT[mL] UNIT[mg] UNIT[mm] vol% wt% in
37 val% H2O@1 // D2O@1
^
# === FASTA tests ===
*** dna:CAGT
=> C₃₉H₃₇¹H₁₀N₁₅O₂₅P₄ @ 1.69
*** dna:CAGT @1n # can override the density of a FASTA sequence
=> C₃₉H₃₇¹H₁₀N₁₅O₂₅P₄ @ 1.00
*** aa:RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
=> C₁₀₈₀H₁₃₇₀¹H₃₁₉N₂₆₈O₃₁₀S₆ @ 1.27
!!! DNA:CAGT # incorrect case for FASTA type
Expected one of @DENSITY[ni] COUNT SYMBOL in
DNA:CAGT
^
!!! dna CAGT # missing colon between FASTA type and sequence
Expected :SEQ in
dna CAGT
^
!!! bad:CAGT # bad FASTA sequence type
Invalid fasta sequence type 'bad:'
|
pkienzle
marked this pull request as ready for review
May 22, 2026 16:26
Collaborator
Author
|
Here are the error messages from pyparsing for comparison (but in a different order): !!! DNA:CAGT # incorrect case for FASTA type not properly identified
unknown element A
!!! dna CAGT # missing colon in FASTA
Expected end of text, found 'dna' (at char 1), (line:1, col:2)
!!! O² # SUPERCHARGE should be the only valid token here
Expected end of text, found '²' (at char 2), (line:1, col:3)
!!! ₃H2O # badly placed subscript
Expected end of text, found '₃' (at char 1), (line:1, col:2)
!!! // 3g Ca # // is not a comment
Expected end of text, found '/' (at char 1), (line:1, col:2)
!!! 3g Ca@ // 5g Si # missing density value
Expected end of text, found '3g' (at char 1), (line:1, col:2)
!!! Ca@i # missing density value ##
!!! pyparsing fails
!!! Ca ⁺⁺ # extra space before valence
Expected end of text, found '⁺' (at char 4), (line:1, col:5)
!!! Ca++ # missing braces in valence: the + is acting as SEPARATOR
Expected end of text, found '+' (at char 3), (line:1, col:4)
!!! Ca2+ # missing braces in valence: the 2 is acting as COUNT and the + as SEPARATOR
Expected end of text, found '+' (at char 4), (line:1, col:5)
!!! Ca{2} # missing charge in valence
Expected end of text, found '{' (at char 3), (line:1, col:4)
!!! 37 vol% H2O@1 / 5% D2O@1 # missing /
Expected end of text, found '37' (at char 1), (line:1, col:2)
!!! 37 vol% H2O@1 /// 5% D2O@1 # extra /
Expected end of text, found '37' (at char 1), (line:1, col:2)
!!! H2O@1h # bad density mode
Expected end of text, found 'h' (at char 6), (line:1, col:7)
!!! 37 vol% [email protected] // H2O@1 // D2O@1 # percent missing in middle part
Expected end of text, found '37' (at char 1), (line:1, col:2)
!!! 37 vol% H2O@1 // 5% D2O@1 # percent not allowed in last part
Expected end of text, found '37' (at char 1), (line:1, col:2)
!!! 37 vol% H2O@1 // 5 vol% D2O@1 # only % in subsequent parts
Expected end of text, found '37' (at char 1), (line:1, col:2)
!!! 37% H2O@1 // D2O@1 # missing vol% or wt%
Expected end of text, found '37' (at char 1), (line:1, col:2)
!!! 37 val% H2O@1 // D2O@1 # bad spelling of vol%
Expected end of text, found '37' (at char 1), (line:1, col:2)
!!! Fe[56O2 # bad isotope syntax
Expected end of text, found '[' (at char 3), (line:1, col:4)
!!! Co[181] # bad isotope
'181 is not an isotope of Co'
!!! Ca{2+O2 # bad valence syntax
Expected end of text, found '{' (at char 3), (line:1, col:4)
!!! Co{17-} # bad valence
valence 17- is not valid for Co
!!! 3..5 mg NaCl
Expected end of text, found '3' (at char 1), (line:1, col:2)
!!! 3.5 fm Si # bad units at the start; could be wt%/vol% or LENGTH, VOLUME, MASS
Expected end of text, found '3' (at char 1), (line:1, col:2)
!!! 3.5 mm Si // 2.5 nm SiO2 //
Expected end of text, found '3' (at char 1), (line:1, col:2)
!!! 3.5 mm Si // 2.5 nm SiO2 // 35 mm cG
Expected end of text, found '3' (at char 1), (line:1, col:2)
!!! ((Co) # mismatched LPAR
Expected end of text, found '(' (at char 1), (line:1, col:2)
!!! Co) # mismatched RPAR
Expected end of text, found ')' (at char 3), (line:1, col:4)
!!! bad:CAGT # bad sequence type
Expected end of text, found 'bad' (at char 1), (line:1, col:2)
*** Co
=> Co @ 8.90
*** dna:CAGT
=> C₃₉H₃₇¹H₁₀N₁₅O₂₅P₄ @ 1.69
*** (Co@5) ##
!!! pyparsing fails
*** (((Co@5)@6)) ##
!!! pyparsing fails
*** CaCO3
=> CaCO₃
*** CaCO₃
=> CaCO₃
*** CaCO3+6H2O
=> CaCO₃(H₂O)₆
*** CaCO3 6H2O
=> CaCO₃(H₂O)₆
*** CaCO3(H2O)6
=> CaCO₃(H₂O)₆
*** CaCO3 (H2O)6
=> CaCO₃(H₂O)₆
*** (Ca(CO3)((H2O)6))
=> CaCO₃(H₂O)₆
*** CaCO₃·6H₂O ##
!!! pyparsing fails
*** DHO
=> DHO
!!! Ca{2++} # bad valence string
Expected end of text, found '{' (at char 2), (line:1, col:3)
*** Ca⁺⁺ # also Ca{2+} ##
!!! pyparsing fails
*** O²⁻ ##
!!! pyparsing fails
*** H[1]
=> ¹H @ 0.07
*** ²H⁺ # D{+} ##
!!! pyparsing fails
*** O²H⁻ # OD{-} ##
!!! pyparsing fails
*** O²⁻H⁺ # O{2-}H{+} ##
!!! pyparsing fails
*** O²⁻²H⁺ # O{2-}D{+} ##
!!! pyparsing fails
*** H2O@1
=> H₂O @ 1.00
*** D2O@1n
=> D₂O @ 1.11
*** D2O @ 1.11 ##
!!! pyparsing fails
*** [email protected]
=> D₂O @ 1.11
*** HO{1-}
=> HO⁻
*** H[1]{1-}O
=> ¹H⁻O
*** H2SO4
=> H₂SO₄
*** C3H4H[1][email protected]
=> C₃H₄¹HNO @ 1.29
*** 78.2H2O[16] + 21.8H2O[18] @1n # density applies to composite
=> (H₂¹⁶O)₇₈.₂(H₂¹8O)₂₁.₈ @ 1.02
*** dna:CAGT @1n # fasta density override
=> C₃₉H₃₇¹H₁₀N₁₅O₂₅P₄ @ 1.00
*** 50 wt% Co // Ti
=> CoTi₁.₂₃₁₁₈₆₂₈₇₀₀₃₅₇₂₆ @ 6.01
*** 33 wt% Co // 33% Fe // Ti
=> CoFe₁.₀₅₅₂₉₉₃₈₂₂₁₈₆₄₁Ti₁.₂₆₈₄₉₄₉₆₂₃₆₇₃₁₇₂ @ 6.50
!!! 93 wt% Co // 33% Fe // Ti # More than 100 wt%
Expected end of text, found '93' (at char 1), (line:1, col:2)
!!! 93 vol% Co // 33% Fe // Ti # More than 100 vol%
Expected end of text, found '93' (at char 1), (line:1, col:2)
*** 20 vol% (10 wt% [email protected] // H2O@1) // D2O@1n
=> NaCl(H₂O)₂₉.₁₉₅₅₅₅₀₁₀₈₂₄₃₁(D₂O)₁₂₂.₇₈₉₅₃₅₈₈₉₁₄₅₈₅ @ 1.10
*** NaCl(H2O)29.1966(D2O)[email protected]
=> NaCl(H₂O)₂₉.₁₉₆₆(D₂O)₁₂₂.₇₉₄ @ 1.10
*** 5g NaCl // 50mL H2O@1
=> NaCl(H₂O)₃₂.₄₃₉₅₀₅₅₆₇₅₈₂₅₇
*** 5g [email protected] // 50mL H2O@1
=> NaCl(H₂O)₃₂.₄₃₉₅₀₅₅₆₇₅₈₂₅₇ @ 1.05
!!! 5g NaCl // 50mL H2O # Need density for H2O to convert volume to mass
Expected end of text, found '5g' (at char 1), (line:1, col:2)
*** (10 wt% NaCl // H2O)@1.07n # set density of a mixture
=> NaCl(H₂O)₂₉.₁₉₅₅₅₅₀₁₀₈₂₄₃₁ @ 1.07
*** 50 mL (45 mL H2O@1 // 5 g NaCl)@1.0707 // 20 mL D2O@1n
=> (H₂O)₂₉.₁₉₅₅₅₅₀₁₀₈₂₄₃₁NaCl(D₂O)₁₂.₁₁₈₉₈₉₆₅₈₁₉₈₄₀₂ @ 1.08
*** 1 cm Si // 5 nm Cr // 10 nm Au
=> Si₁₁₉₉₉₂₂.₉₇₃₇₄₆₂₄₉₅CrAu₁.₄₁₇₂₁₈₀₀₉₃₁₂₁₃₆ @ 2.33
*** aa:RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
=> C₁₀₈₀H₁₃₇₀¹H₃₁₉N₂₆₈O₃₁₀S₆ @ 1.27
!!! Bl2Oh # Bad symbol
unknown element Bl
!!! 5 Mg NaCl // 50mL H2O@1 # Bad units
Expected end of text, found '5' (at char 1), (line:1, col:2)
!!! 4 nm [email protected]// 50 g Si # Can't use mass in layer mixture
Expected end of text, found '4' (at char 1), (line:1, col:2) |
|
I'll give it check the next days ! |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment
Add this suggestion to a batch that can be applied as a single commit.This suggestion is invalid because no changes were made to the code.Suggestions cannot be applied while the pull request is closed.Suggestions cannot be applied while viewing a subset of changes.Only one suggestion per line can be applied in a batch.Add this suggestion to a batch that can be applied as a single commit.Applying suggestions on deleted lines is not supported.You must change the existing code in this line in order to create a valid suggestion.Outdated suggestions cannot be applied.This suggestion has been applied or marked resolved.Suggestions cannot be applied from pending reviews.Suggestions cannot be applied on multi-line comments.Suggestions cannot be applied while the pull request is queued to merge.Suggestion cannot be applied right now. Please check back later.
This PR replaces pyparsing with lark.
It does a better job of error messages (#34), and it is more robust than the existing parser.
The syntax is represented as a string using EBNF notation. This nicely separates it from parsing and interpretation. The format is clean enough to use directly in the documentation.
periodictable/periodictable/lark_parse.py
Lines 23 to 89 in cc49581
@bpedersen2 Please check if this works with the activation calculator at FRM2: https://webapps.frm2.tum.de/activation/