diff --git a/results/2026-10-29_near_tie/CANDIDATE_RECORDS.md b/results/2026-10-29_near_tie/CANDIDATE_RECORDS.md new file mode 100644 index 00000000..9a64a3fc --- /dev/null +++ b/results/2026-10-29_near_tie/CANDIDATE_RECORDS.md @@ -0,0 +1,38 @@ +# Candidate reference records for the SLA2-type genera (draft, 2026-10-29) + +Search: PubMed (via the PubMed MCP) and NCBI Protein and Assembly (E-utilities) for MAT loci in Barnettozyma, Petasospora (Cyberlindnera fabianii), Wickerhamomyces, Ambrosiozyma, Saccharomycopsis, Citeromyces, Williopsis (Cyberlindnera jadinii), Hansenula, Kuraishia and Pachysolen. Only three leads are real; nothing here is curated yet. + +## 1. *Saccharomycopsis schoenii*: best candidate (published locus, RNA-seq, chromosome-scale assembly) + +- **Paper:** Kriti D, Barazandeh M, Ogbede JU, Giaever G, Nislow C. G3 2026;16(5), [10.1093/g3journal/jkag067](https://doi.org/10.1093/g3journal/jkag067) (PMID 41849659, PMC13148404). Chromosome-scale assembly (6 nuclear chromosomes, PacBio HiFi + Hi-C), BRAKER2 annotation, RNA-seq. +- **What it says about MAT:** an expanded MAT system, with SLA2-MAT cassettes (MATa1, MATa2, MATalpha1, MATalpha2) on every chromosome; SLA2 stays tightly linked to the MAT genes on every chromosome while DIC1 is scattered; the cassettes are co-transcribed (189-247 bp splice junctions between MATa1 and SLA2; conserved 58 bp introns between MATa2 and MATa1). The active locus is on chromosome IV: a leftmost alpha-dominant sub-cluster (470,610-475,000: MATalpha2, MATalpha1) and a rightmost palindromic cassette (528,044-537,777; SLA2 anchor flanked by mirrored MATa1 and MATa2 arrays). The species is homothallic (Dost et al., Microbiol Res 2024, [10.1016/j.micres.2024.127691](https://doi.org/10.1016/j.micres.2024.127691), PMID 38492364; *S. lassenensis* is heterothallic). +- **Assembly:** GenBank JBTFFQ000000000, BioProject PRJNA1364152 (data availability). The v0.7.0 genome table has GCA_054953955.1 (NCYC 2975, chromosome level, submitted 2026-02-09), which I expect to be this assembly (not checked against the WGS prefix). Our replay calls six `MTL alpha` loci there (CM143126-CM143131), each with SLA2 (40-45% identity) inside the locus, no DIC1 and no PIK1/OBP1/PAP1: the published SLA2-MAT architecture, not MTL. +- **Record plan:** one record per active locus, `system` homothallic or `unknown`, the gene models of the deposit (annotation plus RNA-seq, tier 2), a family of its own or an SLA2-MAT family (curator). +- **Needs:** the deposit's annotation (GFF) and exact coordinates of the chromosome IV loci; the MATa1/MATa2 intron structure. + +## 2. *Barnettozyma californica* and relatives + +- **Paper:** Hession C, Byrne KP, Wolfe KH, Butler G. PLoS Genet 2025;21(12):e1011814, [10.1371/journal.pgen.1011814](https://doi.org/10.1371/journal.pgen.1011814) (PMID 41359681, PMC12711049). A centromere formed at the MAT locus of *B. californica* (250 kb from the old one); the same chromosome carries MAT and MRP17-PUT2 about 250 kb apart in all three *Barnettozyma* species studied. +- **MAT structure (S3 Fig, text only read):** a 460 bp centromere-associated sequence lies in a 2.8 kb intergenic region **between MATa1 and MATa2 on one side and MATalpha1 and MATalpha2 on the other**, so one locus carries both gene pairs. +- **Our replay:** five *B. californica* assemblies (UCD09 GCA_003123585.1, UCD89 GCA_003123885.1, NRRL Y-17395 GCA_003706655.x, PB4207 GCA_023627795.1) give one MTL call of 16 kb with SLA2 inside and **DIC1 8.2 kb away**, no PIK1: the SLA2-MAT-DIC1 arrangement. +- **Assembly with the best contiguity:** *B. discipulorum* GCA_049863505.1 (PYCC:10016, complete genome, 2025-04-23; not in our run). The accessions the paper used are in its S1 Table, which was not read. +- **Record plan:** a record from the paper's locus (both idiomorph gene pairs at one locus), pseudohomothallic or `unknown`, tier 2; family decision for the curator (a Phaffomycetales/Barnettozyma family, or MATog-like). +- **Needs:** S1 Table and S3 Fig (supplement) for the assembly and coordinates. + +## 3. *Petasospora (Cyberlindnera) fabianii*: annotation-only + +- Protein ONH67106 "Mating-type-like protein ALPHA1" (strain 65, MPUK01000005.1, locus tag BON22_3092, MATalpha_HMGbox region): a draft-genome annotation with no paper on the locus (PubMed finds none), tier 3 at best. +- Chromosome-level assemblies: GCA_022641835.1 ("Missouri", CP048715.1): our MATsc call is at 630,345-685,843 with DIC1 1.1 kb from the locus and SLA2 inside; GCA_050575385.1 (TBRC4498, chromosome) is uncalled in v0.7.0. +- **Record plan:** a manual annotation of the CP048715.1 locus (the same procedure as for CBS 573) would make this a real record; needs the curator's go-ahead on the evidence bar (no publication, no RNA-seq). + +## Leads not followed +- *Williopsis (Cyberlindnera) jadinii* XP_020071302: hypothetical HMG-box protein, nothing on MAT. +- *Wickerhamomyces anomalus* (isolate KG16, JAHTLX01) is one of the seven Phaffomycetales genomes of Hession et al.; whether the supplement describes its MAT locus was not checked. +- *Ambrosiozyma*, *Citeromyces*, *Hansenula*, *Kuraishia*, *Pachysolen*: no MAT-named protein records or papers found. + +## Next steps +1. Fetch the S. schoenii annotation (GCA_054953955.1 or JBTFFQ) and the Hession et al. supplement (S1 Table, S3 Fig) for the coordinates. +2. Draft records for S. schoenii (chromosome IV) and *B. californica* with the existing `curate-db propose` workflow, plus a family decision (separate or MATog-like). +3. Curator: the family structure (one SLA2-MAT family for these genera, or per genus) and the evidence bar for the annotation-only *P. fabianii* lead. + +Sources (PubMed): 41849659, 41359681, 38492364. diff --git a/results/2026-10-29_near_tie/GENUS_CURATION_LIST.md b/results/2026-10-29_near_tie/GENUS_CURATION_LIST.md new file mode 100644 index 00000000..91396609 --- /dev/null +++ b/results/2026-10-29_near_tie/GENUS_CURATION_LIST.md @@ -0,0 +1,84 @@ +# Genera that need a curator ruling on MATsc against MTL (draft, 2026-10-29) + +From the 354-genome replay with the genome-level rule (`genus_table.tsv`, one row per genus: genomes, species, loci, family kept, mean best core-gene identity per family, gap, loci with MTL flank support). 156 `family_ambiguous` loci, 140 genomes, 27 genera. Identity gap = MATsc minus MTL, median over the genus's loci, in percentage points; the scores are best-hit identities of one gene (see README: about 6.5 points of noise per locus), so a gap under about 5 points is weak. + +Nothing here is a ruling. The choice per genus is one of: **leave** (the genome-level identity rule decides, with `family_ambiguous`), **scope** (the genus is added to the `taxonomic_scope` of a family, as for MATkp, MATog and MATpk; needs at least one reference record from the genus or evidence that the references transfer), or **hold** (leave unresolved and report both). + +## A. Consistent in the data, large gap (MATsc side): leave + +| Genus | genomes (species) | kept | gap | note | +|---|---|---|---|---| +| Williopsis | 9 (6) | MATsc 9 | +9.7 | | +| Taiozyma | 3 (3) | MATsc 3 | +12.8 | | +| Millerago | 2 (2) | MATsc 2 | +15.7 | | +| Sporopachydermia | 3 (2) | MATsc 3 | +8.3 | | +| Kregervanrija | 4 (3) | MATsc 4 | +7.3 | one near tie called different idiomorphs under the old rule | +| Hansenula | 6 (6) | MATsc 6 | +3.4 | gap small | +| Candida (sensu lato, 3 species) | 3 (3) | MATsc 3 | +5.5 | | +| *Pichia* other than *P. kudriavzevii* (11 species) | 27 (11) | MATsc 28 | +4.3 | not routed to MATpk (species scope); MATpk call at 31-60% identity in the genus-scope trial, MATsc `medium` before | + +Proposed: **leave**. A ruling would need a reference record from the genus. + +## B. Lean MTL, no flank support: curator to decide + +| Genus | genomes (species) | kept | gap | loci with PAP1/OBP1/PIK1 flank | +|---|---|---|---|---| +| Saccharomycopsis | 20 (6) | MTL 22, MATsc 5 | -5.0 | 0 | +| Ambrosiozyma | 13 (11) | MTL 15, MATsc 4 | -3.3 | 0 | +| Citeromyces | 3 (3) | MTL 3 | -3.1 | 0 | +| Saturnispora, Wenyingozyma | 1 each | MTL | -5.3, -11.2 | 0 | + +The family is split inside the genus for Saccharomycopsis and Ambrosiozyma (a few loci keep MATsc), which the per-locus rule produced and the genome-level rule only partly removes (a genome with a single cross-called locus is decided by it). No genome has two MTL flank genes, so MTL here is a choice by identity alone, the same weakness as the MTL-in-Serinales finding of #188. Proposed: **hold** and check synteny (SLA2/DIC1 against PAP1/OBP1/PIK1 neighbourhood) for one genome per genus before any scope. + +## C. Split or tied genera: needs the evidence + +| Genus | genomes (species) | kept | gap | flank loci | +|---|---|---|---|---| +| Petasospora | 11 (7) | MATsc 6, MTL 5 | 0.0 | 2 | +| Wickerhamomyces | 9 (9) | MATsc 8, MTL 1 | +4.3 | 0 | +| Barnettozyma | 8 (5) | MTL 6, MATsc 2 | -6.2 | 6 | +| Gotozyma, Komagataea, Ruyongia, Xingzhongia | 2 each | split | -0.2 to +6.4 | 0-1 | +| Saccharomycodes | 3 (2) | MTL 3 | -2.3 | 3 (one gene each) | + +Barnettozyma is the one genus where MTL flank genes show up in most loci (6 of 8, never two): worth a synteny look first. Saccharomycodes is close to Saccharomycetaceae by phylogeny, so MATsc would be the expected family although the identity leans MTL. Proposed: **hold**. + +## What would settle each + +1. Synteny of one genome per genus B and C (a figure with the flanks of both families). +2. A profile score of each locus's genes against both reference sets (alpha-box and HMG-box profiles), instead of best-hit identity. +3. A curated reference record from a genus (as for MATpk) before it is scoped. + +## Questions for the curator + +1. Accept **leave** for the genera of A? +2. For B and C: **hold** now, with a synteny check as the next step, or scope any genus now? +3. Is the order of work: Barnettozyma, Saccharomycopsis, Ambrosiozyma, Petasospora? + +## Synteny check (curator's order: Barnettozyma, Saccharomycopsis, Ambrosiozyma, Petasospora; all 156 loci were run) + +`flank_synteny.py` cuts each ambiguous locus +/- 40 kb and searches 35 flank proteins from the curated records with miniprot (SLA2, CHA1, APN2, DIC1 from the MATsc, MATyl and MATog records; PAP1, OBP1, PIK1 from the MTL records). A hit counts at 40% identity or more; `flank_synteny.tsv` has the nearest hit of each gene (identity@distance to the locus edge, 0 = inside the locus span). Cluster job 31430330. + +| Genus | loci | kept MATsc / MTL | SLA2 or CHA1 within 10 kb | DIC1 within 10 kb | PIK1, OBP1 or PAP1 within 20 kb | +|---|---|---|---|---|---| +| Barnettozyma | 8 | 2 / 6 | 7 | 7 | **0** | +| Saccharomycopsis | 27 | 5 / 22 | 21 | 0 | **0** | +| Ambrosiozyma | 19 | 4 / 15 | 13 | 13 | **0** | +| Petasospora | 11 | 6 / 5 | 11 | 11 | **0** | +| Wickerhamomyces | 9 | 8 / 1 | 9 | 9 | **0** | +| all 27 genera | 156 | 91 / 65 | 129 | 71 | **0** | + +Findings: + +1. **No MTL flank gene lies near any of the 156 loci, including the 65 where MTL was kept.** The MTL architecture has PAP1, OBP1 and PIK1 beside the locus; none is found within 20 kb at 40% identity or more. (The detector's own flank rule found one flank gene beside 38 MTL calls, never two; a hit below 40% identity is not counted here, and a divergent PIK1 in a distant genus could be missed. This is the weak point of the check.) +2. **SLA2 or CHA1 sits beside the locus in 129 of 156 loci**, and **DIC1 beside 71**, the same side-by-side as the *Komagataella* (MATkp) and *Ogataea* (MATog) cassettes: SLA2 on one side, DIC1 on the other. DIC1 is present in the Pichiales and Phaffomycetales genera (Barnettozyma 7 of 8, Ambrosiozyma 13 of 19, Petasospora 11 of 11, Wickerhamomyces 9 of 9) and absent in Saccharomycopsis and Saccharomycodes (Ascoideales, Saccharomycodales), which have SLA2 only. +3. So the identity preference for MTL in Saccharomycopsis, Ambrosiozyma, Barnettozyma and Citeromyces is not backed by the neighbourhood: these loci sit in an SLA2 (+ DIC1) neighbourhood, a MATsc, MATog or MATkp-like arrangement. The MTL calls are probably the closest reference by sequence only. + +### Proposed (for the curator; not implemented) + +- **Genera with SLA2 + DIC1 beside the locus** (Barnettozyma, Ambrosiozyma, Petasospora, Wickerhamomyces, Hansenula, Williopsis, Ruyongia, ...): a MATog/MATkp-type architecture. Candidate action: a reference record from one genus (a *Barnettozyma* or *Petasospora* species with a manual locus check) before scoping; until then the MATsc/MATog calls stand. +- **Rule change to consider:** an MTL call outside Serinales with no flank support should not win a cross-call against a family whose own flank genes are present (MATsc: SLA2). Applied to this replay it would keep MATsc in all 65 loci where MTL won. It makes the flank rule decide the family, the asymmetric evidence that the evaluation warned about, but here the asymmetry is complete (0 of 156). This needs the curator's decision. + +## Flank rule implemented (curator, 2026-10-30) +An out-of-scope MTL call with fewer than two of PAP1/OBP1/PIK1 within the window cannot win a cross-call against a family whose own flank gene (SLA2, DIC1) is in the call; it is set aside as `cross_call` (`flank_rule: true`), is left out of the genome mean, and the kept call's `family_ambiguous.reason` is `cross_call_flank_rule` (`flank_rule_set_aside` names the family). `src/MATPredict/detect/family_status.py`, 6 tests in `tests/detect/test_family_status.py`. + +Estimated effect on the 156 cross-called pairs of the v0.7.0 replay (`cross_call_pairs.tsv`, before the per-genome pooling): of the 51 pairs kept as MTL, **40 flip to MATsc** (Pichiaceae 14, Saccharomycopsidaceae 12, Wickerhamomycetaceae 7, Phaffomycetaceae 6, Pachysolenaceae 1); 11 stay MTL because the MATsc call has no SLA2/DIC1 (Saccharomycopsidaceae 8, Pichiaceae 3). This is not ground truth: MATsc is not the right family for these genera either (S. schoenii has its own `MATss` family now); the rule only removes the MTL call that has no flank gene of its own where a competitor has one. A v0.8 replay (`--preset v0.8`) is needed for exact numbers. diff --git a/results/2026-10-29_near_tie/README.md b/results/2026-10-29_near_tie/README.md new file mode 100644 index 00000000..3a2d1c10 --- /dev/null +++ b/results/2026-10-29_near_tie/README.md @@ -0,0 +1,42 @@ +# The near-tie margin: replaced by a genome-level decision (curator decision of 2026-10-29) + +`--cross-family-policy on` (PR #214) kept, for two families calling one locus where neither is scoped to the genome, the call with the higher best core-gene identity, except that within `NEAR_TIE_POINTS` = 3 points the family without a `confirm_outside_scope` rule (MATsc) was kept and flagged `family_unconfirmed`. The 3 was a draft value, never validated. The curator asked for it to be evaluated. + +## Evidence + +`cross_call_pairs.tsv`: the 156 cross-called locus pairs of the 354-genome replay (v5), 140 genomes, all MATsc against MTL; identity gap = kept minus other best core-gene identity. An independent evaluation (a second model, read-only, 23 tool calls, from this table and the full reports) found: + +- **No natural break at 3 points.** Per species the gaps run continuously from -3.3 to +1.7. The cutoff splits congeners: *Ambrosiozyma oregonensis* (-2.6) is kept as MATsc, *A. angophorae*, *A. neoplatypodis* and *A. ambrosiae* (-3.2 to -3.3) as MTL. +- **The score is too coarse for a 3-point rule.** The kept call's best alignment has a median 59 aa at 38% coverage, so one residue is about 1.7 points and the standard error of one identity is about 6.5 points. The two identities come from different reference proteins, often different genes (41 of 105 kept MATsc calls take their best identity from MATA2 or MATALPHA2, which the registry marks `idiomorph_informative: false`). +- **The MATsc tie-break is biased.** `sla2` is searched only by MATsc and PAP1/OBP1/PIK1 only by MTL, so gene counts and flank evidence are not comparable; no MTL call reached two flank genes. In 4 near ties the two families call different idiomorphs, so the tie-break silently sets MATa against alpha. +- **Per-locus decisions give genomes with two families** (4 genomes in v5), which cannot be right for one genome. +- **The flag measured "MTL was involved", not uncertainty**: every MTL call outside Serinales is flagged by the flank rule anyway, and every margin option flags 65-108 calls. + +The evaluation's counts for 156 pairs: margin 0: 5 near ties; 1: 19; 2: 34; 3: 42; 5: 72; genome-level mean with no margin: 0 mixed genomes and 1 lower-identity call kept, against 4 and 12 at 3 points. + +## Decision (option A) + +1. No margin and no preference for either family. +2. For every group of overlapping cross-family calls with no family scoped to the genome, the family is decided once for the genome: the higher mean, over those groups, of each family's best core-gene identity (equal means: the smaller family name). +3. Every such kept call carries `family_ambiguous` (identities of both families, their gap, the genome means and locus counts): GFF3 attribute `family_ambiguous=` and a YAML block. `family_unconfirmed` is now only the PAP1/OBP1/PIK1 flank rule for MTL outside Serinales. +4. The set-aside call's gene evidence (gene, role, identity, coverage, status) is kept in its `cross_call` note, so the two families can be compared gene for gene after a run. + +## Replay with the new rule (job 31429403; `compare_v5_v8.py`, `compare_v5_v8.txt`) + +354 genomes, `--preset v0.8`, the database of `main` (no MATpk): + +| | v5 (3-point margin) | v8 (genome-level) | +|---|---|---| +| genomes whose cross-called loci keep two families | 4 | 0 | +| `cross_call_near_tie` flags | 42 | 0 | +| `family_ambiguous` loci | - | 156 in 140 genomes (MATsc kept 91, MTL 65) | +| kept call has the lower identity | 12 | 1 (gap -1.5) | +| `mtl_outside_scope` unconfirmed / confirmed | 75 / 5 | 89 / 5 | +| genomes whose calls change | | 14 | + +The 14 genomes change family (and so idiomorph names, MATa against A and so on); for most the per-locus rule had kept MATsc where the genus leans to MTL. The extra 14 `mtl_outside_scope` flags are those MTL calls, which have no PAP1/OBP1/PIK1 support. + +## Open + +- There is still no ground truth: the family is a choice between two reference systems by best-hit identity. The evaluation suggests per-genus curator rulings (Ambrosiozyma, Saccharomycopsis, Pichia, the Wickerhamomycetaceae, as for MATkp, MATog and MATpk), HMG/alpha-box profile scoring against both reference sets, and synteny of a sample per genus. +- With the genome-level rule a genome with only one cross-called locus is decided by that locus alone (as before). diff --git a/results/2026-10-29_near_tie/compare_v5_v8.py b/results/2026-10-29_near_tie/compare_v5_v8.py new file mode 100644 index 00000000..8052ef3b --- /dev/null +++ b/results/2026-10-29_near_tie/compare_v5_v8.py @@ -0,0 +1,38 @@ +"""Before (v5: per-locus rule with a 3-point near-tie margin) and after (v8: the family decided once per genome by mean identity, +`family_ambiguous` on every unscoped cross-call) on the 354 yeast genomes. usage: python3 compare_v5_v8.py """ +import collections, glob, os, sys +import yaml + +R = sys.argv[1] + +def load(run): + out = {} + for d in sorted(glob.glob(f"{R}/{run}/runs/*")): + f = d + "/detection_report.yaml" + if os.path.exists(f): + out[os.path.basename(d)] = yaml.safe_load(open(f)).get("detected") or [] + return out + +v5, v8 = load("out_v5"), load("out_v8") +fam = lambda loci: sorted({l["family"].split(":")[1] for l in loci}) +print("genomes", len(v5), len(v8)) +mixed = lambda d: sum(1 for loci in d.values() if len(fam([l for l in loci if l.get("cross_call")])) > 1) +print("genomes whose cross-called loci keep two different families: v5", mixed(v5), "v8", mixed(v8)) +amb = [(g, l) for g, loci in v8.items() for l in loci if l.get("family_ambiguous")] +print("v8 loci with family_ambiguous:", len(amb), "in", len({g for g, _ in amb}), "genomes; kept family", collections.Counter(l["family"].split(":")[1] for g, l in amb)) +lower = sum(1 for g, l in amb if (l["family_ambiguous"]["gap"] or 0) < 0) +print("kept call has the lower identity:", lower) +gaps = [l["family_ambiguous"]["gap"] for g, l in amb if l["family_ambiguous"]["gap"] is not None] +print("gap (kept minus other), min/median/max:", min(gaps), sorted(gaps)[len(gaps) // 2], max(gaps)) +st = collections.Counter((l.get("family_status") or {}).get("status", "") + ":" + (l.get("family_status") or {}).get("reason", "") for loci in v8.values() for l in loci) +print("family_status v8:", dict(st)) +st5 = collections.Counter((l.get("family_status") or {}).get("status", "") + ":" + (l.get("family_status") or {}).get("reason", "") for loci in v5.values() for l in loci) +print("family_status v5:", dict(st5)) +changed = [] +for g in v5: + a = sorted((l["contig"], l["start"], l["family"].split(":")[1], l.get("idiomorph")) for l in v5[g]) + b = sorted((l["contig"], l["start"], l["family"].split(":")[1], l.get("idiomorph")) for l in v8.get(g, [])) + if a != b: changed.append((g, a, b)) +print("genomes whose calls differ:", len(changed)) +for g, a, b in changed[:40]: + print(" ", g, [x[2:] for x in a], "=>", [x[2:] for x in b]) diff --git a/results/2026-10-29_near_tie/compare_v5_v8.txt b/results/2026-10-29_near_tie/compare_v5_v8.txt new file mode 100644 index 00000000..c83d91e1 --- /dev/null +++ b/results/2026-10-29_near_tie/compare_v5_v8.txt @@ -0,0 +1,22 @@ +genomes 354 354 +genomes whose cross-called loci keep two different families: v5 4 v8 0 +v8 loci with family_ambiguous: 156 in 140 genomes; kept family Counter({'MATsc': 91, 'MTL': 65}) +kept call has the lower identity: 1 +gap (kept minus other), min/median/max: -1.5 5.29 64.41 +family_status v8: {':': 345, 'family_unconfirmed:mtl_outside_scope': 89, 'family_confirmed:mtl_outside_scope': 5} +family_status v5: {':': 317, 'family_unconfirmed:cross_call_near_tie': 42, 'family_unconfirmed:mtl_outside_scope': 75, 'family_confirmed:mtl_outside_scope': 5} +genomes whose calls differ: 14 + GCA_001936135.1_KJJ81 [('MTL', 'alpha'), ('MATsc', 'MATalpha')] => [('MTL', 'alpha'), ('MTL', 'alpha')] + GCA_003706315.3_ASM370631v3 [('MATsc', 'MATalpha'), ('MTL', 'A')] => [('MTL', 'alpha'), ('MTL', 'A')] + GCA_030557395.1_ASM3055739v1 [('MTL', 'A'), ('MATsc', 'MATalpha')] => [('MTL', 'A'), ('MTL', 'alpha')] + GCA_030567455.1_ASM3056745v1 [('MATsc', 'MATa')] => [('MTL', 'A')] + GCA_030570795.1_ASM3057079v1 [('MATsc', 'MATa')] => [('MTL', 'alpha')] + GCA_030574715.1_ASM3057471v1 [('MATsc', 'MATa'), ('MATsc', 'MATalpha')] => [('MTL', 'A'), ('MATsc', 'MATalpha')] + GCA_030579955.1_ASM3057995v1 [('MTL', 'A'), ('MATsc', 'MATalpha')] => [('MTL', 'A'), ('MTL', 'alpha')] + GCA_030580455.1_ASM3058045v1 [('MATsc', 'MATa')] => [('MTL', 'A')] + GCA_037355565.1_Ssch_CD502 [('MATsc', 'MATalpha')] => [('MTL', 'alpha')] + GCA_041498895.1_ASM4149889v1 [('MATsc', 'MATa')] => [('MTL', 'A')] + GCA_054085685.1_DORT_Sapseu_12645 [('MATsc', 'MATalpha')] => [('MTL', 'alpha')] + GCA_054085705.1_DORT_Sapseu_12643 [('MATsc', 'MATalpha')] => [('MTL', 'alpha')] + GCA_054953955.1_ASM5495395v1 [('MTL', 'alpha'), ('MTL', 'alpha'), ('MTL', 'alpha'), ('MTL', 'alpha'), ('MTL', 'A'), ('MATsc', 'MATalpha'), ('MTL', 'alpha')] => [('MTL', 'alpha'), ('MTL', 'alpha'), ('MTL', 'alpha'), ('MTL', 'alpha'), ('MTL', 'A'), ('MTL', 'alpha'), ('MTL', 'alpha')] + GCF_020623625.1_UHD_SCDLUD_16 [('MATsc', 'MATalpha')] => [('MTL', 'alpha')] diff --git a/results/2026-10-29_near_tie/cross_call_pairs.tsv b/results/2026-10-29_near_tie/cross_call_pairs.tsv new file mode 100644 index 00000000..4b0dc0df --- /dev/null +++ b/results/2026-10-29_near_tie/cross_call_pairs.tsv @@ -0,0 +1,157 @@ +genome species order family kept kept_idio kept_conf kept_class kept_best kept_genes other other_idio other_conf other_class other_best other_genes gap near status reason +GCA_001599195.1_JCM_3601_assembly_v001 Petasospora fabianii Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 58.18 MATA1|MATA2|sla2 MTL A medium mat_locus 57.14 MTLA1|MTLA2|PIK1 1.04 True family_unconfirmed cross_call_near_tie +GCA_001599295.1_JCM_9486_assembly_v001 Sporopachydermia quercuum Sporopachydermiales Sporopachydermiaceae MATsc MATa high mat_locus 50.94 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 MTL alpha high idiomorph_gene_only 42.67 MTLA1|MTLA2|MTLalpha1|MTLalpha2 8.27 False +GCA_001599995.1_JCM_7599_assembly_v001 Ambrosiozyma monospora Pichiales Pichiaceae MTL A high idiomorph_gene_only 49.15 MTLA1|MTLA2 MATsc MATa medium partial_locus 39.76 MATA1|sla2 9.39 False family_unconfirmed mtl_outside_scope +GCA_001661245.1_Pacta1_2 Pachysolen tannophilus Alaninales Pachysolenaceae MTL alpha medium mat_locus 53.45 MTLA1|MTLA2|MTLalpha1|MTLalpha2|PIK1 MATsc MATa medium mat_locus 44.21 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 9.24 False family_unconfirmed mtl_outside_scope +GCA_001936135.1_KJJ81 Saccharomycopsis fibuligera x Saccharomycopsis cf. fibuligera Ascoideales Saccharomycopsidaceae MATsc MATalpha medium mat_locus 47.222 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 MTL alpha medium idiomorph_gene_only 47.22 MTLA1|MTLA2|MTLalpha1|MTLalpha2 0.0 True family_unconfirmed cross_call_near_tie +GCA_001936135.1_KJJ81 Saccharomycopsis fibuligera x Saccharomycopsis cf. fibuligera Ascoideales Saccharomycopsidaceae MTL alpha medium idiomorph_gene_only 50.0 MTLA1|MTLA2|MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 37.33 MATALPHA1|MATA1|MATA2|sla2 12.67 False family_unconfirmed mtl_outside_scope +GCA_001936155.1_KPH12 Saccharomycopsis fibuligera Ascoideales Saccharomycopsidaceae MTL alpha medium idiomorph_gene_only 50.0 MTLA1|MTLA2|MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 37.33 MATALPHA1|MATA1|MATA2|sla2 12.67 False family_unconfirmed mtl_outside_scope +GCA_001936275.1_ATCC36309 Saccharomycopsis fibuligera Ascoideales Saccharomycopsidaceae MTL alpha medium idiomorph_gene_only 47.54 MTLA1|MTLA2|MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 37.33 MATALPHA1|MATA1|MATA2|sla2 10.21 False family_unconfirmed mtl_outside_scope +GCA_003123585.1_ASM312358v1 Barnettozyma californica Phaffomycetales Phaffomycetaceae MTL A high mat_locus 51.72 MTLA1|MTLA2|MTLalpha1|OBP1 MATsc MATa high mat_locus 42.53 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 9.19 False family_unconfirmed mtl_outside_scope +GCA_003123885.1_ASM312388v1 Barnettozyma californica Phaffomycetales Phaffomycetaceae MTL A high mat_locus 51.72 MTLA1|MTLA2|MTLalpha1|OBP1 MATsc MATa high mat_locus 42.53 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 9.19 False family_unconfirmed mtl_outside_scope +GCA_003243015.1_ASM324301v1 Saccharomycopsis capsularis Ascoideales Saccharomycopsidaceae MATsc MATalpha medium partial_locus 39.44 MATALPHA1|MATA2|sla2 MTL alpha medium idiomorph_gene_only 29.14 MTLalpha1|MTLalpha2 10.3 False +GCA_003327685.1_ASM332768v1 Pichia kluyveri Pichiales Pichiaceae MATsc MATalpha high mat_locus 51.85 MATALPHA1|MATALPHA2|sla2 MTL alpha high idiomorph_gene_only 35.71 MTLalpha1|MTLalpha2 16.14 False +GCA_003339355.1_UCD_Pferm_PL1 Pichia fermentans Pichiales Pichiaceae MATsc MATalpha high idiomorph_gene_only 46.55 MATALPHA1|MATALPHA2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 6.55 False +GCA_003339405.1_UCD_Pnorv_NO1 Pichia norvegensis Pichiales Pichiaceae MATsc MATalpha medium mat_locus 47.76 MATALPHA1|MATALPHA2|sla2 MTL alpha medium idiomorph_gene_only 42.7 MTLalpha1|MTLalpha2 5.06 False +GCA_003705185.2_ASM370518v2 Ambrosiozyma ambrosiae Pichiales Pichiaceae MTL alpha high idiomorph_gene_only 50.6 MTLalpha1|MTLalpha2 MATsc MATalpha medium idiomorph_gene_only 47.37 MATALPHA1|MATALPHA2|MATA2 3.23 False family_unconfirmed mtl_outside_scope +GCA_003705185.2_ASM370518v2 Ambrosiozyma ambrosiae Pichiales Pichiaceae MTL A high idiomorph_gene_only 42.62 MTLA1|MTLA2 MATsc MATa high mat_locus 35.0 MATA1|MATA2|sla2 7.62 False family_unconfirmed mtl_outside_scope +GCA_003705225.2_ASM370522v2 Ambrosiozyma vanderkliftii Pichiales Pichiaceae MATsc MATalpha medium mat_locus 48.21 MATALPHA1|MATALPHA2|MATA2|sla2 MTL alpha high idiomorph_gene_only 46.48 MTLalpha1|MTLalpha2 1.73 True family_unconfirmed cross_call_near_tie +GCA_003705515.2_ASM370551v2 Pichia kudriavzevii Pichiales Pichiaceae MATsc MATa medium mat_locus 51.06 MATALPHA1|MATALPHA2|MATA1|sla2 MTL alpha medium idiomorph_gene_only 42.42 MTLA1|MTLalpha1|MTLalpha2 8.64 False +GCA_003706235.2_ASM370623v2 Wenyingozyma naganishii Pichiales Pichiaceae MTL alpha medium idiomorph_gene_only 53.33 MTLA1|MTLA2|MTLalpha1|MTLalpha2 MATsc MATa medium mat_locus 42.11 MATALPHA1|MATALPHA2|MATA1|sla2 11.22 False family_unconfirmed mtl_outside_scope +GCA_003706315.3_ASM370631v3 Ambrosiozyma oregonensis Pichiales Pichiaceae MATsc MATalpha medium idiomorph_gene_only 45.45 MATALPHA1|MATALPHA2|MATA2 MTL alpha high idiomorph_gene_only 48.1 MTLalpha1|MTLalpha2 -2.65 True family_unconfirmed cross_call_near_tie +GCA_003706445.3_ASM370644v3 Williopsis mrakii Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 60.0 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 MTL A high mat_locus 48.39 MTLA1|MTLA2|MTLalpha1|PAP1 11.61 False +GCA_003706615.3_ASM370661v3 Gotozyma montana Phaffomycetales Phaffomycetaceae MATsc MATa medium partial_locus 55.93 MATA1|sla2 MTL A high idiomorph_gene_only 47.69 MTLA1|MTLA2 8.24 False +GCA_003706635.2_ASM370663v2 Ambrosiozyma maleeae Pichiales Pichiaceae MTL alpha medium mat_locus 45.83 MTLalpha1|MTLalpha2|PAP1 MATsc MATalpha medium mat_locus 37.97 MATALPHA1|MATALPHA2|sla2 7.86 False family_unconfirmed mtl_outside_scope +GCA_003706655.3_ASM370665v3 Barnettozyma californica Phaffomycetales Phaffomycetaceae MTL A high mat_locus 51.72 MTLA1|MTLA2|MTLalpha1|OBP1 MATsc MATa high mat_locus 42.53 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 9.19 False family_unconfirmed mtl_outside_scope +GCA_003706665.2_ASM370666v2 Barnettozyma hawaiiensis Phaffomycetales Phaffomycetaceae MATsc MATa medium mat_locus 46.875 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 MTL A high mat_locus 43.59 MTLA1|MTLA2|MTLalpha1|OBP1 3.28 False +GCA_003706765.3_ASM370676v3 Xingzhongia hampshirensis Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 54.55 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 MTL alpha high mat_locus 53.57 MTLA1|MTLA2|MTLalpha1|MTLalpha2|PAP1 0.98 True family_unconfirmed cross_call_near_tie +GCA_003707015.3_ASM370701v3 Wickerhamomyces canadensis Phaffomycetales Wickerhamomycetaceae MATsc MATa medium partial_locus 62.5 MATA1|sla2 MTL A high idiomorph_gene_only 58.18 MTLA1|MTLA2 4.32 False +GCA_003707205.3_ASM370720v3 Kregervanrija delftensis Pichiales Pichiaceae MATsc MATa medium idiomorph_gene_only 51.85 MATALPHA1|MATALPHA2|MATA1 MTL alpha high idiomorph_gene_only 41.67 MTLA1|MTLA2|MTLalpha1|MTLalpha2 10.18 False +GCA_003707275.3_ASM370727v3 Kregervanrija fluxuum Pichiales Pichiaceae MATsc MATa medium idiomorph_gene_only 38.89 MATALPHA1|MATALPHA2|MATA1 MTL alpha medium idiomorph_gene_only 38.67 MTLA1|MTLalpha1|MTLalpha2 0.22 True family_unconfirmed cross_call_near_tie +GCA_003707675.3_ASM370767v3 Ambrosiozyma philentoma Pichiales Pichiaceae MTL alpha high idiomorph_gene_only 49.4 MTLalpha1|MTLalpha2 MATsc MATalpha medium idiomorph_gene_only 39.44 MATALPHA1|MATALPHA2|MATA2 9.96 False family_unconfirmed mtl_outside_scope +GCA_003707675.3_ASM370767v3 Ambrosiozyma philentoma Pichiales Pichiaceae MTL A high idiomorph_gene_only 42.19 MTLA1|MTLA2 MATsc MATa high mat_locus 37.31 MATA1|MATA2|sla2 4.88 False family_unconfirmed mtl_outside_scope +GCA_003707735.2_ASM370773v2 Candida freyschussii Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 56.36 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 50.82 MTLA1|MTLA2 5.54 False +GCA_003707885.2_ASM370788v2 Komagataea salicaria Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 55.0 MATALPHA1|MATA1|MATA2|sla2 MTL A high homothallic_candidate 40.48 MTLA1|MTLA2|MTLalpha1|OBP1 14.52 False +GCA_003708265.3_ASM370826v3 Williopsis vartiovaarae Phaffomycetales Wickerhamomycetaceae MATsc MATa medium mat_locus 52.54 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 50.0 MTLA1|MTLA2 2.54 True family_unconfirmed cross_call_near_tie +GCA_003708285.2_ASM370828v2 Petasospora xylosilytica Phaffomycetales Wickerhamomycetaceae MATsc MATa medium partial_locus 56.36 MATA1|sla2 MTL A medium mat_locus 56.36 MTLA1|MTLA2|PIK1 0.0 True family_unconfirmed cross_call_near_tie +GCA_003708295.3_ASM370829v3 Petasospora mycetangii Phaffomycetales Wickerhamomycetaceae MTL A high idiomorph_gene_only 50.0 MTLA1|MTLA2 MATsc MATa medium mat_locus 43.02 MATA1|MATA2|sla2 6.98 False family_unconfirmed mtl_outside_scope +GCA_003709245.3_ASM370924v3 Williopsis saturnus Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 63.64 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 MTL A high mat_locus 46.38 MTLA1|MTLA2|MTLalpha1|PAP1 17.26 False +GCA_004931855.1_ASM493185v1 Pichia inconspicua Pichiales Pichiaceae MATsc MATalpha high idiomorph_gene_only 40.48 MATALPHA1|MATALPHA2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 0.48 True family_unconfirmed cross_call_near_tie +GCA_010994365.1_ASM1099436v1 Saccharomycopsis schoenii Ascoideales Saccharomycopsidaceae MTL alpha medium idiomorph_gene_only 50.0 MTLA1|MTLalpha1|MTLalpha2 MATsc MATalpha medium idiomorph_gene_only 45.71 MATALPHA1|MATALPHA2|MATA1 4.29 False family_unconfirmed mtl_outside_scope +GCA_012062855.1_ASM1206285v1 Saccharomycopsis fibuligera Ascoideales Saccharomycopsidaceae MTL alpha medium idiomorph_gene_only 50.0 MTLA1|MTLA2|MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 37.33 MATALPHA1|MATA1|MATA2|sla2 12.67 False family_unconfirmed mtl_outside_scope +GCA_017948575.1_ASM1794857v1 Williopsis subsufficiens Phaffomycetales Wickerhamomycetaceae MATsc MATa medium mat_locus 63.64 MATALPHA1|MATALPHA2|MATA1|sla2 MTL A high mat_locus 49.21 MTLA1|MTLA2|MTLalpha1|MTLalpha2|PAP1 14.43 False +GCA_018343965.1_ASM1834396v1 Petasospora fabianii Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 58.18 MATA1|MATA2|sla2 MTL A medium mat_locus 57.14 MTLA1|MTLA2|PIK1 1.04 True family_unconfirmed cross_call_near_tie +GCA_019096115.1_ASM1909611v1 Pichia kluyveri Pichiales Pichiaceae MATsc MATalpha high mat_locus 51.85 MATALPHA1|MATALPHA2|sla2 MTL alpha high idiomorph_gene_only 35.71 MTLalpha1|MTLalpha2 16.14 False +GCA_019155655.1_ASM1915565v1 Kregervanrija delftensis Pichiales Pichiaceae MATsc MATa medium mat_locus 51.85 MATALPHA1|MATALPHA2|MATA1|sla2 MTL alpha high idiomorph_gene_only 41.67 MTLA1|MTLA2|MTLalpha1|MTLalpha2 10.18 False +GCA_020280145.1_ASM2028014v1 Gotozyma botsteinii Phaffomycetales Phaffomycetaceae MTL alpha high mat_locus 52.46 MTLA1|MTLA2|MTLalpha1|PAP1 MATsc MATa medium mat_locus 45.0 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 7.46 False family_unconfirmed mtl_outside_scope +GCA_020995425.1_ASM2099542v1 Williopsis sargentensis Phaffomycetales Wickerhamomycetaceae MATsc MATa medium mat_locus 52.54 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 50.0 MTLA1|MTLA2 2.54 True family_unconfirmed cross_call_near_tie +GCA_022641835.1_ASM2264183v1 Petasospora fabianii Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 58.18 MATA1|MATA2|sla2 MTL A medium mat_locus 57.14 MTLA1|MTLA2|PIK1 1.04 True family_unconfirmed cross_call_near_tie +GCA_023497445.1_ASM2349744v1 Saccharomycopsis fibuligera Ascoideales Saccharomycopsidaceae MTL alpha medium idiomorph_gene_only 47.222 MTLA1|MTLA2|MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 37.33 MATALPHA1|MATA1|MATA2|sla2 9.89 False family_unconfirmed mtl_outside_scope +GCA_023627795.1_ASM2362779v1 Barnettozyma californica Phaffomycetales Phaffomycetaceae MTL A high mat_locus 51.72 MTLA1|MTLA2|MTLalpha1|OBP1 MATsc MATa high mat_locus 42.53 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 9.19 False family_unconfirmed mtl_outside_scope +GCA_023629335.1_ASM2362933v1 Pichia kluyveri Pichiales Pichiaceae MATsc MATalpha high mat_locus 51.85 MATALPHA1|MATALPHA2|sla2 MTL alpha high idiomorph_gene_only 35.71 MTLalpha1|MTLalpha2 16.14 False +GCA_025531525.1_ASM2553152v1 Pichia sp. P7020A Pichiales Pichiaceae MATsc MATalpha high mat_locus 46.55 MATALPHA1|MATALPHA2|sla2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 6.55 False +GCA_025531535.1_ASM2553153v1 Pichia sp. F1605B Pichiales Pichiaceae MATsc MATalpha high mat_locus 46.55 MATALPHA1|MATALPHA2|sla2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 6.55 False +GCA_025531545.1_ASM2553154v1 Pichia inconspicua Pichiales Pichiaceae MATsc MATalpha high idiomorph_gene_only 40.48 MATALPHA1|MATALPHA2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 0.48 True family_unconfirmed cross_call_near_tie +GCA_025531555.1_ASM2553155v1 Pichia inconspicua Pichiales Pichiaceae MATsc MATalpha high mat_locus 40.48 MATALPHA1|MATALPHA2|sla2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 0.48 True family_unconfirmed cross_call_near_tie +GCA_029299855.1_ASM2929985v1 Saccharomycopsidaceae sp. Ascoideales Saccharomycopsidaceae MTL alpha high idiomorph_gene_only 42.34 MTLalpha1|MTLalpha2 MATsc MATalpha medium idiomorph_gene_only 37.33 MATALPHA1|MATA2 5.01 False family_unconfirmed mtl_outside_scope +GCA_030267745.1_ASM3026774v1 Ambrosiozyma monospora Pichiales Pichiaceae MATsc MATalpha medium idiomorph_gene_only 44.78 MATALPHA1|MATALPHA2 MTL alpha medium idiomorph_gene_only 43.28 MTLalpha1|MTLalpha2 1.5 True family_unconfirmed cross_call_near_tie +GCA_030556525.1_ASM3055652v1 Wickerhamomyces quercuum Phaffomycetales Wickerhamomycetaceae MATsc MATa medium partial_locus 60.34 MATA1|sla2 MTL A high mat_locus 54.24 MTLA1|MTLA2|OBP1 6.1 False +GCA_030557365.1_ASM3055736v1 Williopsis sargentensis Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 58.18 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 MTL A high mat_locus 48.44 MTLA1|MTLA2|MTLalpha1|PAP1 9.74 False +GCA_030557395.1_ASM3055739v1 Ambrosiozyma platypodis Pichiales Pichiaceae MATsc MATalpha medium idiomorph_gene_only 45.76 MATALPHA1|MATALPHA2|MATA2 MTL alpha high idiomorph_gene_only 46.99 MTLalpha1|MTLalpha2 -1.23 True family_unconfirmed cross_call_near_tie +GCA_030557395.1_ASM3055739v1 Ambrosiozyma platypodis Pichiales Pichiaceae MTL A high idiomorph_gene_only 43.08 MTLA1|MTLA2 MATsc MATa high mat_locus 35.82 MATA1|MATA2|sla2 7.26 False family_unconfirmed mtl_outside_scope +GCA_030557705.1_ASM3055770v1 Taiozyma odintsovae Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 55.93 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 43.08 MTLA1|MTLA2 12.85 False +GCA_030558335.1_ASM3055833v1 Petasospora stauntonica Phaffomycetales Wickerhamomycetaceae MTL A high idiomorph_gene_only 52.38 MTLA1|MTLA2 MATsc MATa medium partial_locus 44.93 MATA1|sla2 7.45 False family_unconfirmed mtl_outside_scope +GCA_030558495.1_ASM3055849v1 Pichia insulana Pichiales Pichiaceae MATsc MATalpha high mat_locus 41.67 MATALPHA1|MATALPHA2|sla2 MTL alpha high idiomorph_gene_only 41.18 MTLalpha1|MTLalpha2 0.49 True family_unconfirmed cross_call_near_tie +GCA_030561065.1_ASM3056106v1 Sporopachydermia cereana Sporopachydermiales Sporopachydermiaceae MATsc MATalpha medium idiomorph_gene_only 42.47 MATALPHA1|MATALPHA2 MTL alpha medium idiomorph_gene_only 38.81 MTLalpha1|MTLalpha2 3.66 False +GCA_030563305.1_ASM3056330v1 Petasospora maesae Phaffomycetales Wickerhamomycetaceae MTL A high mat_locus 56.36 MTLA1|MTLA2|PIK1 MATsc MATa medium partial_locus 50.0 MATA1|sla2 6.36 False family_unconfirmed mtl_outside_scope +GCA_030563965.1_ASM3056396v1 Pichia cactophila Pichiales Pichiaceae MATsc MATa medium partial_locus 50.0 MATALPHA2|MATA1|sla2 MTL alpha medium idiomorph_gene_only 48.15 MTLA1|MTLA2|MTLalpha2 1.85 True family_unconfirmed cross_call_near_tie +GCA_030564545.1_ASM3056454v1 Saturnispora mendoncae Pichiales Pichiaceae MTL alpha high idiomorph_gene_only 48.15 MTLalpha1|MTLalpha2 MATsc MATalpha high idiomorph_gene_only 42.86 MATALPHA1|MATALPHA2 5.29 False family_unconfirmed mtl_outside_scope +GCA_030565225.1_ASM3056522v1 Allodekkera sacchari Pichiales Pichiaceae MATsc MATalpha medium mat_locus 50.0 MATALPHA1|MATALPHA2|MATA1|sla2 MTL alpha high idiomorph_gene_only 38.46 MTLalpha1|MTLalpha2 11.54 False +GCA_030567395.1_ASM3056739v1 Citeromyces hawaiiensis Pichiales Pichiaceae MTL alpha medium idiomorph_gene_only 45.0 MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 41.89 MATALPHA1|MATALPHA2|sla2 3.11 False family_unconfirmed mtl_outside_scope +GCA_030567455.1_ASM3056745v1 Komagataea norvegica Phaffomycetales Wickerhamomycetaceae MATsc MATa medium mat_locus 56.36 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 58.18 MTLA1|MTLA2 -1.82 True family_unconfirmed cross_call_near_tie +GCA_030567475.1_ASM3056747v1 Ambrosiozyma angophorae Pichiales Pichiaceae MTL alpha high idiomorph_gene_only 54.17 MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 50.88 MATALPHA1|MATALPHA2|MATA2|sla2 3.29 False family_unconfirmed mtl_outside_scope +GCA_030567475.1_ASM3056747v1 Ambrosiozyma angophorae Pichiales Pichiaceae MTL alpha high idiomorph_gene_only 54.17 MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 50.88 MATALPHA1|MATALPHA2|MATA2|sla2 3.29 False family_unconfirmed mtl_outside_scope +GCA_030567475.1_ASM3056747v1 Ambrosiozyma angophorae Pichiales Pichiaceae MTL alpha high idiomorph_gene_only 54.17 MTLalpha1|MTLalpha2 MATsc MATalpha high mat_locus 50.88 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 3.29 False family_unconfirmed mtl_outside_scope +GCA_030567495.1_ASM3056749v1 Ambrosiozyma neoplatypodis Pichiales Pichiaceae MTL alpha high idiomorph_gene_only 40.3 MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 37.04 MATALPHA1|MATALPHA2|MATA2|sla2 3.26 False family_unconfirmed mtl_outside_scope +GCA_030568845.1_ASM3056884v1 Millerago galiae Phaffomycetales Phaffomycetaceae MATsc MATa medium mat_locus 58.49 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 44.44 MTLA1|MTLA2 14.05 False +GCA_030569135.1_ASM3056913v1 Pichia inconspicua Pichiales Pichiaceae MATsc MATalpha high idiomorph_gene_only 40.48 MATALPHA1|MATALPHA2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 0.48 True family_unconfirmed cross_call_near_tie +GCA_030569275.1_ASM3056927v1 Candida sanyiensis Phaffomycetales Phaffomycetaceae MATsc MATa medium partial_locus 51.72 MATA1|sla2 MTL A high idiomorph_gene_only 48.28 MTLA1|MTLA2 3.44 False +GCA_030569515.1_ASM3056951v1 Barnettozyma vustinii Phaffomycetales Phaffomycetaceae MATsc MATa medium partial_locus 50.91 MATA1|sla2 MTL A high idiomorph_gene_only 50.72 MTLA1|MTLA2 0.19 True family_unconfirmed cross_call_near_tie +GCA_030569745.1_ASM3056974v1 Petasospora bimundalis Phaffomycetales Wickerhamomycetaceae MTL A high idiomorph_gene_only 45.59 MTLA1|MTLA2 MATsc MATa high mat_locus 41.38 MATA1|MATA2|sla2 4.21 False family_unconfirmed mtl_outside_scope +GCA_030570285.1_ASM3057028v1 Pichia norvegensis Pichiales Pichiaceae MATsc MATalpha medium mat_locus 47.76 MATALPHA1|MATALPHA2|sla2 MTL alpha medium idiomorph_gene_only 42.7 MTLalpha1|MTLalpha2 5.06 False +GCA_030570795.1_ASM3057079v1 Wickerhamomyces silvicola Phaffomycetales Wickerhamomycetaceae MATsc MATa medium mat_locus 40.32 MATALPHA1|MATALPHA2|MATA1|sla2 MTL alpha medium idiomorph_gene_only 41.54 MTLA1|MTLA2|MTLalpha1|MTLalpha2 -1.22 True family_unconfirmed cross_call_near_tie +GCA_030570875.1_ASM3057087v1 Citeromyces matritensis Pichiales Pichiaceae MTL alpha medium idiomorph_gene_only 43.59 MTLA1|MTLalpha1|MTLalpha2 MATsc MATalpha high mat_locus 37.65 MATALPHA1|MATALPHA2|sla2 5.94 False family_unconfirmed mtl_outside_scope +GCA_030571235.1_ASM3057123v1 Wickerhamomyces sp. yHMH26 Phaffomycetales Wickerhamomycetaceae MATsc MATa medium mat_locus 59.32 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 53.45 MTLA1|MTLA2 5.87 False +GCA_030572235.1_ASM3057223v1 Ambrosiozyma kamigamensis Pichiales Pichiaceae MATsc MATalpha medium mat_locus 47.46 MATALPHA1|MATALPHA2|MATA2|sla2 MTL alpha high idiomorph_gene_only 40.3 MTLalpha1|MTLalpha2 7.16 False +GCA_030572555.1_ASM3057255v1 Candida sp. Saccharomycetales MATsc MATa medium mat_locus 62.07 MATA1|MATA2|sla2 MTL A high mat_locus 55.17 MTLA1|MTLA2|OBP1 6.9 False +GCA_030572875.1_ASM3057287v1 Wickerhamomyces kurtzmanii Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 59.02 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 MTL alpha high idiomorph_gene_only 49.23 MTLA1|MTLA2|MTLalpha1|MTLalpha2 9.79 False +GCA_030574175.1_ASM3057417v1 Williopsis subsufficiens Phaffomycetales Wickerhamomycetaceae MATsc MATa medium mat_locus 63.64 MATALPHA1|MATALPHA2|MATA1|sla2 MTL A medium mat_locus 50.79 MTLA1|MTLA2|MTLalpha1|PAP1 12.85 False +GCA_030574595.1_ASM3057459v1 Ruyongia chambardii Phaffomycetales Wickerhamomycetaceae MATsc MATalpha medium mat_locus 47.95 MATALPHA1|MATALPHA2|MATA2|sla2 MTL alpha medium idiomorph_gene_only 44.3 MTLA1|MTLalpha1|MTLalpha2 3.65 False +GCA_030574595.1_ASM3057459v1 Ruyongia chambardii Phaffomycetales Wickerhamomycetaceae MATsc MATa medium partial_locus 58.18 MATA1|sla2 MTL A high idiomorph_gene_only 50.0 MTLA1|MTLA2 8.18 False +GCA_030574715.1_ASM3057471v1 Xingzhongia strasburgensis Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 54.55 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 55.93 MTLA1|MTLA2 -1.38 True family_unconfirmed cross_call_near_tie +GCA_030574855.1_ASM3057485v1 Taiozyma rabaulensis Phaffomycetales Wickerhamomycetaceae MATsc MATa medium mat_locus 57.63 MATA1|MATA2|sla2 MTL A high mat_locus 44.83 MTLA1|MTLA2|PIK1 12.8 False +GCA_030574875.1_ASM3057487v1 Taiozyma peoriensis Phaffomycetales Wickerhamomycetaceae MATsc MATa medium mat_locus 56.36 MATA1|MATA2|sla2 MTL A high mat_locus 46.15 MTLA1|MTLA2|MTLalpha1|PAP1 10.21 False +GCA_030575215.1_ASM3057521v1 Saccharomycopsis javanensis Ascoideales Saccharomycopsidaceae MTL alpha high idiomorph_gene_only 52.38 MTLalpha1|MTLalpha2 MATsc MATalpha medium idiomorph_gene_only 37.89 MATALPHA1|MATALPHA2|MATA2 14.49 False family_unconfirmed mtl_outside_scope +GCA_030579615.1_ASM3057961v1 Sporopachydermia quercuum Sporopachydermiales Sporopachydermiaceae MATsc MATa high mat_locus 50.94 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 MTL alpha high idiomorph_gene_only 42.67 MTLA1|MTLA2|MTLalpha1|MTLalpha2 8.27 False +GCA_030579935.1_ASM3057993v1 Ambrosiozyma cicatricosa Pichiales Pichiaceae MATsc MATalpha medium idiomorph_gene_only 44.78 MATALPHA1|MATALPHA2 MTL alpha medium idiomorph_gene_only 43.28 MTLalpha1|MTLalpha2 1.5 True family_unconfirmed cross_call_near_tie +GCA_030579955.1_ASM3057995v1 Ambrosiozyma monospora Pichiales Pichiaceae MATsc MATalpha medium idiomorph_gene_only 44.78 MATALPHA1|MATALPHA2 MTL alpha medium idiomorph_gene_only 43.28 MTLalpha1|MTLalpha2 1.5 True family_unconfirmed cross_call_near_tie +GCA_030579955.1_ASM3057995v1 Ambrosiozyma monospora Pichiales Pichiaceae MTL A high idiomorph_gene_only 49.15 MTLA1|MTLA2 MATsc MATa medium partial_locus 39.76 MATA1|sla2 9.39 False family_unconfirmed mtl_outside_scope +GCA_030580035.1_ASM3058003v1 Pichia pseudocactophila Pichiales Pichiaceae MATsc MATalpha medium partial_locus 44.78 MATALPHA1|MATA2|sla2 MTL alpha medium idiomorph_gene_only 41.18 MTLalpha1|MTLalpha2 3.6 False +GCA_030580115.1_ASM3058011v1 Kregervanrija pseudodelftensis Pichiales Pichiaceae MATsc MATa medium idiomorph_gene_only 46.27 MATALPHA1|MATALPHA2|MATA1 MTL alpha medium idiomorph_gene_only 41.94 MTLA1|MTLalpha1|MTLalpha2 4.33 False +GCA_030580415.1_ASM3058041v1 Citeromyces nyonsensis Pichiales Pichiaceae MTL alpha high idiomorph_gene_only 43.75 MTLalpha1|MTLalpha2 MATsc MATalpha high mat_locus 40.62 MATALPHA1|MATALPHA2|sla2 3.13 False family_unconfirmed mtl_outside_scope +GCA_030580455.1_ASM3058045v1 Barnettozyma sp. UFMG-CM-Y5996 Phaffomycetales Phaffomycetaceae MATsc MATa medium mat_locus 56.36 MATALPHA1|MATALPHA2|MATA1|sla2 MTL A high mat_locus 57.14 MTLA1|MTLA2|MTLalpha1|OBP1 -0.78 True family_unconfirmed cross_call_near_tie +GCA_030582155.1_ASM3058215v1 Hansenula lynferdii Phaffomycetales Wickerhamomycetaceae MATsc MATa medium mat_locus 54.55 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 50.88 MTLA1|MTLA2 3.67 False +GCA_030582235.1_ASM3058223v1 Ruyongia ponderosae Phaffomycetales Wickerhamomycetaceae MTL A high mat_locus 67.65 MTLA1|MTLA2|PIK1 MATsc MATa high mat_locus 56.36 MATA1|MATA2|sla2 11.29 False family_unconfirmed mtl_outside_scope +GCA_030582255.1_ASM3058225v1 Hansenula subpelliculosa Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 58.18 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 55.0 MTLA1|MTLA2 3.18 False +GCA_030582275.1_ASM3058227v1 Waltiozyma pijperi Phaffomycetales Wickerhamomycetaceae MTL A medium mat_locus 56.36 MTLA1|MTLA2|MTLalpha1|MTLalpha2|PIK1 MATsc MATa high mat_locus 52.73 MATALPHA1|MATA1|MATA2|sla2 3.63 False family_unconfirmed mtl_outside_scope +GCA_030583195.1_ASM3058319v1 Saccharomycopsis fibuligera Ascoideales Saccharomycopsidaceae MTL alpha medium idiomorph_gene_only 50.0 MTLA1|MTLA2|MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 37.33 MATALPHA1|MATA1|MATA2|sla2 12.67 False family_unconfirmed mtl_outside_scope +GCA_030585085.1_ASM3058508v1 Petasospora xishuangbannaensis Phaffomycetales Wickerhamomycetaceae MTL alpha medium mat_locus 56.36 MTLA1|MTLA2|MTLalpha1|PIK1 MATsc MATa medium mat_locus 47.37 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 8.99 False family_unconfirmed mtl_outside_scope +GCA_030674255.1_ASM3067425v1 Hansenula queroliae Phaffomycetales Wickerhamomycetaceae MATsc MATa medium mat_locus 52.46 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 51.72 MTLA1|MTLA2 0.74 True family_unconfirmed cross_call_near_tie +GCA_030770065.1_ASM3077006v1 Pichia fermentans Pichiales Pichiaceae MATsc MATalpha high mat_locus 46.55 MATALPHA1|MATALPHA2|sla2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 6.55 False +GCA_031125485.1_ASM3112548v1 Saccharomycopsis javanensis Ascoideales Saccharomycopsidaceae MTL alpha high idiomorph_gene_only 52.38 MTLalpha1|MTLalpha2 MATsc MATalpha medium idiomorph_gene_only 37.89 MATALPHA1|MATALPHA2|MATA2 14.49 False family_unconfirmed mtl_outside_scope +GCA_031125595.1_ASM3112559v1 Saccharomycopsis capsularis Ascoideales Saccharomycopsidaceae MATsc MATalpha medium mat_locus 39.44 MATALPHA1|MATA1|MATA2|sla2 MTL alpha medium mat_locus 28.65 MTLalpha1|MTLalpha2|PIK1 10.79 False +GCA_031125625.1_ASM3112562v1 Saccharomycopsis capsularis Ascoideales Saccharomycopsidaceae MTL alpha high idiomorph_gene_only 49.32 MTLalpha1|MTLalpha2 MATsc MATalpha medium partial_locus 44.62 MATALPHA1|MATA2|sla2 4.7 False family_unconfirmed mtl_outside_scope +GCA_031125665.1_ASM3112566v1 Saccharomycopsis capsularis Ascoideales Saccharomycopsidaceae MATsc MATalpha medium partial_locus 39.44 MATALPHA1|MATA2|sla2 MTL alpha medium idiomorph_gene_only 29.14 MTLalpha1|MTLalpha2 10.3 False +GCA_031125675.1_ASM3112567v1 Saccharomycopsis capsularis Ascoideales Saccharomycopsidaceae MATsc MATalpha medium partial_locus 39.44 MATALPHA1|MATA2|sla2 MTL alpha medium idiomorph_gene_only 29.14 MTLalpha1|MTLalpha2 10.3 False +GCA_031125685.1_ASM3112568v1 Saccharomycopsis capsularis Ascoideales Saccharomycopsidaceae MATsc MATalpha medium partial_locus 39.44 MATALPHA1|MATA2|sla2 MTL alpha medium idiomorph_gene_only 29.14 MTLalpha1|MTLalpha2 10.3 False +GCA_031126305.1_ASM3112630v1 Saccharomycopsis fibuligera Ascoideales Saccharomycopsidaceae MTL alpha high idiomorph_gene_only 42.34 MTLalpha1|MTLalpha2 MATsc MATalpha medium idiomorph_gene_only 37.33 MATALPHA1|MATA2 5.01 False family_unconfirmed mtl_outside_scope +GCA_037040195.1_ASM3704019v1 Pichia inconspicua Pichiales Pichiaceae MATsc MATalpha high idiomorph_gene_only 40.48 MATALPHA1|MATALPHA2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 0.48 True family_unconfirmed cross_call_near_tie +GCA_037041065.1_ASM3704106v1 Hansenula sp. DX7706-1 Phaffomycetales Wickerhamomycetaceae MATsc MATa medium partial_locus 61.02 MATA1|sla2 MTL A high idiomorph_gene_only 51.72 MTLA1|MTLA2 9.3 False +GCA_037041205.1_ASM3704120v1 Pichia fermentans Pichiales Pichiaceae MATsc MATalpha medium idiomorph_gene_only 40.0 MATALPHA1|MATALPHA2|MATA2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 0.0 True family_unconfirmed cross_call_near_tie +GCA_037041255.1_ASM3704125v1 Pichia fermentans Pichiales Pichiaceae MATsc MATalpha medium mat_locus 40.0 MATALPHA1|MATALPHA2|MATA2|sla2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 0.0 True family_unconfirmed cross_call_near_tie +GCA_037041515.1_ASM3704151v1 Pichia fermentans Pichiales Pichiaceae MATsc MATalpha high mat_locus 46.55 MATALPHA1|MATALPHA2|sla2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 6.55 False +GCA_037041755.1_ASM3704175v1 Pichia fermentans Pichiales Pichiaceae MATsc MATalpha medium mat_locus 40.0 MATALPHA1|MATALPHA2|MATA2|sla2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 0.0 True family_unconfirmed cross_call_near_tie +GCA_037042445.1_ASM3704244v1 Hansenula sp. Y91-04 Phaffomycetales Wickerhamomycetaceae MATsc MATa medium partial_locus 61.02 MATA1|sla2 MTL A high idiomorph_gene_only 51.72 MTLA1|MTLA2 9.3 False +GCA_037102705.1_ASM3710270v1 Pichia kluyveri Pichiales Pichiaceae MATsc MATalpha high mat_locus 51.85 MATALPHA1|MATALPHA2|sla2 MTL alpha high idiomorph_gene_only 35.71 MTLalpha1|MTLalpha2 16.14 False +GCA_037355565.1_Ssch_CD502 Saccharomycopsis schoenii Ascoideales Saccharomycopsidaceae MATsc MATalpha medium idiomorph_gene_only 37.14 MATALPHA1|MATA2 MTL alpha medium idiomorph_gene_only 39.76 MTLalpha1|MTLalpha2 -2.62 True family_unconfirmed cross_call_near_tie +GCA_039700735.1_ASM3970073v1 Pichia pseudocactophila Pichiales Pichiaceae MATsc MATalpha medium partial_locus 44.78 MATALPHA1|MATA2|sla2 MTL alpha medium idiomorph_gene_only 41.18 MTLalpha1|MTLalpha2 3.6 False +GCA_039700745.1_ASM3970074v1 Pichia cactophila Pichiales Pichiaceae MATsc MATalpha high mat_locus 40.48 MATALPHA1|MATALPHA2|sla2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 0.48 True family_unconfirmed cross_call_near_tie +GCA_040365455.1_JCM_7609_assembly_v001 Saccharomycopsis fibuligera Ascoideales Saccharomycopsidaceae MTL alpha medium idiomorph_gene_only 47.54 MTLA2|MTLalpha1|MTLalpha2 MATsc MATalpha medium idiomorph_gene_only 37.33 MATALPHA1|MATA2 10.21 False family_unconfirmed mtl_outside_scope +GCA_040365455.1_JCM_7609_assembly_v001 Saccharomycopsis fibuligera Ascoideales Saccharomycopsidaceae MTL alpha medium idiomorph_gene_only 50.0 MTLA1|MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 37.33 MATALPHA1|MATA1|MATA2|sla2 12.67 False family_unconfirmed mtl_outside_scope +GCA_040802125.1_ASM4080212v1 Millerago phaffii Phaffomycetales Phaffomycetaceae MATsc MATa medium mat_locus 60.38 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 43.06 MTLA1|MTLA2 17.32 False +GCA_040938015.1_ASM4093801v1 Pichia sp. VM-2024a Pichiales Pichiaceae MATsc MATalpha high idiomorph_gene_only 40.48 MATALPHA1|MATALPHA2 MTL alpha high idiomorph_gene_only 40.0 MTLalpha1|MTLalpha2 0.48 True family_unconfirmed cross_call_near_tie +GCA_041498895.1_ASM4149889v1 Pichiaceae sp. Pichiales Pichiaceae MATsc MATa high mat_locus 41.89 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 42.86 MTLA1|MTLA2 -0.97 True family_unconfirmed cross_call_near_tie +GCA_047651925.1_ASM4765192v1 Saccharomyces cerevisiae_Schizosaccharomyces pombe fusant MATsc MATalpha medium idiomorph_gene_only 100.0 MATALPHA1|MATALPHA2|MATA2 MTL alpha high idiomorph_gene_only 36.49 MTLalpha1|MTLalpha2 63.51 False +GCA_047651925.1_ASM4765192v1 Saccharomyces cerevisiae_Schizosaccharomyces pombe fusant MATsc MATa high idiomorph_gene_only 100.0 MATALPHA1|MATALPHA2|MATA1|MATA2 MTL alpha medium idiomorph_gene_only 35.59 MTLA1|MTLalpha2 64.41 False +GCA_048164895.1_ASM4816489v1 Saccharomycopsis crataegensis Ascoideales Saccharomycopsidaceae MTL alpha high idiomorph_gene_only 42.34 MTLA2|MTLalpha1|MTLalpha2 MATsc MATalpha medium idiomorph_gene_only 37.33 MATALPHA1|MATA2 5.01 False family_unconfirmed mtl_outside_scope +GCA_049863505.1_ASM4986350v1 Barnettozyma discipulorum Phaffomycetales Phaffomycetaceae MTL A medium mat_locus 51.61 MTLA1|MTLalpha1|OBP1 MATsc MATa medium partial_locus 48.44 MATALPHA1|MATA1|sla2 3.17 False family_unconfirmed mtl_outside_scope +GCA_053455635.1_ASM5345563v1 Hansenula anomala Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 58.18 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 55.0 MTLA1|MTLA2 3.18 False +GCA_054085685.1_DORT_Sapseu_12645 Saccharomycodes sp. B7079-1 Saccharomycodales Saccharomycodaceae MATsc MATalpha high mat_locus 36.62 MATALPHA1|MATALPHA2|sla2 MTL alpha high mat_locus 38.89 MTLalpha1|MTLalpha2|PIK1 -2.27 True family_unconfirmed cross_call_near_tie +GCA_054085705.1_DORT_Sapseu_12643 Saccharomycodes sp. B7079-1 Saccharomycodales Saccharomycodaceae MATsc MATalpha high mat_locus 36.62 MATALPHA1|MATALPHA2|sla2 MTL alpha high mat_locus 38.89 MTLalpha1|MTLalpha2|PIK1 -2.27 True family_unconfirmed cross_call_near_tie +GCA_054953955.1_ASM5495395v1 Saccharomycopsis schoenii Ascoideales Saccharomycopsidaceae MTL alpha medium idiomorph_gene_only 50.0 MTLA1|MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 45.71 MATALPHA1|MATA1|MATA2|sla2 4.29 False family_unconfirmed mtl_outside_scope +GCA_054953955.1_ASM5495395v1 Saccharomycopsis schoenii Ascoideales Saccharomycopsidaceae MTL alpha medium idiomorph_gene_only 51.429 MTLA1|MTLA2|MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 45.71 MATALPHA1|MATA1|MATA2|sla2 5.72 False family_unconfirmed mtl_outside_scope +GCA_054953955.1_ASM5495395v1 Saccharomycopsis schoenii Ascoideales Saccharomycopsidaceae MTL alpha medium idiomorph_gene_only 50.0 MTLA1|MTLalpha1|MTLalpha2 MATsc MATalpha medium idiomorph_gene_only 45.71 MATALPHA1|MATA1|MATA2 4.29 False family_unconfirmed mtl_outside_scope +GCA_054953955.1_ASM5495395v1 Saccharomycopsis schoenii Ascoideales Saccharomycopsidaceae MTL alpha medium idiomorph_gene_only 51.429 MTLA1|MTLA2|MTLalpha1|MTLalpha2 MATsc MATalpha medium mat_locus 45.71 MATALPHA1|MATA1|MATA2|sla2 5.72 False family_unconfirmed mtl_outside_scope +GCA_054953955.1_ASM5495395v1 Saccharomycopsis schoenii Ascoideales Saccharomycopsidaceae MTL alpha medium mat_locus 51.429 MTLA1|MTLalpha1|MTLalpha2|PIK1 MATsc MATalpha high mat_locus 45.71 MATALPHA1|MATALPHA2|MATA1|MATA2|sla2 5.72 False family_unconfirmed mtl_outside_scope +GCA_054953955.1_ASM5495395v1 Saccharomycopsis schoenii Ascoideales Saccharomycopsidaceae MATsc MATalpha medium mat_locus 48.485 MATALPHA1|MATA1|MATA2|sla2 MTL alpha medium idiomorph_gene_only 51.43 MTLA1|MTLalpha1|MTLalpha2 -2.95 True family_unconfirmed cross_call_near_tie +GCA_058970815.1_ASM5897081v1 Petasospora fabianii Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 58.18 MATA1|MATA2|sla2 MTL A medium mat_locus 57.14 MTLA1|MTLA2|PIK1 1.04 True family_unconfirmed cross_call_near_tie +GCA_060251755.1_ASM6025175v1 Wickerhamomyces sp. HBSY964-1 Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 60.34 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 55.17 MTLA1|MTLA2 5.17 False +GCA_060251785.1_ASM6025178v1 Wickerhamomyces sp. HBSY304-4 Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 59.32 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 55.0 MTLA1|MTLA2 4.32 False +GCA_060251865.1_ASM6025186v1 Wickerhamomyces sp. 3Q4-1 Phaffomycetales Wickerhamomycetaceae MATsc MATa medium partial_locus 56.36 MATA1|sla2 MTL A high idiomorph_gene_only 52.5 MTLA1|MTLA2 3.86 False +GCA_060251885.1_ASM6025188v1 Wickerhamomyces sp. HHY24-4 Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 52.38 MATA1|MATA2|sla2 MTL A medium mat_locus 48.75 MTLA1|MTLA2|PIK1 3.63 False +GCA_900465365.1_CvDDNA1.1 Williopsis vartiovaarae Phaffomycetales Wickerhamomycetaceae MATsc MATa medium mat_locus 54.24 MATA1|MATA2|sla2 MTL A high idiomorph_gene_only 50.0 MTLA1|MTLA2 4.24 False +GCA_947297755.1_246_Pichia_kluyveri Pichia kluyveri Pichiales Pichiaceae MATsc MATalpha high idiomorph_gene_only 51.85 MATALPHA1|MATALPHA2 MTL alpha high idiomorph_gene_only 35.71 MTLalpha1|MTLalpha2 16.14 False +GCA_947297755.1_246_Pichia_kluyveri Pichia kluyveri Pichiales Pichiaceae MATsc MATalpha high mat_locus 51.85 MATALPHA1|MATALPHA2|sla2 MTL alpha high idiomorph_gene_only 35.71 MTLalpha1|MTLalpha2 16.14 False +GCA_963678715.1_2795_Cyberlindnera_fabianii Petasospora fabianii Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 58.18 MATA1|MATA2|sla2 MTL A medium mat_locus 57.14 MTLA1|MTLA2|PIK1 1.04 True family_unconfirmed cross_call_near_tie +GCA_982397265.1_4-FMI Williopsis jadinii Phaffomycetales Wickerhamomycetaceae MATsc MATa high mat_locus 58.18 MATA1|MATA2|sla2 MTL A medium mat_locus 57.14 MTLA1|MTLA2|PIK1 1.04 True family_unconfirmed cross_call_near_tie +GCF_020623625.1_UHD_SCDLUD_16 Saccharomycodes ludwigii Saccharomycodales Saccharomycodaceae MATsc MATalpha high mat_locus 34.67 MATALPHA1|MATALPHA2|sla2 MTL alpha high mat_locus 37.5 MTLalpha1|MTLalpha2|PIK1 -2.83 True family_unconfirmed cross_call_near_tie diff --git a/results/2026-10-29_near_tie/flank_synteny.py b/results/2026-10-29_near_tie/flank_synteny.py new file mode 100644 index 00000000..9632931c --- /dev/null +++ b/results/2026-10-29_near_tie/flank_synteny.py @@ -0,0 +1,71 @@ +"""Flank check for the family_ambiguous loci of the v8 replay: which family's flank genes sit beside the locus? + +For each ambiguous locus cut the contig window locus +/- WINDOW bp, search the flank proteins of both families +with miniprot (SLA2, CHA1, APN2, DIC1 from the MATsc, MATyl and MATog records; PAP1, OBP1, PIK1 from the MTL records) and report the nearest hit +of each gene with its distance to the locus edge and its identity. MATsc-type neighbourhood: SLA2 (or CHA1) next to the locus; MTL-type: PIK1/OBP1/PAP1. +usage: python3 flank_synteny.py (run on the cluster with miniprot on PATH)""" +import collections, glob, gzip, json, os, subprocess, sys, tempfile +import yaml + +R, DB, LIB, OUT = sys.argv[1:5] +WINDOW = 40000 +FLANK = {"sla2": "SLA2", "cha1": "CHA1", "apn2": "APN2", "dic1": "DIC1", "PAP1": "PAP1", "OBP1": "OBP1", "PIK1": "PIK1"} + +def flank_refs(path): + """One protein per (gene, record) from the curated records, named |.""" + n = 0 + with open(path, "w") as out: + for faa in glob.glob(f"{DB}/Ascomycota/*/*/proteins.faa"): + rec = os.path.basename(os.path.dirname(faa)) + if not any(f in rec for f in ("_MATsc_", "_MTL_", "_MATyl_", "_MATog_")): + continue + name = seq = None + for line in open(faa): + if line.startswith(">"): + if name in FLANK and seq: out.write(f">{FLANK[name]}|{rec}\n{seq}\n"); n += 1 + name = next((x[5:] for x in line.strip().split("|") if x.startswith("name=")), None); seq = "" + else: + seq += line.strip() + if name in FLANK and seq: out.write(f">{FLANK[name]}|{rec}\n{seq}\n"); n += 1 + return n + +def genome_seq(asm, contig): + want, seq, on = contig, [], False + with gzip.open(f"{LIB}/{asm}.fa.gz", "rt") as fh: + for line in fh: + if line.startswith(">"): + if on: break + on = line[1:].split()[0] == want + elif on: + seq.append(line.strip()) + return "".join(seq) + +work = tempfile.mkdtemp(dir=R) +refs = os.path.join(work, "flank_refs.faa"); print("flank reference proteins:", flank_refs(refs), flush=True) +rows = [] +for d in sorted(glob.glob(f"{R}/out_v8/runs/*")): + asm = os.path.basename(d); f = d + "/detection_report.yaml" + if not os.path.exists(f): continue + y = yaml.safe_load(open(f)) + for l in y.get("detected") or []: + if not l.get("family_ambiguous"): continue + seq = genome_seq(asm, l["contig"]) + lo, hi = max(1, l["start"] - WINDOW), min(len(seq), l["end"] + WINDOW) + fa = os.path.join(work, "win.fa"); open(fa, "w").write(f">w\n{seq[lo - 1:hi]}\n") + gff = subprocess.run(["miniprot", "--gff", "-t", "2", fa, refs], capture_output=True, text=True).stdout + best = {} + for g in gff.splitlines(): + c = g.split("\t") + if len(c) < 9 or c[2] != "mRNA": continue + a = dict(x.split("=", 1) for x in c[8].split(";") if "=" in x) + gene = a.get("Target", "").split()[0].split("|")[0] + ident = float(a.get("Identity", 0)) * 100; s0, e0 = lo - 1 + int(c[3]), lo - 1 + int(c[4]) + dist = 0 if (s0 <= l["end"] and e0 >= l["start"]) else min(abs(s0 - l["end"]), abs(e0 - l["start"])) + if gene not in best or ident > best[gene][0]: best[gene] = (round(ident, 1), dist, s0, e0, c[6]) + rows.append(dict(genome=asm, family=l["family"].split(":")[1], idiomorph=l.get("idiomorph"), contig=l["contig"], start=l["start"], end=l["end"], + identity=l["family_ambiguous"]["identities"], **{k: (f"{v[0]}@{v[1]}" if (v := best.get(k)) else "") for k in sorted(set(FLANK.values()))})) +cols = ["genome", "family", "idiomorph", "contig", "start", "end"] + sorted(set(FLANK.values())) +with open(OUT, "w") as out: + out.write("\t".join(cols) + "\n") + for r in rows: out.write("\t".join(str(r[c]) for c in cols) + "\n") +print(len(rows), "loci") diff --git a/results/2026-10-29_near_tie/flank_synteny.tsv b/results/2026-10-29_near_tie/flank_synteny.tsv new file mode 100644 index 00000000..6988bfc3 --- /dev/null +++ b/results/2026-10-29_near_tie/flank_synteny.tsv @@ -0,0 +1,157 @@ +genome family idiomorph contig start end APN2 CHA1 DIC1 OBP1 PAP1 PIK1 SLA2 +GCA_001599195.1_JCM_3601_assembly_v001 MATsc MATa BCGI01000001.1 643043 698460 61.4@1099 51.5@0 +GCA_001599295.1_JCM_9486_assembly_v001 MATsc MATa BCGN01000003.1 1834745 1863776 59.6@3603 55.8@0 +GCA_001599995.1_JCM_7599_assembly_v001 MTL A BCIP01000001.1 108563 114355 71.9@1825 52.3@0 +GCA_001661245.1_Pacta1_2 MTL alpha KV454014.1 197158 238577 56.3@0 +GCA_001936135.1_KJJ81 MTL alpha CP012819.1 1926142 1945025 51.7@0 +GCA_001936135.1_KJJ81 MTL alpha CP012812.1 1952798 1972723 51.6@0 +GCA_001936155.1_KPH12 MTL alpha CP012826.1 1898110 1918007 51.7@0 +GCA_001936275.1_ATCC36309 MTL alpha CP015981.1 1940512 1959967 51.7@0 +GCA_003123585.1_ASM312358v1 MTL A QBLI01000035.1 9748 26373 58.2@8224 51.2@0 +GCA_003123885.1_ASM312388v1 MTL A QBLJ01000026.1 125869 142498 58.2@8167 51.2@0 +GCA_003243015.1_ASM324301v1 MATsc MATalpha NHAM01000013.1 323577 328981 50.0@0 +GCA_003327685.1_ASM332768v1 MATsc MATalpha QEFR01000004.1 276325 287124 51.1@0 +GCA_003339355.1_UCD_Pferm_PL1 MATsc MATalpha QAWB01000478.1 178 1924 +GCA_003339405.1_UCD_Pnorv_NO1 MATsc MATalpha QAWC01000011.1 43142 48071 51.0@0 +GCA_003705185.2_ASM370518v2 MTL alpha PPHU02000014.1 79953 84602 +GCA_003705185.2_ASM370518v2 MTL A PPHU02000007.1 26712 32905 71.3@1437 52.7@0 +GCA_003705225.2_ASM370522v2 MATsc MATalpha PPHW02000031.1 88938 96840 71.5@0 52.7@0 +GCA_003705515.2_ASM370551v2 MATsc MATa PPIQ02000974.1 165583 172315 51.1@0 +GCA_003706235.2_ASM370623v2 MTL alpha PPKS02000022.1 33100 71249 72.4@0 47.6@0 +GCA_003706315.3_ASM370631v3 MTL alpha PPKY03000108.1 1223 2583 +GCA_003706445.3_ASM370644v3 MATsc MATa PPLH03000051.1 39 38039 62.2@0 52.0@0 +GCA_003706615.3_ASM370661v3 MATsc MATa PPLU03000009.1 138944 143669 55.3@16230 51.3@0 +GCA_003706635.2_ASM370663v2 MTL alpha PPLV02000004.1 622360 649386 71.8@2573 51.9@0 +GCA_003706655.3_ASM370665v3 MTL A PPLX03000005.1 120524 137156 58.2@8173 51.2@0 +GCA_003706665.2_ASM370666v2 MATsc MATa PPLY02000023.1 22910 35246 58.2@3585 50.5@0 +GCA_003706765.3_ASM370676v3 MATsc MATa PPXL03000005.1 545853 574183 58.4@4269 52.4@0 +GCA_003707015.3_ASM370701v3 MATsc MATa PPMU03000001.1 253309 258264 59.1@1070 53.4@0 +GCA_003707205.3_ASM370720v3 MATsc MATa PPNL03000096.1 227 10984 +GCA_003707275.3_ASM370727v3 MATsc MATa PPNM03000112.1 217 12323 +GCA_003707675.3_ASM370767v3 MTL alpha PPKZ03000012.1 331460 336694 +GCA_003707675.3_ASM370767v3 MTL A PPKZ03000004.1 215815 223380 70.4@1597 52.6@0 +GCA_003707735.2_ASM370773v2 MATsc MATa PPLE02000007.1 114093 119141 61.1@683 53.8@0 +GCA_003707885.2_ASM370788v2 MATsc MATa PPMB02000005.1 308839 322961 58.8@0 51.4@0 +GCA_003708265.3_ASM370826v3 MATsc MATa PPNV03000010.1 378085 383189 60.4@16318 52.2@0 +GCA_003708285.2_ASM370828v2 MATsc MATa PPNT02000026.1 37428 67326 62.5@0 51.9@0 +GCA_003708295.3_ASM370829v3 MTL A PPNU03000009.1 78602 83299 61.4@1290 52.3@0 +GCA_003709245.3_ASM370924v3 MATsc MATa PPNR03000050.1 40 48778 63.3@0 52.3@0 +GCA_004931855.1_ASM493185v1 MATsc MATalpha SELW01000438.1 292 1942 +GCA_010994365.1_ASM1099436v1 MTL alpha JNFU01000001.1 1750657 1752492 55.8@419 +GCA_012062855.1_ASM1206285v1 MTL alpha WXEZ01000003.1 716032 735927 51.7@0 +GCA_017948575.1_ASM1794857v1 MATsc MATa JACVEX010000198.1 581 38969 64.0@0 51.8@0 +GCA_018343965.1_ASM1834396v1 MATsc MATa JADIOU010000016.1 198194 253611 61.4@1099 51.5@0 +GCA_019096115.1_ASM1909611v1 MATsc MATalpha JAGUCV010000004.1 269830 282876 51.5@0 +GCA_019155655.1_ASM1915565v1 MATsc MATa JAFMZF010000005.1 1021368 1037845 51.6@0 +GCA_020280145.1_ASM2028014v1 MTL alpha JAFIIU010000003.1 172887 196979 58.1@0 52.5@0 +GCA_020995425.1_ASM2099542v1 MATsc MATa CP083467.1 866744 871848 60.4@16318 52.2@0 +GCA_022641835.1_ASM2264183v1 MATsc MATa CP048715.1 630345 685843 61.4@1099 51.5@0 +GCA_023497445.1_ASM2349744v1 MTL alpha CP095753.1 1930140 1949510 51.7@0 +GCA_023627795.1_ASM2362779v1 MTL A JAMAIE010000005.1 614225 630853 58.2@8172 51.2@0 +GCA_023629335.1_ASM2362933v1 MATsc MATalpha JAMAIZ010000027.1 46063 56850 51.3@0 +GCA_025531525.1_ASM2553152v1 MATsc MATalpha JAMYHI010000112.1 23938 28926 51.7@0 +GCA_025531535.1_ASM2553153v1 MATsc MATalpha JAMYHH010000108.1 26928 31916 51.7@0 +GCA_025531545.1_ASM2553154v1 MATsc MATalpha JAMYHG010000426.1 315 1969 +GCA_025531555.1_ASM2553155v1 MATsc MATalpha JAMYHF010000081.1 16823 21824 50.9@0 +GCA_029299855.1_ASM2929985v1 MTL alpha DAGXHN010000045.1 42219 43819 +GCA_030267745.1_ASM3026774v1 MATsc MATalpha BSXS01010739.1 454 2132 63.0@234 +GCA_030556525.1_ASM3055652v1 MATsc MATa JAKTUE010000007.1 151609 186922 60.2@0 53.0@0 +GCA_030557365.1_ASM3055736v1 MATsc MATa JAKTPA010000050.1 568 38098 62.5@0 52.0@0 +GCA_030557395.1_ASM3055739v1 MTL alpha JAKTPC010000023.1 4649 14590 +GCA_030557395.1_ASM3055739v1 MTL A JAKTPC010000004.1 532268 539022 71.6@1143 53.0@0 +GCA_030557705.1_ASM3055770v1 MATsc MATa JANIVH010000002.1 1002757 1025745 62.9@1076 52.7@0 +GCA_030558335.1_ASM3055833v1 MTL A JAJMSG010000009.1 219121 223919 59.9@1111 52.1@0 +GCA_030558495.1_ASM3055849v1 MATsc MATalpha JAJMSP010000150.1 7862 12760 51.0@0 +GCA_030561065.1_ASM3056106v1 MATsc MATalpha JAKTWI010001458.1 202 1715 +GCA_030563305.1_ASM3056330v1 MTL A JAKUBT010000004.1 231765 255322 62.0@0 21.4@0 51.8@0 +GCA_030563965.1_ASM3056396v1 MATsc MATa JAJMKU010000007.1 131833 137795 50.9@0 +GCA_030564545.1_ASM3056454v1 MTL alpha JAJLVT010000128.1 173 1192 +GCA_030565225.1_ASM3056522v1 MATsc MATalpha JAJMBG010000014.1 55897 72598 62.8@1108 52.6@0 +GCA_030567395.1_ASM3056739v1 MTL alpha JAJLSF010000362.1 18802 25725 48.6@0 +GCA_030567455.1_ASM3056745v1 MTL A JAJLSD010000016.1 99135 103909 57.7@914 49.8@0 +GCA_030567475.1_ASM3056747v1 MTL alpha JAJLSH010000159.1 3398 8183 70.1@1804 51.3@0 +GCA_030567475.1_ASM3056747v1 MTL alpha JAJLSH010000044.1 1882 20575 70.1@0 51.3@0 +GCA_030567475.1_ASM3056747v1 MTL alpha JAJLSH010000171.1 2820 12134 70.1@1804 51.3@0 +GCA_030567495.1_ASM3056749v1 MTL alpha JAJLSG010000226.1 51846 79195 70.4@0 52.7@0 +GCA_030568845.1_ASM3056884v1 MATsc MATa JAJMIZ010000007.1 1476 6559 52.0@0 +GCA_030569135.1_ASM3056913v1 MATsc MATalpha JAJMJZ010002059.1 355 2005 +GCA_030569275.1_ASM3056927v1 MATsc MATa JAJMKO010000124.1 3439 18025 50.3@0 +GCA_030569515.1_ASM3056951v1 MATsc MATa JAJMLD010000026.1 1 2470 57.9@10135 39.6@0 +GCA_030569745.1_ASM3056974v1 MTL A JAJMLR010000017.1 211458 216185 62.9@1102 52.6@0 +GCA_030570285.1_ASM3057028v1 MATsc MATalpha JAJLVM010000195.1 22724 27653 51.0@0 +GCA_030570795.1_ASM3057079v1 MTL alpha JAJLWN010000014.1 131342 159843 59.6@877 52.8@0 +GCA_030570875.1_ASM3057087v1 MTL alpha JAJLWQ010000352.1 64296 77670 48.9@0 +GCA_030571235.1_ASM3057123v1 MATsc MATa JAJLXG010000020.1 180291 184855 59.5@645 50.9@0 +GCA_030572235.1_ASM3057223v1 MATsc MATalpha JAJLZM010000262.1 47848 53764 71.1@2051 52.8@0 +GCA_030572555.1_ASM3057255v1 MATsc MATa JAJMAJ010000003.1 169290 191981 61.4@0 51.2@0 +GCA_030572875.1_ASM3057287v1 MATsc MATa JAJMCJ010000135.1 2109 13054 54.7@3918 53.8@0 +GCA_030574175.1_ASM3057417v1 MATsc MATa JAJMEN010000065.1 587 39245 64.0@0 52.0@0 +GCA_030574595.1_ASM3057459v1 MATsc MATalpha JAJMFI010000625.1 5415 14719 57.9@1241 49.8@0 +GCA_030574595.1_ASM3057459v1 MATsc MATa JAJMFI010000654.1 2055 7536 57.1@1482 49.7@0 +GCA_030574715.1_ASM3057471v1 MTL A JAJMFO010000032.1 120169 124860 52.5@0 +GCA_030574855.1_ASM3057485v1 MATsc MATa JAJMFP010000178.1 180711 200557 62.9@995 52.9@0 +GCA_030574875.1_ASM3057487v1 MATsc MATa JAJMFM010000007.1 81519 108643 62.5@1146 52.3@0 +GCA_030575215.1_ASM3057521v1 MTL alpha JAJMII010000120.1 597 1764 +GCA_030579615.1_ASM3057961v1 MATsc MATa JAKTRI010000005.1 9416 38447 59.6@3603 55.8@0 +GCA_030579935.1_ASM3057993v1 MATsc MATalpha JAKTRY010000741.1 268 1661 68.8@3935 +GCA_030579955.1_ASM3057995v1 MTL alpha JAKTRZ010000681.1 281 1959 +GCA_030579955.1_ASM3057995v1 MTL A JAKTRZ010000415.1 3088 8880 71.9@1833 53.1@0 +GCA_030580035.1_ASM3058003v1 MATsc MATalpha JAKTSE010000178.1 222345 227442 51.2@0 +GCA_030580115.1_ASM3058011v1 MATsc MATa JAKTSJ010000109.1 230 10994 +GCA_030580415.1_ASM3058041v1 MTL alpha JAKTTA010000039.1 23763 28578 48.4@0 +GCA_030580455.1_ASM3058045v1 MTL A JAKTSX010000010.1 206303 219920 60.8@2214 50.8@0 +GCA_030582155.1_ASM3058215v1 MATsc MATa JAKTWT010000007.1 285543 290653 61.9@1217 53.4@0 +GCA_030582235.1_ASM3058223v1 MTL A JAKTWV010000016.1 21750 37222 60.1@0 49.9@0 +GCA_030582255.1_ASM3058225v1 MATsc MATa JAKTWW010000016.1 6038 12420 60.4@257 53.7@0 +GCA_030582275.1_ASM3058227v1 MTL A JAKTWX010000358.1 10668 34198 50.5@0 48.8@0 +GCA_030583195.1_ASM3058319v1 MTL alpha JAJMHU010000036.1 1757 21563 51.7@0 +GCA_030585085.1_ASM3058508v1 MTL alpha JAJMBV010000006.1 337097 373300 62.5@0 50.9@0 +GCA_030674255.1_ASM3067425v1 MATsc MATa JAJLXP010000001.1 300082 305157 61.2@1145 52.6@0 +GCA_030770065.1_ASM3077006v1 MATsc MATalpha JASOBJ010000274.1 18393 23381 51.7@0 +GCA_031125485.1_ASM3112548v1 MTL alpha JASTUL010000111.1 1497 2664 +GCA_031125595.1_ASM3112559v1 MATsc MATalpha JASTUX010000026.1 70699 92003 50.2@0 +GCA_031125625.1_ASM3112562v1 MTL alpha JASTUY010000005.1 71131 76576 50.3@0 +GCA_031125665.1_ASM3112566v1 MATsc MATalpha JASTUZ010000025.1 69685 75089 50.0@0 +GCA_031125675.1_ASM3112567v1 MATsc MATalpha JASVEF010000013.1 168013 173417 50.0@0 +GCA_031125685.1_ASM3112568v1 MATsc MATalpha JASTVA010000011.1 168247 173651 50.0@0 +GCA_031126305.1_ASM3112630v1 MTL alpha JASTUP010000673.1 2307 3907 +GCA_037040195.1_ASM3704019v1 MATsc MATalpha JAXQGK010000272.1 463 2117 59.2@234 +GCA_037041065.1_ASM3704106v1 MATsc MATa JAXQHV010000076.1 306470 311669 62.5@1239 51.7@0 +GCA_037041205.1_ASM3704120v1 MATsc MATalpha JAXQIC010000078.1 1476 3214 65.0@145 +GCA_037041255.1_ASM3704125v1 MATsc MATalpha JAXQIE010000001.1 7928 12909 51.6@0 +GCA_037041515.1_ASM3704151v1 MATsc MATalpha JAXQIP010000894.1 1 4386 49.4@0 +GCA_037041755.1_ASM3704175v1 MATsc MATalpha JAXQJC010000140.1 9845 14826 51.6@0 +GCA_037042445.1_ASM3704244v1 MATsc MATa JAXQKK010000058.1 33959 39158 62.5@1239 51.7@0 +GCA_037102705.1_ASM3710270v1 MATsc MATalpha BTGB01000003.1 287773 298560 51.4@0 +GCA_037355565.1_Ssch_CD502 MTL alpha JBAKGB010000901.1 722 1871 +GCA_039700735.1_ASM3970073v1 MATsc MATalpha JBBJZV010000113.1 360583 365680 51.2@0 +GCA_039700745.1_ASM3970074v1 MATsc MATalpha JBBJZU010000151.1 66405 71301 51.0@0 +GCA_040365455.1_JCM_7609_assembly_v001 MTL alpha BCIU01000086.1 39282 56202 +GCA_040365455.1_JCM_7609_assembly_v001 MTL alpha BCIU01000040.1 47819 68154 52.6@0 +GCA_040802125.1_ASM4080212v1 MATsc MATa JBEUWP010000001.1 360635 365892 55.9@549 51.7@0 +GCA_040938015.1_ASM4093801v1 MATsc MATalpha JBBULV010000672.1 561 2215 +GCA_041498895.1_ASM4149889v1 MTL A JBGMOJ010000036.1 108850 114405 68.4@2048 51.6@0 +GCA_047651925.1_ASM4765192v1 MATsc MATalpha CM105497.1 12854 36780 +GCA_047651925.1_ASM4765192v1 MATsc MATa CM105497.1 191610 194513 +GCA_048164895.1_ASM4816489v1 MTL alpha JBKSNE010000019.1 1692 12445 +GCA_049863505.1_ASM4986350v1 MTL A CM113344.1 1130885 1139023 59.1@1077 51.2@0 +GCA_053455635.1_ASM5345563v1 MATsc MATa JBQYEW010000016.1 172246 177905 59.7@937 53.7@0 +GCA_054085685.1_DORT_Sapseu_12645 MTL alpha JBSZQV010000009.1 639172 670297 44.4@0 +GCA_054085705.1_DORT_Sapseu_12643 MTL alpha JBSZQX010000011.1 644859 675983 44.4@0 +GCA_054953955.1_ASM5495395v1 MTL alpha CM143131.1 298409 303209 42.6@0 +GCA_054953955.1_ASM5495395v1 MTL alpha CM143129.1 463900 474618 40.2@0 +GCA_054953955.1_ASM5495395v1 MTL alpha CM143126.1 1288273 1290053 45.3@465 +GCA_054953955.1_ASM5495395v1 MTL alpha CM143128.1 2741968 2771606 42.6@0 +GCA_054953955.1_ASM5495395v1 MTL alpha CM143127.1 474935 502738 42.6@0 +GCA_054953955.1_ASM5495395v1 MTL alpha CM143130.1 2215366 2219597 43.1@0 +GCA_058970815.1_ASM5897081v1 MATsc MATa JBZCIV010000002.1 570188 625602 61.4@1099 51.4@0 +GCA_060251755.1_ASM6025175v1 MATsc MATa JBSNFT010000016.1 13481 40810 58.4@0 52.7@0 +GCA_060251785.1_ASM6025178v1 MATsc MATa JBSNFU010000005.1 282523 287669 63.7@1213 52.7@0 +GCA_060251865.1_ASM6025186v1 MATsc MATa JBSNFY010000016.1 15369 32262 62.2@1207 53.4@0 +GCA_060251885.1_ASM6025188v1 MATsc MATa JBSNFS010000011.1 284134 335651 62.9@0 53.1@0 +GCA_900465365.1_CvDDNA1.1 MATsc MATa UICF01000025.1 1119346 1124444 61.2@16356 52.0@0 +GCA_947297755.1_246_Pichia_kluyveri MATsc MATalpha CAMYTV010000058.1 998 2259 +GCA_947297755.1_246_Pichia_kluyveri MATsc MATalpha CAMYTV010000030.1 184325 195115 51.3@0 +GCA_963678715.1_2795_Cyberlindnera_fabianii MATsc MATa CAVMBU010000011.1 635202 690623 61.4@1099 51.5@0 +GCA_982397265.1_4-FMI MATsc MATa CEVXIE010000012.1 38798 94215 61.4@1099 51.4@0 +GCF_020623625.1_UHD_SCDLUD_16 MTL alpha NC_060204.1 594740 625360 44.2@0 diff --git a/results/2026-10-29_near_tie/genus_table.tsv b/results/2026-10-29_near_tie/genus_table.tsv new file mode 100644 index 00000000..2a9053c1 --- /dev/null +++ b/results/2026-10-29_near_tie/genus_table.tsv @@ -0,0 +1,28 @@ +genus order family genomes species loci kept_MATsc kept_MTL mean_MATsc mean_MTL median_gap_sc_minus_mtl min_gap max_gap loci_with_mtl_flank split +Pichia Pichiales Pichiaceae 27 11 28 28 0 45.5 39.8 4.3 0.0 16.1 0 +Saccharomycopsis Ascoideales Saccharomycopsidaceae 20 6 27 5 22 40.7 45.1 -5.0 -14.5 10.8 0 yes +Ambrosiozyma Pichiales Pichiaceae 13 11 19 4 15 43.3 46.7 -3.3 -10.0 7.2 0 yes +Petasospora Phaffomycetales Wickerhamomycetaceae 11 7 11 6 5 52.2 54.8 0.0 -9.0 1.0 2 yes +Wickerhamomyces Phaffomycetales Wickerhamomycetaceae 9 9 9 8 1 56.7 52.0 4.3 -1.2 9.8 0 yes +Williopsis Phaffomycetales Wickerhamomycetaceae 9 6 9 9 0 58.5 50.0 9.7 1.0 17.3 0 +Barnettozyma Phaffomycetales Phaffomycetaceae 8 5 8 2 6 46.6 51.2 -6.2 -9.2 3.3 6 yes +Hansenula Phaffomycetales Wickerhamomycetaceae 6 6 6 6 0 57.6 52.7 3.4 0.7 9.3 0 +Kregervanrija Pichiales Pichiaceae 4 3 4 4 0 47.2 41.0 7.3 0.2 10.2 0 +Candida Phaffomycetales Wickerhamomycetaceae 3 3 3 3 0 56.7 51.4 5.5 3.4 6.9 0 +Citeromyces Pichiales Pichiaceae 3 3 3 0 3 40.1 44.1 -3.1 -5.9 -3.1 0 +Saccharomycodes Saccharomycodales Saccharomycodaceae 3 2 3 0 3 36.0 38.4 -2.3 -2.8 -2.3 3 +Sporopachydermia Sporopachydermiales Sporopachydermiaceae 3 2 3 3 0 48.1 41.4 8.3 3.7 8.3 0 +Taiozyma Phaffomycetales Wickerhamomycetaceae 3 3 3 3 0 56.6 44.7 12.8 10.2 12.9 0 +Gotozyma Phaffomycetales Phaffomycetaceae 2 2 2 1 1 50.5 50.1 0.4 -7.5 8.2 1 yes +Komagataea Phaffomycetales Wickerhamomycetaceae 2 2 2 1 1 55.7 49.3 6.4 -1.8 14.5 0 yes +Millerago Phaffomycetales Phaffomycetaceae 2 2 2 2 0 59.4 43.8 15.7 14.1 17.3 0 +Ruyongia Phaffomycetales Wickerhamomycetaceae 2 2 3 2 1 54.2 54.0 3.7 -11.3 8.2 1 yes +Xingzhongia Phaffomycetales Wickerhamomycetaceae 2 2 2 1 1 54.5 54.8 -0.2 -1.4 1.0 0 yes +Allodekkera Pichiales Pichiaceae 1 1 1 1 0 50.0 38.5 11.5 11.5 11.5 0 +Pachysolen Alaninales Pachysolenaceae 1 1 1 0 1 44.2 53.5 -9.2 -9.2 -9.2 1 +Pichiaceae Pichiales Pichiaceae 1 1 1 0 1 41.9 42.9 -1.0 -1.0 -1.0 0 +Saccharomyces 1 1 2 2 0 100.0 36.0 64.0 63.5 64.4 0 +Saccharomycopsidaceae Ascoideales Saccharomycopsidaceae 1 1 1 0 1 37.3 42.3 -5.0 -5.0 -5.0 0 +Saturnispora Pichiales Pichiaceae 1 1 1 0 1 42.9 48.1 -5.3 -5.3 -5.3 0 +Waltiozyma Phaffomycetales Wickerhamomycetaceae 1 1 1 0 1 52.7 56.4 -3.6 -3.6 -3.6 1 +Wenyingozyma Pichiales Pichiaceae 1 1 1 0 1 42.1 53.3 -11.2 -11.2 -11.2 0 diff --git a/results/2026-10-29_ss_records/.gitignore b/results/2026-10-29_ss_records/.gitignore new file mode 100644 index 00000000..81f01bb3 --- /dev/null +++ b/results/2026-10-29_ss_records/.gitignore @@ -0,0 +1,5 @@ +data/spliced_*.txt +data/transcripts.fa +data/transcripts.fa.transdecoder.* +data/longest_orfs.pep +refs.faa.bak diff --git a/results/2026-10-29_ss_records/README.md b/results/2026-10-29_ss_records/README.md new file mode 100644 index 00000000..f46d05e7 --- /dev/null +++ b/results/2026-10-29_ss_records/README.md @@ -0,0 +1,27 @@ +# S. schoenii chromosome IV MAT loci: gene models rebuilt from public RNA-seq (2026-10-30) + +**Why:** Kriti et al., G3 2026 ([10.1093/g3journal/jkag067](https://doi.org/10.1093/g3journal/jkag067), PMID 41849659) describe SLA2-MAT cassettes on every chromosome of *S. schoenii* (GDD12, GCA_054953955.1, WGS JBTFFQ01) and say the BRAKER2 GTF is on GitHub and Zenodo. Neither holds it (GitHub `dkriti/Saccharomycopsis-schoenii-Genome-Assembly` and Zenodo 10.5281/zenodo.18950794 carry scripts only; checked 2026-10-29), and the NCBI assembly has no annotation. The models below are rebuilt here and are **ours, not the authors'**. + +**Method** (`ss_rnaseq.slurm`, `ss_models.slurm`, `chr4_orfs.py`, `chr4_models.py`, `make_refs.sh`): the three paired non-stranded RNA-seq runs of PRJNA1364152 (SRR37453601-03; 86% overall alignment) mapped with hisat2; StringTie transcripts; TransDecoder long ORFs; ORFs identified by phmmer against the 63 curated Saccharomycotina MAT proteins (`refs.faa`) and Pfam-A (HMG_box, Homeodomain, MATalpha_HMGbox, I_LWEQ). The library is not stranded, so transcript and ORF strands are inferred from the ORF alone. + +## What agrees with the paper +- Chromosome IV is CM143129.1. Splice junction **536,635-536,692 (58 bp, 218 reads)** = the paper's conserved 58 bp intron at 536,635. The paper's mirrored junction at 529,128 is not seen (the two arms are an inverted repeat, so reads map to one copy). +- RNA depth in the left cluster ends near 474,500 (paper: SLA2 to 475,000); the right cassette has two blocks, 530-532 kb and 534-536 kb, with no depth at 532.5-533.5 kb (the paper's spacer). +- SLA2 (I_LWEQ domain, 546-712 bits to curated SLA2) is found as one ORF in each arm of the palindrome (CDS 529,992-532,490 and 533,981-535,828, mirrored) and, diverged, at 472,708-474,606: the paper's "SLA2 anchors". + +## Models (ours) +| locus | ORF | CDS (CM143129.1) | evidence | +|---|---|---|---| +| left | MATalpha1 | 471,020-471,595, minus | 191 aa, MATalpha_HMGbox 54 bits, 73 bits to *Ogataea* MATalpha1 | +| left | HMG-like (a2-type) | 470,349-470,951 plus, or 470,176-470,243 + 470,336-470,951 with a 92 bp intron (97 reads) | 200/227 aa, 44 bits to *S. cerevisiae* MATA2, no Pfam hit | +| left | homeodomain | 471,961-472,227 + 472,445-472,489 plus | 103 aa (partial), Homeodomain 57 bits; the 217 bp intron (198 reads) joins it toward SLA2, the paper's "MATa1-SLA2 splice junction" | +| left | SLA2 | 472,708-473,478 and 473,680-474,606 | two diverged pieces, I_LWEQ 186 bits | +| right (IR copy 2) | homeodomain | 536,046-536,090 + 536,296-536,634 + 536,693-536,944, minus | 211 aa, Homeodomain 54 bits, introns of 205 bp (221 reads) and 58 bp (218 reads) | +| right (IR copy 1) | homeodomain | 529,258-529,749 | 163 aa, 34 bits; the 58 bp intron is not seen here | +Raw table: `data/chr4_orfs.tsv`; junctions `data/junctions_chrIV.tsv`; transcripts `data/stringtie.gtf`. + +## What is not settled +- **Gene names.** A homeodomain protein is MATa1 or MATalpha2; Pfam cannot say which. The paper calls the left cluster alpha (MATalpha2, MATalpha1) and the right cassette a (MATa1, MATa2). I use those names only by position, as a hypothesis. +- **No HMG-box (MATa2) ORF in the right cassette** passed the filters; the left "HMG-like" ORF has no Pfam hit, as for *Komagataella* MATa2 (13.6 bits, below GA). +- Palindrome copies are collapsed by short-read mapping; strand of the unstranded transcripts is inferred. +- These are our own ORF calls, not an annotation of the deposit, so a record built on them is **tier 3**, not tier 2, until the authors' GTF is obtained or the models are checked another way. diff --git a/results/2026-10-29_ss_records/chr4_models.py b/results/2026-10-29_ss_records/chr4_models.py new file mode 100644 index 00000000..f6b0aabc --- /dev/null +++ b/results/2026-10-29_ss_records/chr4_models.py @@ -0,0 +1,39 @@ +"""S. schoenii chromosome IV (CM143129.1): StringTie transcripts and TransDecoder ORFs in the MAT region, identified by phmmer +against the curated Saccharomycotina MAT proteins (refs.faa). Usage: chr4_models.py data/ refs.faa A B""" +import re, sys, collections, pyhmmer +from pyhmmer.easel import SequenceFile, Alphabet, TextSequence, DigitalSequenceBlock +d, refs, A, B = sys.argv[1], sys.argv[2], int(sys.argv[3]), int(sys.argv[4]) +tx = {} +for l in open(f"{d}/stringtie.gtf"): + f = l.split("\t") + if f[0] != "CM143129.1" or f[2] not in ("transcript", "exon"): continue + tid = re.search(r'transcript_id "([^"]+)"', f[8]).group(1) + t = tx.setdefault(tid, {"strand": f[6], "exons": [], "span": None, "cov": None}) + if f[2] == "transcript": + t["span"] = (int(f[3]), int(f[4])); t["cov"] = float(re.search(r'cov "([^"]+)"', f[8]).group(1)) + else: t["exons"].append((int(f[3]), int(f[4]))) +keep = {k: v for k, v in tx.items() if v["span"] and A <= v["span"][0] and v["span"][1] <= B} +pep = {} +name = None +for l in open(f"{d}/longest_orfs.pep"): + if l.startswith(">"): + name = l[1:].split()[0]; hdr = l; pep[name] = [hdr.strip(), ""] + elif name: pep[name][1] += l.strip() +alpha = Alphabet.amino() +q = [] +for tid in keep: + for n, (h, s) in pep.items(): + if n.startswith(tid + ".p") and s: + q.append(TextSequence(name=n.encode(), sequence=s.rstrip("*")).digitize(alpha)) +with SequenceFile(refs, digital=True, alphabet=alpha) as sf: db = sf.read_block() +out = {} +for hits in pyhmmer.phmmer(q, db, E=1e-2): + qn = hits.query.name if isinstance(hits.query.name, str) else hits.query.name.decode() + if len(hits): + h = hits[0]; out[qn] = (h.name if isinstance(h.name, str) else h.name.decode(), h.score, h.evalue) +for tid, t in sorted(keep.items(), key=lambda kv: kv[1]["span"]): + print(tid, t["strand"], t["span"], f"cov={t['cov']:.0f}", "exons=" + ",".join(f"{a}-{b}" for a, b in sorted(t["exons"]))) + for n, (h, s) in pep.items(): + if n.startswith(tid + ".p") and s: + hit = out.get(n) + print(" ", h[:110].split(" ")[0], h.split()[-2] if False else "", f"len={len(s.rstrip('*'))}", ("-> %s %.0f bits E=%.1g" % (hit[0].split("|")[0][-45:] + ("|" + hit[0].split("name=")[1].split("|")[0] if "name=" in hit[0] else ""), hit[1], hit[2])) if hit else "") diff --git a/results/2026-10-29_ss_records/chr4_orfs.py b/results/2026-10-29_ss_records/chr4_orfs.py new file mode 100644 index 00000000..b3dc275e --- /dev/null +++ b/results/2026-10-29_ss_records/chr4_orfs.py @@ -0,0 +1,55 @@ +"""ORFs of the StringTie transcripts in a window of S. schoenii chromosome IV with genomic CDS coordinates, Pfam domains +(HMG_box, Homeodomain, MATalpha_HMGbox, ANTH/ENTH, I/LWEQ) and the best curated MAT reference hit. +Usage: chr4_orfs.py data refs.faa Pfam-A.hmm A B""" +import re, sys, pyhmmer +from pyhmmer.easel import SequenceFile, Alphabet, TextSequence +d, refs, pfam, A, B = sys.argv[1], sys.argv[2], sys.argv[3], int(sys.argv[4]), int(sys.argv[5]) +tx = {} +for l in open(f"{d}/stringtie.gtf"): + f = l.split("\t") + if f[0] != "CM143129.1" or f[2] != "exon": continue + tid = re.search(r'transcript_id "([^"]+)"', f[8]).group(1) + tx.setdefault(tid, {"strand": f[6], "ex": []})["ex"].append((int(f[3]), int(f[4]))) +tx = {k: v for k, v in tx.items() if A <= min(a for a, b in v["ex"]) and max(b for a, b in v["ex"]) <= B} +def to_genome(tid, s, e): # 1-based transcript coords (transcript orientation = genome + order of exons, '+' transcripts; '-' reversed) + ex = sorted(tx[tid]["ex"]); strand = tx[tid]["strand"] + blocks, off = [], 0 + seq = ex if strand != "-" else ex[::-1] + for a, b in seq: + L = b - a + 1 + lo, hi = max(s, off + 1), min(e, off + L) + if lo <= hi: + blocks.append((a + (lo - off - 1), a + (hi - off - 1)) if strand != "-" else (b - (hi - off - 1), b - (lo - off - 1))) + off += L + return sorted(blocks) +orfs = []; name = None +for l in open(f"{d}/longest_orfs.pep"): + if l.startswith(">"): + m = re.match(r">(\S+) type:(\S+) len:(\d+) \S+ (\S+):(\d+)-(\d+)\(([+-])\)", l) + name = m.group(1); tid = name.rsplit(".p", 1)[0] + orfs.append([name, tid, m, ""]) + else: orfs[-1][3] += l.strip() +orfs = [o for o in orfs if o[1] in tx and len(o[3].rstrip("*")) >= 60] +alpha = Alphabet.amino() +seqs = {o[0]: TextSequence(name=o[0].encode(), sequence=o[3].rstrip("*")).digitize(alpha) for o in orfs} +with SequenceFile(refs, digital=True, alphabet=alpha) as sf: db = sf.read_block() +best = {} +for hits in pyhmmer.phmmer(list(seqs.values()), db, E=1e-2): + if len(hits): + h = hits[0]; best[hits.query.name.decode() if isinstance(hits.query.name, bytes) else hits.query.name] = (h.name.decode() if isinstance(h.name, bytes) else h.name, h.score) +dom = {} +want = {"HMG_box", "Homeodomain", "MATalpha_HMGbox", "ANTH", "ENTH", "I_LWEQ", "HMG_box_2", "Homeobox_KN"} +with pyhmmer.plan7.HMMFile(pfam) as hf: + for hits in pyhmmer.hmmscan(list(seqs.values()), hf, E=1e-3): + q = hits.query.name.decode() if isinstance(hits.query.name, bytes) else hits.query.name + dom[q] = [((h.name.decode() if isinstance(h.name, bytes) else h.name), round(h.score, 1)) for h in hits if (h.name.decode() if isinstance(h.name, bytes) else h.name) in want] +print("orf\ttranscript\tstrand\tlen\tcds_blocks\tbest_ref\tbits\tpfam") +for name, tid, m, s in orfs: + ts, te, st = min(int(m.group(5)), int(m.group(6))), max(int(m.group(5)), int(m.group(6))), m.group(7) + blocks = to_genome(tid, ts, te) if True else [] + br = best.get(name) + ref = "" + if br: + ref = br[0].split("|")[0][-40:] + ("|" + br[0].split("name=")[1].split("|")[0] if "name=" in br[0] else "|" + br[0].split("|")[-1]) + gs = {("+","+"):"+",("+","-"):"-",("-","+"):"-",("-","-"):"+"}.get((tx[tid]["strand"], st), "?") + print(name, tid, gs, len(s.rstrip('*')), ";".join(f"{a}-{b}" for a, b in blocks), ref, f"{br[1]:.0f}" if br else "", dom.get(name, ""), sep="\t") diff --git a/results/2026-10-29_ss_records/data/chr4_models.txt b/results/2026-10-29_ss_records/data/chr4_models.txt new file mode 100644 index 00000000..e6ac03af --- /dev/null +++ b/results/2026-10-29_ss_records/data/chr4_models.txt @@ -0,0 +1,65 @@ +SS.1982.1 + (469005, 473478) cov=85 exons=469005-472227,472445-473478 + >SS.1982.1.p1 len=256 -> 1173061_clib918_MATdc_A|sla2 273 bits E=9e-84 + >SS.1982.1.p2 len=248 + >SS.1982.1.p3 len=200 -> 4932_s288c_MATsc_HMRa|MATA2 44 bits E=8e-14 + >SS.1982.1.p4 len=191 -> 1005962_dl-1_MATog_MATa-MATalpha|MATalpha1 73 bits E=9e-23 + >SS.1982.1.p5 len=103 -> 5476_sc5314_MTL_A_MTLA1 50 bits E=1e-15 + >SS.1982.1.p6 len=98 + >SS.1982.1.p7 len=80 + >SS.1982.1.p8 len=73 + >SS.1982.1.p9 len=73 +SS.1982.2 + (469005, 473478) cov=30 exons=469005-470243,470336-472227,472445-473478 + >SS.1982.2.p1 len=256 -> 1173061_clib918_MATdc_A|sla2 273 bits E=9e-84 + >SS.1982.2.p2 len=248 + >SS.1982.2.p3 len=227 -> 4932_s288c_MATsc_HMRa|MATA2 43 bits E=1e-13 + >SS.1982.2.p4 len=191 -> 1005962_dl-1_MATog_MATa-MATalpha|MATalpha1 73 bits E=9e-23 + >SS.1982.2.p5 len=103 -> 5476_sc5314_MTL_A_MTLA1 50 bits E=1e-15 + >SS.1982.2.p6 len=98 + >SS.1982.2.p7 len=80 + >SS.1982.2.p8 len=73 + >SS.1982.2.p9 len=73 +SS.1983.1 . (473679, 474606) cov=37 exons=473679-474606 + >SS.1983.1.p1 len=309 -> 460519_cbs-7435_MATkp_MATa|sla2 302 bits E=1e-92 + >SS.1983.1.p2 len=197 +SS.1981.1 . (483659, 484889) cov=56 exons=483659-484889 +SS.1984.1 . (485926, 486704) cov=205 exons=485926-486704 +SS.1985.1 . (487454, 487699) cov=11 exons=487454-487699 +SS.1986.1 . (503375, 504795) cov=41 exons=503375-504795 + >SS.1986.1.p1 len=163 -> 5476_sc5314_MTL_A_MTLA1 34 bits E=8e-11 + >SS.1986.1.p2 len=108 -> MH260578_SLA2 109 bits E=3e-34 + >SS.1986.1.p3 len=106 + >SS.1986.1.p4 len=102 + >SS.1986.1.p5 len=80 +SS.1987.1 . (513657, 515192) cov=43 exons=513657-515192 + >SS.1987.1.p1 len=201 + >SS.1987.1.p2 len=165 + >SS.1987.1.p3 len=134 + >SS.1987.1.p4 len=130 + >SS.1987.1.p5 len=82 + >SS.1987.1.p6 len=70 + >SS.1987.1.p7 len=69 +SS.2000.1 . (522696, 524063) cov=17 exons=522696-524063 + >SS.2000.1.p1 len=112 + >SS.2000.1.p2 len=61 +SS.2001.1 . (528841, 532491) cov=143 exons=528841-532491 + >SS.2001.1.p1 len=832 -> 460519_cbs-7435_MATkp_MATa|sla2 712 bits E=5e-216 + >SS.2001.1.p2 len=219 + >SS.2001.1.p3 len=191 + >SS.2001.1.p4 len=163 -> 5476_sc5314_MTL_A_MTLA1 34 bits E=1e-10 + >SS.2001.1.p5 len=116 + >SS.2001.1.p6 len=106 + >SS.2001.1.p7 len=80 + >SS.2001.1.p8 len=71 +SS.2002.1 - (533930, 536977) cov=32 exons=533930-536634,536693-536977 + >SS.2002.1.p1 len=632 -> 1173061_clib918_MATdc_A|sla2 571 bits E=8e-174 + >SS.2002.1.p2 len=271 -> 5476_sc5314_MTL_A_MTLA1 33 bits E=2e-10 + >SS.2002.1.p3 len=197 + >SS.2002.1.p4 len=191 + >SS.2002.1.p5 len=106 + >SS.2002.1.p6 len=80 +SS.2002.2 - (533980, 536977) cov=160 exons=533980-536090,536296-536634,536693-536977 + >SS.2002.2.p1 len=615 -> 1173061_clib918_MATdc_A|sla2 546 bits E=3e-166 + >SS.2002.2.p2 len=211 -> 5476_sc5314_MTL_A_MTLA1 47 bits E=9e-15 + >SS.2002.2.p3 len=191 + >SS.2002.2.p4 len=181 + >SS.2002.2.p5 len=80 diff --git a/results/2026-10-29_ss_records/data/chr4_orfs.tsv b/results/2026-10-29_ss_records/data/chr4_orfs.tsv new file mode 100644 index 00000000..9f503158 --- /dev/null +++ b/results/2026-10-29_ss_records/data/chr4_orfs.tsv @@ -0,0 +1,54 @@ +orf transcript strand len cds_blocks best_ref bits pfam +SS.1982.1.p1 SS.1982.1 - 256 472708-473478 1173061_clib918_MATdc_A|sla2 273 [('I_LWEQ', 185.9)] +SS.1982.1.p2 SS.1982.1 + 248 469005-469751 [] +SS.1982.1.p3 SS.1982.1 + 200 470349-470951 4932_s288c_MATsc_HMRa|MATA2 44 [] +SS.1982.1.p4 SS.1982.1 - 191 471020-471595 1005962_dl-1_MATog_MATa-MATalpha|MATalpha1 73 [('MATalpha_HMGbox', 54.2)] +SS.1982.1.p5 SS.1982.1 + 103 471961-472227;472445-472489 5476_sc5314_MTL_A_MTLA1|5476_sc5314_MTL_A_MTLA1 50 [('Homeodomain', 56.8), ('Homeobox_KN', 34.3)] +SS.1982.1.p6 SS.1982.1 - 98 469070-469366 [] +SS.1982.1.p7 SS.1982.1 - 80 471942-472184 [] +SS.1982.1.p8 SS.1982.1 + 73 469958-470179 [] +SS.1982.1.p9 SS.1982.1 + 73 473258-473476 [] +SS.1982.2.p1 SS.1982.2 - 256 472708-473478 1173061_clib918_MATdc_A|sla2 273 [('I_LWEQ', 185.9)] +SS.1982.2.p2 SS.1982.2 + 248 469005-469751 [] +SS.1982.2.p3 SS.1982.2 + 227 470176-470243;470336-470951 4932_s288c_MATsc_HMRa|MATA2 43 [] +SS.1982.2.p4 SS.1982.2 - 191 471020-471595 1005962_dl-1_MATog_MATa-MATalpha|MATalpha1 73 [('MATalpha_HMGbox', 54.2)] +SS.1982.2.p5 SS.1982.2 + 103 471961-472227;472445-472489 5476_sc5314_MTL_A_MTLA1|5476_sc5314_MTL_A_MTLA1 50 [('Homeodomain', 56.8), ('Homeobox_KN', 34.3)] +SS.1982.2.p6 SS.1982.2 - 98 469070-469366 [] +SS.1982.2.p7 SS.1982.2 - 80 471942-472184 [] +SS.1982.2.p8 SS.1982.2 + 73 469958-470179 [] +SS.1982.2.p9 SS.1982.2 + 73 473258-473476 [] +SS.1983.1.p1 SS.1983.1 ? 309 473680-474606 460519_cbs-7435_MATkp_MATa|sla2 302 [] +SS.1983.1.p2 SS.1983.1 ? 197 474014-474604 [] +SS.1986.1.p1 SS.1986.1 ? 163 503715-504206 5476_sc5314_MTL_A_MTLA1|5476_sc5314_MTL_A_MTLA1 34 [('Homeodomain', 32.0)] +SS.1986.1.p2 SS.1986.1 ? 108 504467-504793 MH260578_SLA2|MH260578_SLA2 109 [('I_LWEQ', 94.3)] +SS.1986.1.p3 SS.1986.1 ? 106 503948-504268 [] +SS.1986.1.p4 SS.1986.1 ? 102 503375-503683 [] +SS.1986.1.p5 SS.1986.1 ? 80 503696-503938 [] +SS.1987.1.p1 SS.1987.1 ? 201 514179-514784 [] +SS.1987.1.p2 SS.1987.1 ? 165 513658-514152 [] +SS.1987.1.p3 SS.1987.1 ? 134 514786-515190 [] +SS.1987.1.p4 SS.1987.1 ? 130 514123-514515 [] +SS.1987.1.p5 SS.1987.1 ? 82 513659-513907 [] +SS.1987.1.p6 SS.1987.1 ? 70 514847-515059 [] +SS.1987.1.p7 SS.1987.1 ? 69 513915-514124 [] +SS.2000.1.p1 SS.2000.1 ? 112 523396-523734 [] +SS.2000.1.p2 SS.2000.1 ? 61 523205-523390 [] +SS.2001.1.p1 SS.2001.1 ? 832 529992-532490 460519_cbs-7435_MATkp_MATa|sla2 712 [('I_LWEQ', 182.4)] +SS.2001.1.p2 SS.2001.1 ? 219 531298-531957 [] +SS.2001.1.p3 SS.2001.1 ? 191 530542-531117 [] +SS.2001.1.p4 SS.2001.1 ? 163 529258-529749 5476_sc5314_MTL_A_MTLA1|5476_sc5314_MTL_A_MTLA1 34 [('Homeodomain', 33.9)] +SS.2001.1.p5 SS.2001.1 ? 116 528876-529226 [] +SS.2001.1.p6 SS.2001.1 ? 106 529491-529811 [] +SS.2001.1.p7 SS.2001.1 ? 80 529239-529481 [] +SS.2001.1.p8 SS.2001.1 ? 71 531843-532058 [] +SS.2002.1.p1 SS.2002.1 + 632 533930-535828 1173061_clib918_MATdc_A|sla2 571 [('I_LWEQ', 183.0)] +SS.2002.1.p2 SS.2002.1 - 271 536071-536634;536693-536944 5476_sc5314_MTL_A_MTLA1|5476_sc5314_MTL_A_MTLA1 33 [('Homeodomain', 33.1)] +SS.2002.1.p3 SS.2002.1 - 197 533932-534522 [] +SS.2002.1.p4 SS.2002.1 - 191 534703-535278 [] +SS.2002.1.p5 SS.2002.1 - 106 536009-536329 [] +SS.2002.1.p6 SS.2002.1 + 80 536339-536581 [] +SS.2002.2.p1 SS.2002.2 + 615 533981-535828 1173061_clib918_MATdc_A|sla2 546 [('I_LWEQ', 183.1)] +SS.2002.2.p2 SS.2002.2 - 211 536046-536090;536296-536634;536693-536944 5476_sc5314_MTL_A_MTLA1|5476_sc5314_MTL_A_MTLA1 47 [('Homeodomain', 54.2), ('Homeobox_KN', 33.1)] +SS.2002.2.p3 SS.2002.2 - 191 534703-535278 [] +SS.2002.2.p4 SS.2002.2 - 181 533980-534522 [] +SS.2002.2.p5 SS.2002.2 + 80 536339-536581 [] diff --git a/results/2026-10-29_ss_records/data/depth_chrIV_455k-545k.tsv.gz b/results/2026-10-29_ss_records/data/depth_chrIV_455k-545k.tsv.gz new file mode 100644 index 00000000..703881e4 Binary files /dev/null and b/results/2026-10-29_ss_records/data/depth_chrIV_455k-545k.tsv.gz differ diff --git a/results/2026-10-29_ss_records/data/genome.fa.fai b/results/2026-10-29_ss_records/data/genome.fa.fai new file mode 100644 index 00000000..f9baf793 --- /dev/null +++ b/results/2026-10-29_ss_records/data/genome.fa.fai @@ -0,0 +1,7 @@ +CM143126.1 1831595 95 80 81 +CM143127.1 3497966 1854681 80 81 +CM143128.1 3172219 5396469 80 81 +CM143129.1 2335549 8608437 80 81 +CM143130.1 2250200 10973276 80 81 +CM143131.1 1178080 13251700 80 81 +CM143132.1 38050 14444621 80 81 diff --git a/results/2026-10-29_ss_records/data/junctions_chrIV.tsv b/results/2026-10-29_ss_records/data/junctions_chrIV.tsv new file mode 100644 index 00000000..0fec4451 --- /dev/null +++ b/results/2026-10-29_ss_records/data/junctions_chrIV.tsv @@ -0,0 +1,6 @@ +469762 469810 7 +470244 470335 97 +472228 472444 198 +514179 514339 81 +536091 536295 221 +536635 536692 218 diff --git a/results/2026-10-29_ss_records/data/miniprot_all.gff b/results/2026-10-29_ss_records/data/miniprot_all.gff new file mode 100644 index 00000000..af8b5d9d --- /dev/null +++ b/results/2026-10-29_ss_records/data/miniprot_all.gff @@ -0,0 +1,294 @@ +##gff-version 3 +##PAF MH260578_SUI1 109 0 109 + CM143129.1 2335549 452887 453324 237 327 0 AS:i:395 ms:i:430 np:i:99 fs:i:1 st:i:0 da:i:0 do:i:0 cg:Z:10M114U32M2G65M cs:Z::2*tctN*cttI:6*gD~gt111ag-ac:8*gatE*tctT*caaE*ccaV:20*caQ:1*attL:1*tctD:3*tccL:1*cgtK:4*ttgI:2*gatE:1*ggtA:3*catN*gttI:3*gaaD:3*gatE*attV*atgI:7*gctL:1*gttI*ttgM:2*ttgM*acaV*accQ*caaT:2*ttaI:3*accN:2*gttI:3 +CM143129.1 miniprot mRNA 452888 453327 430 + . ID=SS000001;Rank=1;Identity=0.7248;Positive=0.9083;Frameshift=1;Target=MH260578_SUI1 1 109 +CM143129.1 miniprot CDS 452888 452918 48 + 0 Parent=SS000001;Rank=1;Identity=0.8182;Target=MH260578_SUI1 1 10 +CM143129.1 miniprot CDS 453030 453327 382 + 2 Parent=SS000001;Rank=1;Identity=0.7143;Frameshift=1;Target=MH260578_SUI1 11 109 +CM143129.1 miniprot stop_codon 453325 453327 0 + 0 Parent=SS000001;Rank=1 +##PAF MH260578_SLA2 1072 227 1072 - CM143128.1 3172219 2744254 2746837 1242 2613 0 AS:i:1979 ms:i:1979 np:i:601 fs:i:0 st:i:0 da:i:-1 do:i:15 cg:Z:57M2I27M6I15M2I258M2D54M4D175M17D5M1D190M2D54M cs:Z::1*gctM*cgcY*agaK*actM*acaS*agtD:1*gacA:1*gctI:4*agaK*caaS*agaK*tatF*gatE*tctD:2*caaE:2*tttY*gagD:3*gatN:1*accS*agcN*cttI*cacR:3*tctT:2*aacT:4*acgP*accF*agtE*cctA:1*gatN:1*ctcI:1+QN:2*aacD*acgE*ggtN*attV*cgtN*agaL:2*accL*aagT*gcgE*ccgQ*gcgK*gcgT*aagA*agtA*ccaT:1*gcaL*agtR*ccgH*ccaS:1*ccgT:1+FEQENE*ccaR*aagQ*gaaQ*ataQ*gcaQ*agcA:1*ttaI*atcA*aatT:4*gttM+VR*gaaN*ttcA*tggF*aaaV*gctE:2*gacQ*aatL*gtgY:1*gctQ*gaaQ:1*gaaQ*agaQ:1*gccE*agaQ*gaaQ:1*aatQ:1*caaE:1*ttaQ*gcgQ:2*gaaQ*gaaQ:1*gctL*aatA:2*gctQ*gcaY*tttW:5*gaaQ*ttgQ*cagA*caaE*cagA:2*atgL:4*atgL:1*caaL*caaD*tatQ*catA*acaQ*caaR*gcgH:11*ctaI:1*gctT:2*aacG:3*caaN:3*ttgM:2*caaS:3*aggK:1*aaaQ*gttA:2*cagN:1*gcgL*atgA*aatS*gccT*aatT:1*gctT:1*actQ*caaE:1*attL:1*ttgS:3*agtQ:2*agtL*gtcL:3*ttgV*aacE*ttgY*ttcW:1*agcN:4*ataL:8*caaT:6*caaT:1*ttcS:2*ttgI:11*gatE:2*gacE*aggK*attL:1*aaaR:1*ttgM:4*gttI:15*attL*gacE*aagR*ttaF*agaK*gggN*tctG*aagT*gacK*tctT*ttgD*attL*gaaQ*aaaT:1*gaaQ*gccL:1*gttK*aatD*actE:1*aagE*gatQ:2*gatA*gtgT*acaL*gaaD:1*aacA:2*tctA:2*aacT*tccA:3*gcaQ:1*cgaN:2*atgL*gaaQ:2*gaaQ*accN:1*ttgF:1-gaaaga*gaaD*tcgV*caaT*atcL*tcaN*gagA*atgP:1*ccaD:1*tcaK*aatL*gctK*gagQ:1*cagE:1*acaQ:1*cgtQ:3*gagL:3*attM*ttaM:5*gatE*gcgT*ttaI:1*cagD:1*gccV*gagK*tctT*aaaQ*aggN*gaaS*agcR:2*gctK*atcS*gatE*gaaM:1-attgatacagtg*ttaN*caaK*gaaL*catN*atcS*atgT:1*ctaV*gttL*gctG*attL:2*tctA:2*caaK:2*gtgI*aaaN:2*gaaQ:1*agtA*ttaV:5*tcgP:2*ggcA:2*caaL:4*tcaE:1*ttgV:2*attL*attL:2*gcaS*ggcS*gaaG*acaL*agtV*caaT*gaaD:2*acgS*gctS:3*tttM*atcL*gctV:2*ccaD*agcN*ggtA*gatN*tatE:1*gagL*atcV:1*tctD*actS:1*tcaT*gaaN:2*ctgT*tgtS:1*acaS:1*gttI*gagL:2*gttT:2*atcL*attT*aagR*tttL*tgcT:1*acaQ*gagD*aatD*ttgF*gaaQ*aacD*tcgD:1*ttaI*tcaD*tctT:1*agaK*ttgD*gttI*ggtA:1*acaI*tgcS*attE*gaaV*tttY:2*gatS:1*ttgY*tctH*aagS:2*gaaV*agcN*ttgK:1*gaaI*gaaD*caaD*aagQ*tcaT:1*aaaI:2*gaaN:1*gtcN*gttI*gaaD*atcV*catQ:1*agaI:1*gaaQ*gaaT:1*actL*acaQ:1*attV:1*actS*attM*gcaK*tctT*acgP:1*ggtS*ggcK-ggcggcggcggcggcggtggcagtagcagcagcaacagcaacaacaagttc:1*gagD*atcL*gaaS:1-caa*acaV*gaaD*gagG:2*gaaS*agcD:3*aacK:2*aacE*gctH:1*gcgS*gagR:2*aagE*caaE:1*acaS*ttaV:2*acgS:3*accN*agcQ*aaaP*aacF*ttaD*cagV*gacS*ttgM:1*cctS:2*ttaI:4*gctS:4*tccA*attS:2*accI*aaaT:2*tcgK*atgY:2*tctR:1*gccS:1*gatE*actS:1*catE:3*gcaN:2*aaaR:2*agtH*acaS*agaK*gccT*caaS:6*agaK:8*gctS:1*gctS*gttI:1*tctY*gctS:2*ttaT:2*caaR*actI:3*aatV:1*agtQ*ggtN:1*aatH*acaS*cacN:3*attV:3*aatR:3*tctA:2*attA:3*gcaS:5*gctS*acgQ*cagF*ttcM:4*gacN*aatK:8*tctN*attL:3*agcQ:2*agcD:2*caaN*gaaK:2*aatI*aaaG*tctK*acaH*caaE*ttaV-gttaat*gatE:3*ttcY:5*attH*gatE:1*agaK*aaaT*gaaA:2*aaaE:2*gcaV:2*atcL:6*ggtS*gctS:6*gatE:3*tatF:2*caaK:3*gatS:1*agcE*gatE +CM143128.1 miniprot mRNA 2744255 2746837 1979 - . ID=SS000002;Rank=1;Identity=0.4753;Positive=0.6900;Target=MH260578_SLA2 228 1072 +CM143128.1 miniprot CDS 2744255 2746837 1979 - 0 Parent=SS000002;Rank=1;Identity=0.4753;Target=MH260578_SLA2 228 1072 +##PAF MH260578_SLA2 1072 227 1072 + CM143127.1 3497966 497868 500451 1245 2613 0 AS:i:1978 ms:i:1978 np:i:600 fs:i:0 st:i:0 da:i:-1 do:i:15 cg:Z:57M2I27M6I15M2I258M2D54M4D175M17D5M1D190M2D54M cs:Z::1*gctM*cgcY*agaK*actM*acaS*agtD:1*gacA:1*gctI:4*agaK*caaS*agaK*tatF*gatE*tctD:2*caaE:2*tttY*gagD:3*gatN:1*accS*agcN*cttI*cacR:3*tctT:2*aacT:4*acaP*accF*actE*cctA:1*gatN:1*ctcI:1+QN:2*aacD*acgE*ggtN*attV*cgtN*agaL:2*accL*aagT*gcgE*ccgQ*gcgK*gcgT*aagA*agtA*ccaT:1*gcaL*agtR*ccgH*ccaS:1*ccgT:1+FEQENE*ccaR*aagQ*gaaQ*ataQ*gcaQ*aacA:1*ttaI*atcA*aatT:4*gttM+VR*gaaN*ttcA*tggF*aaaV*gctE:2*gacQ*aatL*gtgY:1*gctQ*gaaQ:1*gaaQ*agaQ:1*gccE*agaQ*gaaQ:1*aatQ:1*caaE:1*ttaQ*gcgQ:2*gaaQ*gaaQ:1*gctL*aatA:2*gctQ*gcaY*tttW:5*gaaQ*ttgQ*cagA*caaE*cagA:2*atgL:4*atgL:1*caaL*caaD*tatQ*catA*acaQ*caaR*gcgH:11*ctaI:1*gctT:2*aacG:3*caaN:3*ttgM:2*caaS:3*aggK:1*aaaQ*gttA:2*cagN:1*gcgL*atgA*aatS*gccT*aatT:1*gctT:1*actQ*caaE:1*attL:1*ttgS:3*agtQ:2*agtL*gtcL:3*ttgV*aacE*ttgY*ttcW:1*agcN:4*ataL:8*caaT:6*caaT:1*ttcS:2*ttgI:11*gatE:2*gacE*aggK*attL:1*aaaR:1*ttgM:4*gttI:15*attL*gacE*aagR*ttaF*agaK*gggN*tctG*aagT*gacK*tctT*ttgD*attL*gaaQ*aaaT:1*gaaQ*gccL:1*gttK*aatD*actE:1*aagE*gatQ:2*gatA*gtgT*acaL*gaaD:1*aacA:2*tctA:2*aacT*tccA:3*gcaQ:1*cgaN:2*atgL*gaaQ:2*gaaQ*accN:1*ttgF:1-gaaaga*gaaD*tcgV*caaT*atcL*tcaN*gagA*atgP:1*ccaD:1*tcaK*aatL*gctK*gagQ:1*cagE:1*acaQ:1*cgtQ:3*gagL:3*attM*ttaM:5*gatE*gcgT*ttaI:1*cagD:1*gccV*gagK*tctT*aaaQ*aggN*gaaS*agcR:2*gctK*atcS*gatE*gaaM:1-attgatacagtg*ttaN*caaK*gaaL*catN*atcS*atgT:1*ctaV*gttL*gctG*attL:2*tctA:2*caaK:2*gtgI*aaaN:2*gaaQ:1*agtA*ttaV:5*tcgP:2*ggcA:2*caaL:4*tcaE:1*ttgV:2*attL*attL:2*gcaS*ggcS*gaaG*acaL*agtV*caaT*gaaD:2*acgS*gctS:3*tttM*atcL*gctV:2*ccaD*agcN*ggtA*gatN*tatE:1*gagL*atcV:1*tctD*actS:1*tcaT*gaaN:2*ctgT*tgtS:1*acaS:1*gttI*gagL:2*gttT:2*atcL*attT*aagR*tttL*tgcT:1*acaQ*gagD*aatD*ttgF*gaaQ*aacD*tcgD:1*ttaI*tcaD*tctT:1*agaK*ttgD*gttI*ggtA:1*acaI*tgcS*attE*gaaV*tttY:2*gatS:1*ttgY*tctH*aagS:2*caaV*agcN*ttgK:1*gaaI*gaaD*caaD*aagQ*tcaT:1*aaaI:2*gaaN:1*gtcN*gttI*gaaD*atcV*catQ:1*agaI:1*gaaQ*gaaT:1*actL*acaQ:1*attV:1*actS*attM*gcaK*tctT*acgP:1*ggtS*ggcK-ggcggcggcggcggcggtggcggtagcagcagcaacagcaacaacaagttc:1*gagD*atcL*gaaS:1-caa*acaV*gaaD*gagG:2*gaaS*agcD:3*aacK:2*aacE*gctH:1*gcgS*gagR:2*aagE*caaE:1*accS*ttaV:2*acgS:3*accN*agcQ*aaaP*aacF*ttaD*cagV*gacS*ttgM:1*cctS:2*ttaI:4*gctS:4*tccA*attS:2*accI*aaaT:2*tcgK*atgY:2*tctR:1*gccS:1*gatE*actS:1*catE:3*gcaN:2*aaaR:2*agtH:1*agaK*gccT*caaS:6*agaK:8*gctS:1*gctS*gttI:1*tctY*gctS:2*ttaT:2*caaR*actI:3*aatV:1*agtQ*ggtN:1*aatH*acaS*cacN:3*attV:3*aatR:3*tctA:2*attA:3*gcaS:5*gctS*acgQ*cagF*ttcM:4*gacN*aatK:8*tctN*attL:3*agcQ:2*agcD:2*caaN*gaaK:2*aatI*aaaG*tctK*acaH*caaE*ttaV-gttaat*gatE:3*ttcY:5*attH*gatE:1*agaK*aaaT*gaaA:2*aaaE:2*gcaV:2*atcL:6*ggtS*gctS:6*gatE:3*tatF:2*caaK:3*gatS:1*agcE*gatE +CM143127.1 miniprot mRNA 497869 500451 1978 + . ID=SS000003;Rank=2;Identity=0.4765;Positive=0.6889;Target=MH260578_SLA2 228 1072 +CM143127.1 miniprot CDS 497869 500451 1978 + 0 Parent=SS000003;Rank=2;Identity=0.4765;Target=MH260578_SLA2 228 1072 +##PAF MH260578_SLA2 1072 239 1072 - CM143131.1 1178080 300671 303215 1227 2574 0 AS:i:1963 ms:i:1963 np:i:595 fs:i:0 st:i:0 da:i:-1 do:i:15 cg:Z:45M2I27M6I15M2I258M2D54M4D175M16D5M1D190M2D54M cs:Z:*aaaE:2*agaK*caaS*agaK*tatF*gatE*tctD:2*caaE:2*tttY*gagD:3*gatN:1*accS*agcN*cttI*cacR:3*tctT:2*aacT:4*acaP*accF*agtE*cctA:1*gatN:1*ctcI:1+QN:2*aacD*acgE*ggtN*attV*cgtN*agaL:2*accL*aagT*gcgE*ccgQ*gcgK*gcgT*aagA*agtA*ccaT:1*gcaL*agtR*ccgH*ccaS:1*ccgT:1+FEQENE*ccaR*aagQ*gaaQ*ataQ*gcaQ*agcA:1*ttaI*atcA*aatT:4*gttM+VR*gaaN*ttcA*tggF*aaaV*gctE:2*gacQ*aatL*gtgY:1*gctQ*gaaQ:1*gaaQ*agaQ:1*gccE*agaQ*gaaQ:1*aatQ:1*caaE:1*ttaQ*gcgQ:2*gaaQ*gaaQ:1*gctL*aatA:2*gctQ*gcaY*tttW:5*gaaQ*ttgQ*cagA*caaE*cagA:2*atgL:4*atgL:1*caaL*caaD*tatQ*catA*acaQ*caaR*gcgH:11*ctaI:1*gctT:2*aacG:3*caaN:3*ttgM:2*caaS:3*aggK:1*aaaQ*gttA:2*cagN:1*gcgL*atgA*aatS*gccT*aatT:1*gctT:1*actQ*caaE:1*attL:1*ttgS:3*agtQ:2*agtL*gtcL:3*ttgV*aacE*ttgY*ttcW:1*agcN:4*ataL:8*caaT:6*caaT:1*ttcS:2*ttgI:11*gatE:2*gacE*aggK*attL:1*aaaR:1*ttgM:4*gttI:15*attL*gacE*aagR*ttaF*agaK*gggN*tctG*aagT*gacK*tctT*ttgD*attL*gaaQ*aaaT:1*gaaQ*gccL:1*gttK*aatD*actE:1*aagE*gatQ:2*gatA*gtgT*acaL*gaaD:1*aacA:2*tctA:2*aacT*tccA:3*gcaQ:1*cgaN:2*atgL*gaaQ:2*gaaQ*accN:1*ttgF:1-gaaaga*gaaD*tcgV*caaT*atcL*tcaN*gagA*atgP:1*ccaD:1*tcaK*aatL*gctK*gagQ:1*cagE:1*acaQ:1*cgtQ:3*gagL:3*attM*ttaM:5*gatE*gcgT*ttaI:1*cagD:1*gccV*gagK*tctT*aaaQ*aggN*gaaS*agcR:2*gctK*atcS*gatE*gaaM:1-attgatacagtg*ttaN*caaK*gaaL*catN*atcS*atgT:1*ctaV*gttL*gctG*attL:2*tctA:2*caaK:2*gtgI*aaaN:2*gaaQ:1*agtA*ttaV:5*tcgP:2*ggcA:2*caaL:4*tcaE:1*ttgV:2*attL*attL:2*gcaS*ggcS*gaaG*acaL*agtV*caaT*gaaD:2*acgS*gctS:3*tttM*atcL*gctV:2*ccaD*agcN*ggtA*gatN*tatE:1*gagL*atcV:1*tctD*actS:1*tcaT*gaaN:2*ctgT*tgtS:1*acaS:1*gttI*gagL:2*gttT:2*atcL*attT*aagR*tttL*tgcT:1*acaQ*gagD*aatD*ttgF*gaaQ*aacD*tcgD:1*ttaI*tcaD*tctT:1*agaK*ttgD*gttI*ggtA:1*acaI*tgcS*attE*gaaV*tttY:2*gatS:1*ttgY*tctH*aagS:2*caaV*agcN*ttgK:1*gaaI*gaaD*caaD*aagQ*tcaT:1*aaaI:2*gaaN:1*gttN*gttI*gaaD*atcV*catQ:1*agaI:1*gaaQ*gaaT:1*actL*acaQ:1*attV:1*actS*attM*gcaK*tctT*acgP:1*ggtS*ggcK-ggcggcggcggcggtggcagtagcagcagcaacagcaacaacaagttc:1*gagD*atcL*gaaS:1-caa*acaV*gaaD*gagG:2*gaaS*agcD:3*aacK:2*aacE*gctH:1*gcgS*gagR:2*aagE*caaE:1*acaS*ttaV:2*acgS:3*accN*agcQ*aaaP*aacF*ttaD*cagV*gacS*ttgM:1*cctS:2*ttaI:4*gctS:4*tccA*attS:2*accI*aaaT:2*tcgK*atgY:2*tctR:1*gccS:1*gatE*actS:1*catE:3*gcaN:2*aaaR:2*agtH*acaS*agaK*gccT*caaS:6*agaK:8*gctS:1*gctS*gttI:1*tctY*gctS:2*ttaT:2*caaR*actI:3*aatV:1*agtQ*ggtN:1*aatH*acaS*cacN:3*attV:3*aatR:3*tctA:2*attA:3*gcaS:5*gctS*acgQ*cagF*ttcM:4*gacN*aatK:8*tctN*attL:3*agcQ:2*agcD:2*caaN*gaaK:2*aatI*aaaG*tctK*acaH*caaE*ttaV-gttaat*gatE:3*ttcY:5*attH*gatE:1*agaK*aaaT*gaaA:2*aaaE:2*gcaV:2*atcL:6*ggtS*gctS:6*gatE:3*tatF:2*caaK:3*gatS:1*agcE*gatE +CM143131.1 miniprot mRNA 300672 303215 1963 - . ID=SS000004;Rank=3;Identity=0.4767;Positive=0.6935;Target=MH260578_SLA2 240 1072 +CM143131.1 miniprot CDS 300672 303215 1963 - 0 Parent=SS000004;Rank=3;Identity=0.4767;Target=MH260578_SLA2 240 1072 +##PAF MH260578_MATalpha2 224 95 224 - CM143127.1 3497966 502273 551282 132 417 0 AS:i:110 ms:i:138 np:i:75 fs:i:0 st:i:0 da:i:333 do:i:42 cg:Z:6M1D13M4I14M2D2M2D38M48610V1D6M4D32M1I12M cs:Z:*ctcM*aagM:1*tctT*aaaE:1-gtt*tctT*aaaN:1*gatT:1*aaaN*attM*aacD:1*aaaH*gacN:2+SIDI:1*gaaI*aagD*acaD*gatE*gatE*atgI*aaaS*agcT:4*aaaE-actgca:2-ttaaag*aatH:1*aaaS*tatF*gttC*aagN*tcaT*aaaD*gcaS*agtN*ggtS*gtgI:1*catT:1*aacD:1*gctS*gctS*aatR*accN*gcgG:1*aagR*gaaL:2*cccE*aaaT*gttI*gagA*aaaV:1*actN*gcaK*ttcW*caaF*gagN*aaD~gt48607ag-a-cgg*aagN*cttI:1*caaN*tggP:1-aagctaagtgac*tttV*tcaQ:2*gcaD:1*gaaS*aagY*tttL*ctgK*aatA*gaaK*gtcT:2*gacQ*gttA*gttS:9*aaaR:2*gaaR:1+G*aaaS*gctK*ataV:1*aagP*ggtS:1*atcV*gatE*gttI:1*aagN +CM143127.1 miniprot mRNA 502274 551282 138 - . ID=SS000005;Rank=1;Identity=0.3165;Positive=0.5396;Target=MH260578_MATalpha2 96 224 +CM143127.1 miniprot CDS 551047 551282 65 - 0 Parent=SS000005;Rank=1;Identity=0.2651;Target=MH260578_MATalpha2 96 172 +CM143127.1 miniprot CDS 502274 502439 73 - 1 Parent=SS000005;Rank=1;Identity=0.3929;Target=MH260578_MATalpha2 173 224 +##PAF MH260578_TGL1 440 0 440 - CM143126.1 1831595 1026320 1027712 357 1431 0 AS:i:271 ms:i:271 np:i:208 fs:i:0 st:i:0 da:i:75 do:i:60 cg:Z:43M1D25M2I9M5D40M3D22M2D25M1I36M2D27M1D22M3D11M3D18M5D28M3I11M1D23M3I13M4I19M1D26M10D29M cs:Z:*agtM*ggtN*gccL*aaaL*cttI*tttI:1*atcL:2*agtV:1*tcgA*attV*ttcV*tcaQ*tttL*tgcP:2*aatI*tatF*ttgH*gtaK*atgL*gtcG*gctV*atgE*gtgE:2*ttgS:1*agaF*aaaQ*tttT*tcaP:1*ttaN*tttR*gaaP*gctD:1-tat*cttI*gtgS*aatA*atcV*gatS*gatQ*ggtE*gaaN*atcK:3*accS*cgaP*gaaS*gagA:1*agaP*gctL*caaH*gatE*aagV*gtcA*atcT*cgaT+HC:1*gcaH:2*ttgI*gatI:1*cctA*cagN-aaaaagttgattcca*aaaD*cttI*gctV*tatD*tatI*gctV*gaaH*gtgA*agtH:1*ttaY*caaK*ctaV*gagH*accE*atcH*aaaI:1*accQ:1*gaaK:2*tttY*ataL:1*gaaS*ttgI*caaH*catR*ttaI*accL*gatK*ccaS*aatS*gagG*actD*gctK*gagP:1-attcgagca*actN*agaS*aagR*cctV*ttcV*tttY:1*ttgH:4*caaT*tctN:1*gctE*gtgL*tatF*atcL*tctL*tcaG*gatE-tccggt:1*tgtK:1*tccK*tctC*atcL*gggP*tatF*tacL:1*catV*acaD:2*tttY:8*tgtG*ggcN+K*ttcY*aagS*ggcR*gagK:1*accL*actF*tacL*aagS*acaS*aatT:1*ccgE*agaK*atgF:1*gatN*tggY*aatS*tttL*tatD:1*atgF:1*aaaM*tatF:1*gtaI*tctP*tgtN*ttcT*ttgV*gatN:2*ataL-gcttat:1*gatN:1*tttQ*aatQ*gaaD*aaaS*ataL:1*gtgY*gcaI:1*cacF:3*actS:2*cttC:1*tttA*tgtA*ataL*cttS*aatL:1-cta*aatH:1*ttcL:1*tcaK:1*gttI:1*tgtK*tatF*tttI*gcgG:1*gctS:2*attM*tacI:1*ggaQ*aaaG:1-ctaactgaa:2*ggtP*ggaI*aatA*ttcS:1*tttL*aagV*ctcT*aacS-catcattta*tccA*tccP*agcG*tctL*tacL*gatY*tcaR*tgcI:2*gttK*actR*tcaA*ttcI:2*atcS*atgV-ttattcctcagaaac*ataV:1*attW:1*accK*aaaL*gtaM:1*tgtP*aaaV:1*tttY*ggcE*tcaK:1*tccV*gccD*gccK*ataS*ttcL*ttaV*tacF:2*gacN:2*gatS+GNI:1*ttaT*tggS*aatQ:2*ttaV*aatG*aatY*agaP*aacH-ttt*cttM:1*gctS:1*accS*tatS*atcV*agtK*gctS*aaaV*ttgA*attH*aagW*tggF*tggQ*ttgI:2*gaaS*gatK*ggcR:1*ttgQ+MFD*aaaE*aacG*tacG*caaA:1*gatG*gatS*catR*attL*ttcV*ccaY*attL*aatS+GTSG:1*agtT*tggN*ttcR*gatV*gatA*gtaS*gaaF:1*gaaT:1*attT*aaaI*gatT*gttT:1*aacC*attL:1-ttg*atgV*ataY*ccaG:1*gaaS:1*aatM*atcL*gttI:1*ccaI*atgE*aagR*ttaT:1*cagD*catN*ttcL*caaS*caaC*catD*gacI*aaaQ*aaaT*ttcI*atgG-gatactcatcaaaagttacactataagatc*ttaI*catD:2*tctE:1*gttM:1*gttT:2*tgcA*aacD*gacQ:1*gttE:1*gatK:1*ggcF*caaP*cctV*atgV*gtgL*aatQ:3*actQ +CM143126.1 miniprot mRNA 1026321 1027712 271 - . ID=SS000006;Rank=1;Identity=0.2495;Positive=0.4361;Target=MH260578_TGL1 1 440 +CM143126.1 miniprot CDS 1026321 1027712 271 - 0 Parent=SS000006;Rank=1;Identity=0.2495;Target=MH260578_TGL1 1 440 +##PAF MH260578_SEC3 1357 0 1357 + CM143126.1 1831595 219563 223376 957 4290 0 AS:i:673 ms:i:654 np:i:567 fs:i:0 st:i:0 da:i:69 do:i:12 cg:Z:24M3I156M12I20M14I3M2I1M1I25M10I13M1I4M19I26M29I35M13I35M8I30M1I11M8I33M7I19M2I3M1D18M4I27M1I106M2I14M3D21M7I47M5D73M1D8M4I36M4D39M2D16M2D16M14D54M1D24M7D23M3I14M8D9M2I7M8D18M3D31M2I26M3D25M3D16M4I16M3D22M5D54M cs:Z:*agcM:1*aatQ*agtR*gccS*aacH*ttcG*aatE*catT*cagG*tctG:1*agcQ*cctR*tccL*atgF*ttgV*caaP*gctT*aatH*actK:1*ttaM:1+SMD:2*caaR:3*cagM:1*aaaM*caaH*aaaN*ttgI*atcT*agaK:1*tgcL:1*tccK*agaE*tacV:1*ccaA*gatQ:1*acaY*ttgK*cacL:2*tatF*attV*acaS*catY:3*gttI:4*tatS:9*caaP*gctL:1*catN:2*gaaN:1*attF*ataL*tctI:1*gcaS*gttA:1*aggA:2*actR*gtcM:1*gttL:2*ggcA*agaK:1*aacS*ccaS*aatS:1*tctV*ttcI:4*actS:1*aacD*ttgF:4*gaaT*attL:3*gttD*gttG*gttS*gatP*aaaT:1*cttF*ataV*gttC*gttE*ttgM:2*cctR:4*acaV*aacH:1*agtP:3*acgR:1*ttcW*ataC*aagT*agtT:1*tgtL*aatQ*attN*tatF*aagI*aaaN*tttY:3*ggtN*atgI:1*atcR:3*ttcC*gatS*aaaI*aatQ*acaY:1+HLEALYDSYRGQ:1*gatS*attS*ataM*gcaY*atgT:1*aatS*catG*ggtN*aaaI:1*acaA*actS*ctaP*agaL*tacS*acaN*gaaQ:1+AMSSPVKTSVKSSL*gaaR:1*acgP+LR*gatS+P:1*tcgK*gagS:2*cagK*attS*aacP:2*acgS*aacH*tctT*actN*tatI*agtQ*aaaR*acaS*aatP:1*aatK*gtaS*ttcS:2+EVSSLKQRLA:1*actP:1*aatL*ggaS:1*acaS:1*ataY:2*ataL:1+N*atcT:1*gatT:1+LGTAVAGNANNAFGLGVGI:1*tacP*ttaV:1*ctcK*aatS*gatS*agaE*ttaV:2*catD*gaaH*tcaQ*tcaD*acaA*ctgE*caaR*tctE*aacA*caaK*cggK*agaI:1*actE:1+NKRRQQEIEKRKREELERRRREQEEFEKN:1*gatR*agcE*aagQ:1*attE:1*aaaR*tcaI:1*ataE*atgE*ggaI*tctE*actE*gcaR*caaK:1*aatK*attE*gatE*aacQ*atgK*actR*ggaL*agaQ*tctE*tacM*agtE*aatK*aagE*aatR*ccaE*acgV:1+RIKQEELEIERQK*attQ*cctE:2*cctD:1*cctE:1*caaR*cagL*cagK:1*tttM*aatE*aatI*tcaA*cctK*tcaK*atgK*caaA*gcaQ*aatK*aatQ*tcgH*aatH*agaQ*aaaQ*tctE*gttL:1*ggcR*atcN:1*ttcI:1+PPGFAGIA*gttK*actR*tctG:1*caaP*aatS*agaE*ggaA*tttL*gatS*gatN*aaaA*aaaP*aatS*gatQ*caaM*actS*aatF:1*aatY*gaaG:1*tctE*gagS*aaaQ:1*aatH*aacH*atgQ*agtN+V:1*gatT*agaE:1*agaA*ttcN*agcT*agcI*aagG*ttaV:1+SFIEGYGS*atgS*tctG*tcaD*atgA*gatE*aacE*cttE*aatT*aggA:1*tcaL*actN:1*aaaG*gacI*acgA*gatQ*tctV*atgK*cgaQ:1*agaK*aaaD:1*agtK*tatM*actV*ggtP:1*attN*gtaL*aatS*gatK+PVITETI*gacE:1*gatS:1*gaaS:1*gatR*cttS*gtgL*aatK*cagI*tacA*gcaT:1*ccaS:3*agtK+LI:1*ggcN:1-tat:1*gatG*aatS*tttP*attM*gaaD:1*ccaK*tcaK*aagV:1*ggaD*ggtT*ggtE*gctQ:1*gcgH*gatE+NRIR*tctA*gttF*gatS*ggtR*ctcV*gatK:1*gagN*gatA*gtaT*gatN*aatK*acaL*ccaD:1*gagL:1*ttaV*tttL:2*attL*gaaG*tggY*aatD*agtP*cggL+F:1*aatD:1*aaaE*gacS*attL*tctE*tcgK:1*ttaI*atgL*agaK*tcgK:1*ttaD*aagE*accI*gaaQ:1*gacS*tctK*gttI*aatK*tcgT:1*ataT*aatD*attV*tcaT:1*agcA*tttT*ggtN*gaaA*attL*gacK*aagE*tacT:1*gaaS*aagT*agtA*attF*actK*caaS:2*aaaV*ttgI:2*atgV:1*actS*ttcL:1*cagS:3*gacS*ggtT:1*aatK:1*gaaD*attV*tcaH:3*aaaE:1*gaaG*aatQ:4*actE*actA*gcaT:1*aagE:1*gctL:1*tggM*aagN*aatE*ttaV*aagN:1*attL:1*agtH*aatS:1*agtE*ttaI:1*aaaD*gaaS*gaaK:2+KL*ataL*ctcT:1*aatK*tatI*actV*attL:1*tcgE:1*gaaN:2*attF-agaactgtg:1*ggcD*gtaI:1*aatL*tctE:2*tctN:1*tttL*caaK*actK*attM:1*ggaD*attA*gatS*aaaS*aatD*aatD+PMSANYQ:1*ggtS*aatQ*attM:3*actQ:1*agaK*tacK*accN*accV*tacF*gtgE*aatG*tatS*agtK*gacN*atgK:1*ttgV*aaaS*agcN*ttgF*aacT*tttR*ttcI*ttgS*actE*cagK*gaaL:1*caaK*aaaS*atgV*gcgS*aatM*attS*atgL*gatT*gagT*cttR*atgL*agaQ:1*accV-ataaacaatatgaat*gctT*actP*aaaE:2*gatE*ggaT*tctN*tcaF:1*atgQ*agaT:1*ataF*aacM*caaE*aatK*ttcS:1*aacL:1*ctaI*attT*tatI:3*acgI*cttA*tatF*gcgV:1*gaaS*attV*gcaS*ccgN:1*agaG*ttcY*tatD*gctS:2*gctN*ataS*tatF*caaV*gatV*tacA*atgF*aagE*tccP*agcF*acaF*aatE*ggaN*attM*tttA*gaaT*aacI*ttcL:1*aatQ*tatH*aatL*gagT*aaaS:1*ataA:1*gctS*attK:1-gca*agaE*gatE*gacP:1*caaS*tacF*aaaT*tttL+NPSQ:1*tttI:1*tatQ*agaE*ggaY*aacI*aaaN*aatS*aatR:1*ttgK*aatK*aacD*aagS*aaaA*tctK*aaaT*gatL*ttgF*acgN*gaaR:2*attK*attL*aatS*ataT*ctcE*acgA*ttaT*gatT*ttaI*gagS*aacS:1-ttgtttgataaa*attV*tgtE*ggtT*attF*attF*aaaS*ctaQ:1*gagV:1*ttgI*attM*attS*caaI*cagE:1*ataE*tttL*gttI*ggtR*gatV*ttcL:1*cacG*ttaF*ttaS:1*cttS*aatS:1*ttcC*aatL*ttgF*tccE*gatN*tttL*ttaV:1*cttV-catcct:1*ccaL*aaaS*gaaQ:1*gcgC*gttQ*tcaK:1*ttcR:1*aagT:1*cagN*ctaF*tatL-attgat*agcK*aagA*gatP*gtcI*actE:1*aagD*aacR*tccR*tctV*actG:1*tcgE*aagI*tttY*agcE-aacgatggcaatccatcgagtaataataaatccaataatgct*acgL*gttM*gatK*gtcG:2*accD*gaaP*caaV*attF*gcaG*tatA:1*atcL:1*ttcV:1*ttgF*gatS*tttL*gttS*acaK*aaaN:1*acaM*cagL*ttaE*gttI:1*actA*ttaI:1*ttaS*ttgI*attL*gatK*aatT*agcY*atgS*aaaQ*aggS*ttcL*tcaA*agtP*agaT*aacC*aatH*gacE:1*attA*gtaY*tctG*gctN:1-ttg*gagT:1*ttaF*tatE*attA*aagR*ttcI*acaN*ctgT:2*aatT*catK*tatE*gccI*aagD*actQ:1*gtcI*aaaQ*ttaN*gtaI*gccV*aacH-aatttgaactctaatttttct*gttT*gatK*aagV*aagH*atcC*aatK*attV*ctaA*tttN*gttF*attV:4*caaV:1*gttY*aaaR*tttR*acaV*gaaN*aaaN+FID:2*cgcN*attL:1*tatN*aatM*tatT*gatS*accF*attG*aaaP:2-actattactcgtgaactattggat*agcG*acaW:3*tttY*aatY*gctM:1+WA:1*atgI:1*tctA*tttA*actL:1-accttagatgccattagcgcatat:1*tcgG*aagV*aagE*ttaQ*aatL*ggaQ*actI*tcaE:2*acaV*cagF*gatE*aagG*aagI*aaaE*acaN-agctcttat:1*tatE:1*tctD*gatI:1*gctT*tcaL*atcT*aatQ*caaK*tgtH*actL*aatA:1*attL*atgL:1*agtY*agtK*tatW:1*attV*gatE*atgE*tttT*gaaR*actS*tttL*gaaN*aacG+FP:1*gttE*attL*tcgN*caaK*ttcS*agaI*aatD*gagD*atcL*ataR*gagD:1*attE*tatL:2*agcF*agcT*agaG*acaS*tatF:1*gttR*tccQ*attF-gttaattct*agcR*ttgI:1*aagG*ttaV*cttI*gagR*ttcL*attV:2*tttM:2*ttaV*caaL*attS*acaE*acaH*agaS*tccN*aagP*attA*tcaN*ataM-actaaaaac:1*actS:2*aagI:1*aatT*ttcI*cgaK*aaaE:1*ttgM*gaaS*cagS*catF*aatK+GDNF:1*catQ:1*gttI*aatS*agaS*tgtI*attA:1*gctH*aatL*tacK*aaaE*aagT*attL*gaaK-gcagatttc*aatG*gatR*ttgC*aatY*agcN:2*atgD*aaaP:2*tacD*gacS:1*cttY*ttaS*attV*ctcA*agaI*ttgG:2-aaagaatttcaagcc*ttgI*aaaE*agcK*agaE:1*gtaY*gaaN*aaaN*ataC*tggM*cagY*cagT*accI*gaaS*acaQ*gagH*tatF:1*ttaS:1*catF*aagT:1*gtcL:1*gacN:1*aaaV*agtE:1*tatH:1*aaaI*gatN*gttF*gatE*attV*gacP:1*acaD*agaK*aatY*aatI*ttgI*gttN*gatF*atgN:2*actK*gttY*gcaY*aagS*gctV +CM143126.1 miniprot mRNA 219564 223376 654 + . ID=SS000007;Rank=1;Identity=0.2231;Positive=0.3965;Target=MH260578_SEC3 1 1357 +CM143126.1 miniprot CDS 219564 223376 654 + 0 Parent=SS000007;Rank=1;Identity=0.2231;Target=MH260578_SEC3 1 1357 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 163 70 163 + CM143131.1 1178080 298633 298897 90 288 0 AS:i:110 ms:i:100 np:i:55 fs:i:0 st:i:0 da:i:246 do:i:18 cg:Z:7M3D26M4I33M1I10M1I1M2I8M cs:Z::2*cagT:2*ataP*aaaR-cgtagtgac:1*aagR*gccI*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actR*tttC:2*agcN*aatD:1*tacV +CM143131.1 miniprot mRNA 298634 298897 100 + . ID=SS000008;Rank=1;Identity=0.3125;Positive=0.5729;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 71 163 +CM143131.1 miniprot CDS 298634 298897 100 + 0 Parent=SS000008;Rank=1;Identity=0.3125;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 71 163 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 163 70 163 - CM143130.1 2250200 2219108 2219372 90 288 0 AS:i:110 ms:i:100 np:i:55 fs:i:0 st:i:0 da:i:246 do:i:18 cg:Z:7M3D26M4I33M1I10M1I1M2I8M cs:Z::2*cagT:2*attP*aaaR-cgtagtgac:1*aagR*gccI*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actR*tttC:2*agcN*aatD:1*tacV +CM143130.1 miniprot mRNA 2219109 2219372 100 - . ID=SS000009;Rank=2;Identity=0.3125;Positive=0.5729;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 71 163 +CM143130.1 miniprot CDS 2219109 2219372 100 - 0 Parent=SS000009;Rank=2;Identity=0.3125;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 71 163 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 163 70 163 + CM143129.1 2335549 470666 470930 90 288 0 AS:i:110 ms:i:100 np:i:55 fs:i:0 st:i:0 da:i:246 do:i:18 cg:Z:7M3D26M4I33M1I10M1I1M2I8M cs:Z::2*cagT:2*ataP*aaaR-cgtagtgac:1*aagR*gccI*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actR*tttC:2*agcN*aatD:1*tacV +CM143129.1 miniprot mRNA 470667 470930 100 + . ID=SS000010;Rank=3;Identity=0.3125;Positive=0.5729;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 71 163 +CM143129.1 miniprot CDS 470667 470930 100 + 0 Parent=SS000010;Rank=3;Identity=0.3125;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 71 163 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 163 70 163 + CM143128.1 3172219 2742192 2742456 90 288 0 AS:i:110 ms:i:100 np:i:55 fs:i:0 st:i:0 da:i:246 do:i:18 cg:Z:7M3D26M4I33M1I10M1I1M2I8M cs:Z::2*cagT:2*ataP*aaaR-cgtagtgac:1*aagR*gccI*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actR*tttC:2*agcN*aatD:1*tacV +CM143128.1 miniprot mRNA 2742193 2742456 100 + . ID=SS000011;Rank=4;Identity=0.3125;Positive=0.5729;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 71 163 +CM143128.1 miniprot CDS 2742193 2742456 100 + 0 Parent=SS000011;Rank=4;Identity=0.3125;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 71 163 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 163 70 163 - CM143127.1 3497966 502249 502513 90 288 0 AS:i:110 ms:i:100 np:i:55 fs:i:0 st:i:0 da:i:246 do:i:18 cg:Z:7M3D26M4I33M1I10M1I1M2I8M cs:Z::2*cagT:2*ataP*aaaR-cgtagtgac:1*aagR*gccI*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actR*tttC:2*agcN*aatD:1*tacV +CM143127.1 miniprot mRNA 502250 502513 100 - . ID=SS000012;Rank=5;Identity=0.3125;Positive=0.5729;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 71 163 +CM143127.1 miniprot CDS 502250 502513 100 - 0 Parent=SS000012;Rank=5;Identity=0.3125;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 71 163 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 163 70 163 + CM143126.1 1831595 1288497 1288761 90 288 0 AS:i:110 ms:i:100 np:i:55 fs:i:0 st:i:0 da:i:246 do:i:18 cg:Z:7M3D26M4I33M1I10M1I1M2I8M cs:Z::2*cagT:2*ataP*aaaR-cgtagtgac:1*aagR*gccI*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actR*tttC:2*agcN*aatD:1*tacV +CM143126.1 miniprot mRNA 1288498 1288761 100 + . ID=SS000013;Rank=6;Identity=0.3125;Positive=0.5729;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 71 163 +CM143126.1 miniprot CDS 1288498 1288761 100 + 0 Parent=SS000013;Rank=6;Identity=0.3125;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 71 163 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 195 39 159 + CM143130.1 2250200 2218551 2218911 126 360 0 AS:i:202 ms:i:202 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:105 cg:Z:120M cs:Z::1*acgL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:4*ttcY*aagG*aaaA*actI*cctD*agaN*atgG*aatK*gaaD*ataS*agcL*gatN*caaK*tgtV:1*gaaP:2*aaaS*aacS*aagR*gcaH*cagR*aaaV*aaaQ*ccaK*accE:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaR:2*aatE*gtcM:1*actL:1 +CM143130.1 miniprot mRNA 2218552 2218911 202 + . ID=SS000014;Rank=1;Identity=0.3500;Positive=0.5500;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 40 159 +CM143130.1 miniprot CDS 2218552 2218911 202 + 0 Parent=SS000014;Rank=1;Identity=0.3500;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 40 159 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 195 39 159 - CM143131.1 1178080 299094 299454 123 360 0 AS:i:200 ms:i:200 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:105 cg:Z:120M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:4*ttcY*aagG*aaaA*actI*cccD*agaN*atgG*aatK*gaaD*ataS*agcL*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacS*aagR*gcaH*cagR*aagV*aaaQ*ccaK*accE:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaR:2*gatE*gtcM:1*actL:1 +CM143131.1 miniprot mRNA 299095 299454 200 - . ID=SS000015;Rank=2;Identity=0.3417;Positive=0.5500;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 40 159 +CM143131.1 miniprot CDS 299095 299454 200 - 0 Parent=SS000015;Rank=2;Identity=0.3417;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 40 159 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 195 39 159 - CM143129.1 2335549 471127 471487 123 360 0 AS:i:200 ms:i:200 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:105 cg:Z:120M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:4*ttcY*aagG*aaaA*actI*cccD*agaN*atgG*aatK*gaaD*ataS*agcL*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacS*aagR*gcaH*cagR*aagV*aaaQ*ccaK*accE:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaR:2*gatE*gtcM:1*actL:1 +CM143129.1 miniprot mRNA 471128 471487 200 - . ID=SS000016;Rank=3;Identity=0.3417;Positive=0.5500;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 40 159 +CM143129.1 miniprot CDS 471128 471487 200 - 0 Parent=SS000016;Rank=3;Identity=0.3417;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 40 159 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 195 39 159 - CM143128.1 3172219 2742649 2743009 123 360 0 AS:i:200 ms:i:200 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:105 cg:Z:120M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:4*ttcY*aagG*aaaA*actI*cccD*agaN*atgG*aatK*gaaD*ataS*agcL*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacS*aagR*gcgH*cagR*aagV*aaaQ*ccaK*accE:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaR:2*gatE*gtcM:1*actL:1 +CM143128.1 miniprot mRNA 2742650 2743009 200 - . ID=SS000017;Rank=4;Identity=0.3417;Positive=0.5500;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 40 159 +CM143128.1 miniprot CDS 2742650 2743009 200 - 0 Parent=SS000017;Rank=4;Identity=0.3417;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 40 159 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 195 39 159 + CM143127.1 3497966 501696 502056 123 360 0 AS:i:200 ms:i:200 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:105 cg:Z:120M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:4*ttcY*aagG*aaaA*actI*cccD*agaN*atgG*aatK*gaaD*ataS*agcL*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacS*aagR*gcgH*cagR*aagV*aaaQ*ccaK*accE:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaR:2*gatE*gtcM:1*actL:1 +CM143127.1 miniprot mRNA 501697 502056 200 + . ID=SS000018;Rank=5;Identity=0.3417;Positive=0.5500;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 40 159 +CM143127.1 miniprot CDS 501697 502056 200 + 0 Parent=SS000018;Rank=5;Identity=0.3417;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 40 159 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 195 39 159 - CM143126.1 1831595 1288954 1289314 123 360 0 AS:i:200 ms:i:200 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:105 cg:Z:120M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:4*ttcY*aagG*aaaA*actI*cccD*agaN*atgG*aatK*gaaD*ataS*agcL*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacS*aagR*gcgH*cagR*aagV*aaaQ*ccaK*accE:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaR:2*gatE*gtcM:1*actL:1 +CM143126.1 miniprot mRNA 1288955 1289314 200 - . ID=SS000019;Rank=6;Identity=0.3417;Positive=0.5500;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 40 159 +CM143126.1 miniprot CDS 1288955 1289314 200 - 0 Parent=SS000019;Rank=6;Identity=0.3417;Target=460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 40 159 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=0|name=sla2|role=flanking_conserved 1019 210 1019 - CM143128.1 3172219 2744263 2746837 1050 2586 0 AS:i:1564 ms:i:1564 np:i:541 fs:i:0 st:i:0 da:i:-1 do:i:24 cg:Z:53M1D36M4D4M2I260M1I7M14D21M4D12M7D69M1I30M1D66M9D8M11D187M2D52M cs:Z::1*gctL*cgcY*agaK*actS*acaS*agtE:3*gctV*ttgI*gaaA:2*agaK*caaD:1*tatF:1*tctV:2*caaR:9*accS:1*cttI*cacK:3*tctT:1*atcV*aacT:2*aagR:1*acgP*accS:3-gat*ttgI:1*attQ:2*aacE*acgD*ggtP*attQ*cgtG*agaF:1*cctL*accV*aagR*gcgE*ccgR*gcgS*gcgS*aagV:1*ccaN*acgS*gcaE*agtE*ccgS*ccaN*ccaI:1*ccaR*ccaS*aagS*gaaN:1*gcaQ:1-cctttaatcaat:4+AM:1*gaaD*ttcS*tggF*aaaV*gctR:2*gacQ*aatE*gtgL:1*gctE*gaaQ:1*gaaR*agaQ*ttaA*gccE*agaE*gaaR:1*aatQ:1*caaE:2*gcgE:2*gaaM*gaaL:1*gctR*aatD:1*caaA*gctR*gcaF*tttW:1*cagE:3*gaaQ*ttgQ*cagA*caaV*cagS:1*cagE*atgL:2*caaS:1*atgL:1*caaA*caaD*tatQ*catM*acaQ*caaR*gcgQ:3*agaK*gtaL:1*gaaQ:2*cgcQ:3*gctT:1*aagG*aacG:1*tacH*gatE*caaR:3*ttgM:1*caaE:10*cagN:1*gcgL*atgR*aatI*gccV*aatT:1*gctT:1*actE*caaE:1*attL:1*ttgV:1*gatT*gaaS*agtQ*cttC*aatS*agtH*gtcL*caaE:2*ttgV*aacQ*ttgY*ttcW:1*agcN:4*ataL:15*caaG:3*aagI*ttgV:9*gctS:4*gacE*aggK*attL:8*gttI:14*gagD*attL*gacA*aagR*ttaI*agaK:1*tctN*aagD*gacS*tctE*ttgQ*attV*gaaQ*aaaM:1*gaaR*gccT*gaaQ*gttL*aatR*actD*ttgM*aagE*gatT:2*gatK*gtgS*acaL:1*agaE*aacT*cagH:1*tctQ:2*aacA:1*attL:1*aacS*gcaQ:1*cgaS:2*atgI:2*cttI*gaaK*accA*aaaS*ttgA*aaaS:1+L*agaK:1*tcgG*caaG*atcL*tcaN:1-atgtcaccagagtcaaatgctgagctacaggaaacattgcgt:1*aagA*gatQ*gagQ:1*atcV*gaaQ*attM:3*acaA:3*gcgT*ttaM*aaaQ*cagE:2-gagtctaaaagg:1*agcQ*gaaH*gaaQ:2*gatE*gaaK*caaE*attA*gatE:1-gtgttacaagaacatatcatg*aagR*ctaV*gttL*gctR*attL:2*tctT*attL:1*caaK*agcV*ggtS*gtgS*aaaD:1*atcL*gaaR*gacE*agtF*ttaV:1*gagN:1*gatE:1*tcgP*atgV*caaY*ggcS*ggtN*aatT*caaD*aacI*tcaP*tcaT*ccaA*tcaE:2*ctaG:1*attM*attL:1*aaaR*gcaV*ggcS*gaaH*acaL:1*caaT*gaaQ:1*gctS:1*gctT*ttcM*aatT*aacD*tttY:3*ggaN*ccaM*agcK:1*gatE+S*tatE*gctS*gagG*atcL:1*tctK*actA:1*tcaI:1*ttcL:1*ctgD*tgtS:1*acaG*gatN*gttL*gagF*ttgS:3*ggcA*atcV*attL*aagR*tttD*tgcR:1-aca*gagD*aatD*ttgV*gaaQ*aacE*tcgI:1*ttaV*tcaE*tctG*gcaS*agaK*ttgD*gttL*ggtA*gagH*acaM*tgcV*attE*gaaL:1*ttgF:1*gatS*ttaM:2*aagN*aatH:1*gaaL*agcK:1*agcE*gaaI*gaaH*caaE*aagR*tcaT:1*aaaR:2*gaaT:1*gtcN*gttI*gaaN*atcV*catQ:1*agaV*ttaI*gaaQ*gaaS:1*actM*acaQ*ttgV*attV:1*actV*attF*gcaR*tctD*acgP-agcggtggcggcggcggcggcggcggt:1*agtR*agcK*agcT*agcP*aacV:1*aacS-aacaagttcattgagatcgaaaaacaaacagaa*gagD:2*gaaG*agcY*ttgF*gtgL:1*aacK:1*atgL*aacA*gctN*gctT*gcgQ*gagA*gttA*atcV*aagE*caaK:1*acaA*ttaG*cacL:1*acgE:1*ttgM*ctaS:1*agcR*aaaH*aacK:1*cagE*gacV*ttgQ*tcaE*cctD*attG*gacS:4*aagE:2*ttgI*gcaS*gcaC*tccA*attS:2*accI*aaaN:1*attV*tcgK*atgL:1*atcL*tctE:1*gccC:2*actA:1*catE:3*gcaS*aatR:1*aaaR:2*agtM*acaS:2*caaL:15*gctS:1*gctQ:2*tctY:2*aacG*ttaI:2*caaR*actM:3*aatV:1*agtA:1*aagT:1*acaS*cacS:12*tctA:1*attA:3*gcaS*gctS*gcaS:3*gctS*acgD*cagL*ttcM:1*aagQ*actS*caaH*gacL:3*gatE:2*aagR:2*tctT*attS*gctS:2*agcM:2*agcT*caaK:1*caaR*gaaS:1*attL*aatL*aaaS*tctD*acaE*caaS-ttagtt:1*gatK*gatT*attV:1*ttcY:1*aagQ:1*agtT*atcA*attH*gatE:2*aaaT*gaaA:1*atgL*aaaE:2*gcaV:2*atcL:3*aatS:2*ggtS*gctH:6*gatE:3*tatF:2*caaR:1*gatE*gatE*gatS +CM143128.1 miniprot mRNA 2744264 2746837 1564 - . ID=SS000020;Rank=1;Identity=0.4060;Positive=0.6276;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=0|name=sla2|role=flanking_conserved 211 1019 +CM143128.1 miniprot CDS 2744264 2746837 1564 - 0 Parent=SS000020;Rank=1;Identity=0.4060;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=0|name=sla2|role=flanking_conserved 211 1019 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=0|name=sla2|role=flanking_conserved 1019 210 1019 + CM143127.1 3497966 497868 500442 1047 2586 0 AS:i:1561 ms:i:1561 np:i:541 fs:i:0 st:i:0 da:i:-1 do:i:24 cg:Z:53M1D35M4D5M2I260M1I7M14D21M4D12M7D69M1I30M1D66M9D8M11D187M2D52M cs:Z::1*gctL*cgcY*agaK*actS*acaS*agtE:3*gctV*ttgI*gaaA:2*agaK*caaD:1*tatF:1*tctV:2*caaR:9*accS:1*cttI*cacK:3*tctT:1*atcV*aacT:2*aagR:1*acaP*accS*actS:2-gat*ttgI:1*attQ:2*aacE*acgD*ggtP*attQ*cgtG*agaF:1*cctL*accV*aagR*gcgE*ccgR*gcgS*gcgS*aagV:1*ccaN*acgS*gcaE*agtE*ccgS*ccaN*ccaI:1*ccaR*ccaS*aagS*gaaN:1*gcaQ-aaccctttaatc*aatS:4+AM:1*gaaD*ttcS*tggF*aaaV*gctR:2*gacQ*aatE*gtgL:1*gctE*gaaQ:1*gaaR*agaQ*ttaA*gccE*agaE*gaaR:1*aatQ:1*caaE:2*gcgE:2*gaaM*gaaL:1*gctR*aatD:1*caaA*gctR*gcaF*tttW:1*cagE:3*gaaQ*ttgQ*cagA*caaV*cagS:1*cagE*atgL:2*caaS:1*atgL:1*caaA*caaD*tatQ*catM*acaQ*caaR*gcgQ:3*agaK*gtaL:1*gaaQ:2*cgcQ:3*gctT:1*aagG*aacG:1*tacH*gatE*caaR:3*ttgM:1*caaE:10*cagN:1*gcgL*atgR*aatI*gccV*aatT:1*gctT:1*actE*caaE:1*attL:1*ttgV:1*gatT*gaaS*agtQ*cttC*aatS*agtH*gtcL*caaE:2*ttgV*aacQ*ttgY*ttcW:1*agcN:4*ataL:15*caaG:3*aagI*ttgV:9*gctS:4*gacE*aggK*attL:8*gttI:14*gagD*attL*gacA*aagR*ttaI*agaK:1*tctN*aagD*gacS*tctE*ttgQ*attV*gaaQ*aaaM:1*gaaR*gccT*gaaQ*gttL*aatR*actD*ttgM*aagE*gatT:2*gatK*gtgS*acaL:1*agaE*aacT*cagH:1*tctQ:2*aacA:1*attL:1*aacS*gcaQ:1*cgaS:2*atgI:2*cttI*gaaK*accA*aaaS*ttgA*aaaS:1+L*agaK:1*tcgG*caaG*atcL*tcaN:1-atgtcaccagagtcaaatgctgagctacaggaaacattgcgt:1*aagA*gatQ*gagQ:1*atcV*gaaQ*attM:3*acaA:3*gcgT*ttaM*aaaQ*cagE:2-gagtctaaaagg:1*agcQ*gaaH*gaaQ:2*gatE*gaaK*caaE*attA*gatE:1-gtgttacaagaacatatcatg*aagR*ctaV*gttL*gctR*attL:2*tctT*attL:1*caaK*agcV*ggtS*gtgS*aaaD:1*atcL*gaaR*gatE*agtF*ttaV:1*gagN:1*gatE:1*tcgP*atgV*caaY*ggcS*ggtN*aatT*caaD*aacI*tcaP*tcaT*ccaA*tcaE:2*ctaG:1*attM*attL:1*aaaR*gcaV*ggcS*gaaH*acaL:1*caaT*gaaQ:1*gctS:1*gctT*ttcM*aatT*aacD*tttY:3*ggaN*ccaM*agcK:1*gatE+S*tatE*gctS*gagG*atcL:1*tctK*actA:1*tcaI:1*ttcL:1*ctgD*tgtS:1*acaG*gatN*gttL*gagF*ttgS:3*ggcA*atcV*attL*aagR*tttD*tgcR:1-aca*gagD*aatD*ttgV*gaaQ*aacE*tcgI:1*ttaV*tcaE*tctG*gcaS*agaK*ttgD*gttL*ggtA*gagH*acaM*tgcV*attE*gaaL:1*ttgF:1*gatS*ttaM:2*aagN*aatH:1*caaL*agcK:1*agcE*gaaI*gaaH*caaE*aagR*tcaT:1*aaaR:2*gaaT:1*gtcN*gttI*gaaN*atcV*catQ:1*agaV*ttaI*gaaQ*gaaS:1*actM*acaQ*ttgV*attV:1*actV*attF*gcaR*tctD*acgP-agcggtggcggcggcggcggcggcggt:1*ggtR*agcK*agcT*agcP*aacV:1*aacS-aacaagttcattgagatcgaaaaacaaacagaa*gagD:2*gaaG*agcY*ttgF*gtgL:1*aacK:1*atgL*aacA*gctN*gctT*gcgQ*gagA*gttA*atcV*aagE*caaK:1*accA*ttaG*cacL:1*acgE:1*ttgM*ctaS:1*agcR*aaaH*aacK:1*cagE*gacV*ttgQ*tcaE*cctD*attG*gacS:4*aagE:2*ttgI*gcaS*gcaC*tccA*attS:2*accI*aaaN:1*attV*tcgK*atgL:1*atcL*tctE:1*gccC:2*actA:1*catE:3*gcaS*aatR:1*aaaR:2*agtM:3*caaL:15*gctS:1*gctQ:2*tctY:2*aacG*ttaI:2*caaR*actM:3*aatV:1*agtA:1*aagT:1*acaS*cacS:12*tctA:1*attA:3*gcaS*gctS*gcaS:3*gctS*acgD*cagL*ttcM:1*aagQ*actS*caaH*gacL:3*gatE:2*aagR:2*tctT*attS*gctS:2*agcM:2*agcT*caaK:1*caaR*gaaS:1*attL*aatL*aaaS*tctD*acaE*caaS-ttagtt:1*gatK*gatT*attV:1*ttcY:1*aagQ:1*agtT*atcA*attH*gatE:2*aaaT*gaaA:1*atgL*aaaE:2*gcaV:2*atcL:3*aatS:2*ggtS*gctH:6*gatE:3*tatF:2*caaR:1*gatE*gatE*gatS +CM143127.1 miniprot mRNA 497869 500442 1561 + . ID=SS000021;Rank=2;Identity=0.4049;Positive=0.6276;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=0|name=sla2|role=flanking_conserved 211 1019 +CM143127.1 miniprot CDS 497869 500442 1561 + 0 Parent=SS000021;Rank=2;Identity=0.4049;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=0|name=sla2|role=flanking_conserved 211 1019 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 190 36 162 + CM143130.1 2250200 2218551 2218929 129 378 0 AS:i:205 ms:i:205 np:i:70 fs:i:0 st:i:0 da:i:108 do:i:87 cg:Z:126M cs:Z::1*acgL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:2*actS:1*ttcY*aagG*aaaA*actI*cctD*agaN*atgG:1*gaaD*ataS:1*gatN*caaK*tgtV:1*gaaP:2*aaaS*aacR*aagR*gcaH*cagR*aaaV*aaaQ*ccaK*accQ:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaI:2*aatE*gtcM:1*actL*agtN*caaK*atgK*gacL*aaaR*gtaK:1 +CM143130.1 miniprot mRNA 2218552 2218929 205 + . ID=SS000022;Rank=1;Identity=0.3413;Positive=0.5556;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 37 162 +CM143130.1 miniprot CDS 2218552 2218929 205 + 0 Parent=SS000022;Rank=1;Identity=0.3413;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 37 162 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 190 36 162 - CM143131.1 1178080 299076 299454 126 378 0 AS:i:203 ms:i:203 np:i:70 fs:i:0 st:i:0 da:i:108 do:i:87 cg:Z:126M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:2*actS:1*ttcY*aagG*aaaA*actI*cccD*agaN*atgG:1*gaaD*ataS:1*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacR*aagR*gcaH*cagR*aagV*aaaQ*ccaK*accQ:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaI:2*gatE*gtcM:1*actL*agtN*caaK*atgK*gacL*aagR*gtaK:1 +CM143131.1 miniprot mRNA 299077 299454 203 - . ID=SS000023;Rank=2;Identity=0.3333;Positive=0.5556;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 37 162 +CM143131.1 miniprot CDS 299077 299454 203 - 0 Parent=SS000023;Rank=2;Identity=0.3333;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 37 162 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 190 36 162 - CM143129.1 2335549 471109 471487 126 378 0 AS:i:203 ms:i:203 np:i:70 fs:i:0 st:i:0 da:i:108 do:i:87 cg:Z:126M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:2*actS:1*ttcY*aagG*aaaA*actI*cccD*agaN*atgG:1*gaaD*ataS:1*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacR*aagR*gcaH*cagR*aagV*aaaQ*ccaK*accQ:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaI:2*gatE*gtcM:1*actL*agtN*caaK*atgK*gacL*aagR*gtaK:1 +CM143129.1 miniprot mRNA 471110 471487 203 - . ID=SS000024;Rank=3;Identity=0.3333;Positive=0.5556;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 37 162 +CM143129.1 miniprot CDS 471110 471487 203 - 0 Parent=SS000024;Rank=3;Identity=0.3333;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 37 162 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 190 36 162 - CM143128.1 3172219 2742631 2743009 126 378 0 AS:i:203 ms:i:203 np:i:70 fs:i:0 st:i:0 da:i:108 do:i:87 cg:Z:126M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:2*actS:1*ttcY*aagG*aaaA*actI*cccD*agaN*atgG:1*gaaD*ataS:1*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacR*aagR*gcgH*cagR*aagV*aaaQ*ccaK*accQ:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaI:2*gatE*gtcM:1*actL*agtN*caaK*atgK*gacL*aagR*gtaK:1 +CM143128.1 miniprot mRNA 2742632 2743009 203 - . ID=SS000025;Rank=4;Identity=0.3333;Positive=0.5556;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 37 162 +CM143128.1 miniprot CDS 2742632 2743009 203 - 0 Parent=SS000025;Rank=4;Identity=0.3333;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 37 162 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 190 36 162 + CM143127.1 3497966 501696 502074 126 378 0 AS:i:203 ms:i:203 np:i:70 fs:i:0 st:i:0 da:i:108 do:i:87 cg:Z:126M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:2*actS:1*ttcY*aagG*aaaA*actI*cccD*agaN*atgG:1*gaaD*ataS:1*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacR*aagR*gcgH*cagR*aagV*aaaQ*ccaK*accQ:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaI:2*gatE*gtcM:1*actL*agtN*caaK*atgK*gacL*aagR*gtaK:1 +CM143127.1 miniprot mRNA 501697 502074 203 + . ID=SS000026;Rank=5;Identity=0.3333;Positive=0.5556;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 37 162 +CM143127.1 miniprot CDS 501697 502074 203 + 0 Parent=SS000026;Rank=5;Identity=0.3333;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 37 162 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 190 36 162 - CM143126.1 1831595 1288936 1289314 126 378 0 AS:i:203 ms:i:203 np:i:70 fs:i:0 st:i:0 da:i:108 do:i:87 cg:Z:126M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:2*actS:1*ttcY*aagG*aaaA*actI*cccD*agaN*atgG:1*gaaD*ataS:1*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacR*aagR*gcgH*cagR*aagV*aaaQ*ccaK*accQ:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaI:2*gatE*gtcM:1*actL*agtN*caaK*atgK*gacL*aagR*gtaK:1 +CM143126.1 miniprot mRNA 1288937 1289314 203 - . ID=SS000027;Rank=6;Identity=0.3333;Positive=0.5556;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 37 162 +CM143126.1 miniprot CDS 1288937 1289314 203 - 0 Parent=SS000027;Rank=6;Identity=0.3333;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 37 162 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 222 16 222 + CM143131.1 1178080 298303 298897 159 645 0 AS:i:115 ms:i:99 np:i:96 fs:i:0 st:i:0 da:i:156 do:i:18 cg:Z:31M6D30M4I7M1I32M4I9M3D28M4I33M1I10M1I1M2I8M cs:Z:*ataL*aatD*aagR*ataL*atgI*gaaD:1*cttI*tccT*aacE*gtaS*tacD*aatL:2*ttgE*tcgD:2*acgY*gttW:2*attH:1*aacH*aacS*aagL:1*gaaA:1-aatgcaatcaaacaaaag*gttI*gttT*aaaH*ataT*ttgV*aaaS*gaaS*tatP:1*aaaG*ataT*tccP*tctM*cagD*aacD*aggM*acaL*tctG*ttaQ*ttgI*tcgQ*gttE*gctR*gatT*ttcK:1*gatL:1*ttgY:1+LMER:1*ctaI*attR*ggcA*gaaA:1*tatL+E*aatQ:2*aatL:1*attY*tttI*tacS:1*caaK*aatP*agaH*attD*actK*aggF*acgC*ttaK:1*aacS*gttM*cctE*gttS*gttF*aaaT*aacT*gacE*gagR*cctT*gcaI:1*gaaY*gtcT+RDCP*tcaP*ttcY*aacA*ataA:2*cagT:2-ataaaacgt*agtP*gacG:2*gccT*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actD*tttC:2*agcN*aatD:1*tacV +CM143131.1 miniprot mRNA 298304 298897 99 + . ID=SS000028;Rank=1;Identity=0.2465;Positive=0.4465;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 17 222 +CM143131.1 miniprot CDS 298304 298897 99 + 0 Parent=SS000028;Rank=1;Identity=0.2465;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 17 222 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 222 16 222 - CM143130.1 2250200 2219108 2219702 159 645 0 AS:i:115 ms:i:99 np:i:96 fs:i:0 st:i:0 da:i:-1 do:i:18 cg:Z:31M6D30M4I7M1I32M4I9M3D28M4I33M1I10M1I1M2I8M cs:Z:*ataL*aatD*aagR*ataL*atgI*gaaD:1*cttI*tccT*aacE*gtaS*tacD*aatL:2*ttgE*tcgD:2*acgY*gttW:2*attH:1*aacH*aacS*aagL:1*gaaA:1-aatgcaatcaaacaaaag*gtcI*gttT*aaaH*ataT*ttgV*aaaS*gaaS*tatP:1*aaaG*ataT*tccP*tctM*cagD*aacD*aggM*acaL*tctG*ttaQ*ttgI*tcgQ*gttE*gctR*gatT*ttcK:1*gatL:1*ttgY:1+LMER:1*ctaI*attR*ggcA*gaaA:1*tatL+E*aacQ:2*aatL:1*attY*tttI*tacS:1*caaK*aatP*agaH*attD*accK*aggF*acgC*ttaK:1*aacS*gttM*cctE*gttS*gttF*aaaT*aacT*gacE*gagR*cctT*gcaI:1*gaaY*gtcT+RDCP*tcaP*ttcY*aacA*ataA:2*cagT:2-attaaacgt*agtP*gacG:2*gccT*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actD*tttC:2*agcN*aatD:1*tacV +CM143130.1 miniprot mRNA 2219109 2219702 99 - . ID=SS000029;Rank=2;Identity=0.2465;Positive=0.4465;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 17 222 +CM143130.1 miniprot CDS 2219109 2219702 99 - 0 Parent=SS000029;Rank=2;Identity=0.2465;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 17 222 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 222 16 222 + CM143129.1 2335549 470336 470930 159 645 0 AS:i:115 ms:i:99 np:i:96 fs:i:0 st:i:0 da:i:-1 do:i:18 cg:Z:31M6D30M4I7M1I32M4I9M3D28M4I33M1I10M1I1M2I8M cs:Z:*ataL*aatD*aagR*ataL*atgI*gaaD:1*cttI*tccT*aacE*gtaS*tacD*aatL:2*ttgE*tcgD:2*acgY*gttW:2*attH:1*aacH*aacS*aagL:1*gaaA:1-aatgcaatcaaacaaaag*gttI*gttT*aaaH*ataT*ttgV*aaaS*gaaS*tatP:1*aaaG*ataT*tccP*tctM*cagD*aacD*aggM*acaL*tctG*ttaQ*ttgI*tcgQ*gttE*gctR*gatT*ttcK:1*gatL:1*ttgY:1+LMER:1*ctaI*attR*ggcA*gaaA:1*tatL+E*aatQ:2*aatL:1*attY*tttI*tacS:1*caaK*aatP*agaH*attD*actK*aggF*acgC*ttaK:1*aacS*gttM*cctE*gttS*gttF*aaaT*aacT*gacE*gagR*cctT*gcaI:1*gaaY*gtcT+RDCP*tcaP*ttcY*aacA*ataA:2*cagT:2-ataaaacgt*agtP*gacG:2*gccT*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actD*tttC:2*agcN*aatD:1*tacV +CM143129.1 miniprot mRNA 470337 470930 99 + . ID=SS000030;Rank=3;Identity=0.2465;Positive=0.4465;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 17 222 +CM143129.1 miniprot CDS 470337 470930 99 + 0 Parent=SS000030;Rank=3;Identity=0.2465;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 17 222 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 222 16 222 + CM143128.1 3172219 2741862 2742456 159 645 0 AS:i:115 ms:i:99 np:i:96 fs:i:0 st:i:0 da:i:51 do:i:18 cg:Z:31M6D30M4I7M1I32M4I9M3D28M4I33M1I10M1I1M2I8M cs:Z:*ataL*aatD*aagR*ataL*atgI*gaaD:1*cttI*tccT*aacE*gtaS*tacD*aatL:2*ttgE*tcgD:2*acgY*gttW:2*attH:1*aacH*aacS*aagL:1*gaaA:1-aatgcaatcaaacaaaag*gttI*gttT*aaaH*ataT*ttgV*aaaS*gaaS*tatP:1*aaaG*ataT*tccP*tctM*cagD*aacD*aggM*acaL*tctG*ttaQ*ttgI*tcgQ*gttE*gctR*gatT*ttcK:1*gatL:1*ttgY:1+LMER:1*ctaI*attR*ggcA*gaaA:1*tatL+E*aacQ:2*aatL:1*attY*tttI*tacS:1*caaK*aatP*agaH*attD*actK*aggF*acgC*ttaK:1*aacS*gttM*cctE*gttS*gttF*aaaT*aacT*gacE*gagR*cctT*gcaI:1*gaaY*gtcT+RDCP*tcaP*ttcY*aacA*ataA:2*cagT:2-ataaaacgt*agtP*gacG:2*gccT*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actD*tttC:2*agcN*aatD:1*tacV +CM143128.1 miniprot mRNA 2741863 2742456 99 + . ID=SS000031;Rank=4;Identity=0.2465;Positive=0.4465;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 17 222 +CM143128.1 miniprot CDS 2741863 2742456 99 + 0 Parent=SS000031;Rank=4;Identity=0.2465;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 17 222 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 222 16 222 - CM143127.1 3497966 502249 502843 159 645 0 AS:i:115 ms:i:99 np:i:96 fs:i:0 st:i:0 da:i:51 do:i:18 cg:Z:31M6D30M4I7M1I32M4I9M3D28M4I33M1I10M1I1M2I8M cs:Z:*ataL*aatD*aagR*ataL*atgI*gaaD:1*cttI*tccT*aacE*gtaS*tacD*aatL:2*ttgE*tcgD:2*acgY*gttW:2*attH:1*aacH*aacS*aagL:1*gaaA:1-aatgcaatcaaacaaaag*gttI*gttT*aaaH*ataT*ttgV*aaaS*gaaS*tatP:1*aaaG*ataT*tccP*tctM*cagD*aacD*aggM*acaL*tctG*ttaQ*ttgI*tcgQ*gttE*gctR*gatT*ttcK:1*gatL:1*ttgY:1+LMER:1*ctaI*attR*ggcA*gaaA:1*tatL+E*aacQ:2*aatL:1*attY*tttI*tacS:1*caaK*aatP*agaH*attD*actK*aggF*acgC*ttaK:1*aacS*gttM*cctE*gttS*gttF*aaaT*aacT*gacE*gagR*cctT*gcaI:1*gaaY*gtcT+RDCP*tcaP*ttcY*aacA*ataA:2*cagT:2-ataaaacgt*agtP*gacG:2*gccT*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actD*tttC:2*agcN*aatD:1*tacV +CM143127.1 miniprot mRNA 502250 502843 99 - . ID=SS000032;Rank=5;Identity=0.2465;Positive=0.4465;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 17 222 +CM143127.1 miniprot CDS 502250 502843 99 - 0 Parent=SS000032;Rank=5;Identity=0.2465;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 17 222 +##PAF 1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 222 16 222 + CM143126.1 1831595 1288167 1288761 159 645 0 AS:i:115 ms:i:99 np:i:96 fs:i:0 st:i:0 da:i:-1 do:i:18 cg:Z:31M6D30M4I7M1I32M4I9M3D28M4I33M1I10M1I1M2I8M cs:Z:*ataL*aatD*aagR*ataL*atgI*gaaD:1*cttI*tccT*aacE*gtaS*tacD*aatL:2*ttgE*tcgD:2*acgY*gttW:2*attH:1*aacH*aacS*aagL:1*gaaA:1-aatgcaatcaaacaaaag*gttI*gttT*aaaH*ataT*ttgV*aaaS*gaaS*tatP:1*aaaG*ataT*tccP*tctM*cagD*aacD*aggM*acaL*tctG*ttaQ*ttgI*tcgQ*gttE*gctR*gatT*ttcK:1*gatL:1*ttgY:1+LMER:1*ctaI*attR*ggcA*gaaA:1*tatL+E*aacQ:2*aatL:1*attY*tttI*tacS:1*caaK*aatP*agaH*attD*actK*aggF*acgC*ttaK:1*aacS*gttM*cctE*gttS*gttF*aaaT*aacT*gacE*gagR*cctT*gcaI:1*gaaY*gtcT+RDCP*tcaP*ttcY*aacA*ataA:2*cagT:2-ataaaacgt*agtP*gacG:2*gccT*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actD*tttC:2*agcN*aatD:1*tacV +CM143126.1 miniprot mRNA 1288168 1288761 99 + . ID=SS000033;Rank=6;Identity=0.2465;Positive=0.4465;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 17 222 +CM143126.1 miniprot CDS 1288168 1288761 99 + 0 Parent=SS000033;Rank=6;Identity=0.2465;Target=1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT 17 222 +##PAF 460519_cbs-7435_MATkp_MATa|gene_index=3|name=sla2|role=flanking_conserved 1045 215 1045 + CM143127.1 3497966 497892 500442 1266 2574 0 AS:i:1950 ms:i:1950 np:i:585 fs:i:0 st:i:0 da:i:-1 do:i:24 cg:Z:71M2D10M3I6M1I5M3I29M1D31M1I193M2D231M21D40M1D153M1D53M cs:Z::4*gaaQ:2*agaI*caaE:1*tatF*gatI:2*catY*caaS*agaD:1*tttY*gagD:3*gatE:1*accS*agcY*cttV*cacK:5*atcV:5*acaP*accF*actE*cctA:3*ctcF*attN*gatW*gagD*aacE:1*ggtD*attE*cgtL*agaK:1*cctR*accI*aagL:1*ccgE*gcgE*gcgP*aagS*agtL*ccaQ*acgV*gcaS:1-ccgcca*ccaK*ccgA:1*ccaS*aagE:1*ataF*gcaG*aacT:1+TEV*ttaI*atcH*aatS:3+A:1*gttT*gaaD*ttcL:1+AQS*aaaN:1*caaL*caaK*gacQ*aatQ*gtgY:1*gctQ:2*gaaQ*agaL:1*gccE*agaQ:2*aatQ*gcgQ:3*gcgE:2*gaaH*gaaQ:1-gct*aatQ:2*gctL*gcaE*tttY*gagW*cagE*caaK:1*cgcK:3*caaE:3*atgL*gcaY*cagA:2*atgQ:1*caaE*caaS*tatD*catQ*acaL:1+R*gcgQ*gctV:4*gctG:7*gctI:1*aagR*aacG:1*tacF:1*caaR:3*ttgM:1*caaR:3*caaE:3*gttA:2*cagT:1*gcgL*atgS*aatS*gccT*aatT:1*gctN:1*actQ:2*attL*gcaG*ttgA:1*gatE:1*agtL:1*aatG*agtN*gtcI:3*ttgA*aacA*ttgQ*ttcW:4*gagD:1*ataL:8*caaE:6*caaS:3*aagT*ttgA:1*caaL:2*gcaS:2*cagR:6*gacE*aggK:2*aaaR:6*gttI:6*aaaR:7*gagD*attL*gacE*aagR*ttaS*agaK*gggS*tctD:1*gacN:1*ttgE*attT:1*aaaR:3*gaaR*gttL*aatR*actE*ttgQ*aagE*gatT:2*gatA*gtgD*acaI:1*agaK*aacL*cagH:2*aatE:1*aacK:1*attF*ttcL*aacS*gcaQ:1*cgaN:2*atgI:3*gaaQ*accN*aaaQ:1-aaagaa*agaQ*gaaA:1*caaS*atcL:2*atgS*tcaA*ccaN:1*tcaR*aatL*gctK*gagA:1*cagE*gaaA*acaQ:1*cgtQ:3*gagD:1*atcL*gaaA:1*ttaA*caaH:3*gatE*gatA*gcgT*ttaI:1*cagE:1*gccT*gagG*tctQ*aaaQ*aggS*gaaI*agcQ*gaaN*gaaS:7*acaA*gtgI:1*caaL:3*atgD:2*gttT*gctE*attV:2*tctA:2*caaT:3*aaaQ:2*gaaQ:1*agtG:6*tcgP:2*ggcA:7*tcaE:2*ctaS*accS:4*gcaS*ggcS*gaaN*acaL*agtA*caaT:2*gctT*acgS*gctS:2*aacG:6*agcN:2*tatH*gctV*gagS*atcV:1*tctQ:2*tcaT:3*ctgT*tgtS:1*acaV:1*gttL*gagL:2*gttC:2*atcV*attV*aagR*tttL*tgcA*aagS*acaS*gagD*aatQ*ttgE*gaaA*aacE*tcgA:2*tcaN:3*ttgD:1*ggtA:1*acaE*tgcS*attE*gaaS:1*ttgI*gaaV*gatS:1*ttgY:1*aagS*aatS:1*caaK*agcG:2*gaaD*gaaQ*caaE:1*tcaT:2*gttA:3*gtcN:1*gaaD:1*catQ*gaaQ*agaE:1*gaaQ*gaaT:1*actS*acaS:1*attV:1*actK*attL*gcaI:1*acgS-agcggtggcggcggcggcggcggcggtggcggtagcagcagcaacagcaacaacaagttcatt*gagQ*atcV*gaaN*aaaI*caaN*acaV*gaaN*gagD*gagN*ttaV*gaaG*agcE:3*aacR:2*aacA*gctH:3*gttT:1*aagA*caaK:1*accS*ttaD:3*tcgD:3*agcN*aaaA*aacK-tta:2*ttgI:1*cctT:2*ttaM*gaaK*gtcI:1*aagN*gctS:2*gcaS:1*tccA:2*atcV:4*tcgI*atgL:2*tctK*gcaT:1*atcT:1*actC:1*catN:3*gcaN*aatH:1*aaaR:5*gccT*caaS:4*aatH:1*agaK:8*gctS:1*gctS:2*tctY*gctS:2*ttaS:3*actI:3*aatV:2*ggtS*aagT*aatS*acaS*cacP:1*gaaQ:4*tctC:1*gaaD:2*tctA:2*attA:5*gcaS:4*acgS*cagF*ttcM:5*aatK:2*gatL:3*aagS:1*tctT*attS:2*aagR:3*agcR:4*ttgI*attL*aatS*aaaQ*tctK*acaD*caaK-tta*gttE*aatE*gatL*gatE:2*ttcY:4*atcA*attH*gatE:1*agaK*aaaT*gaaV*gaaQ:1*aaaE:2*gcaV:2*atcL:3*aatT:2*ggtQ*gctN:2*aagR:3*gatE:2*aaaR*tatF*agtG:1*caaH*gatA:1*gatE*gatE +CM143127.1 miniprot mRNA 497893 500442 1950 + . ID=SS000034;Rank=1;Identity=0.4918;Positive=0.6818;Target=460519_cbs-7435_MATkp_MATa|gene_index=3|name=sla2|role=flanking_conserved 216 1045 +CM143127.1 miniprot CDS 497893 500442 1950 + 0 Parent=SS000034;Rank=1;Identity=0.4918;Target=460519_cbs-7435_MATkp_MATa|gene_index=3|name=sla2|role=flanking_conserved 216 1045 +##PAF 460519_cbs-7435_MATkp_MATa|gene_index=3|name=sla2|role=flanking_conserved 1045 215 1045 - CM143128.1 3172219 2744263 2746813 1263 2574 0 AS:i:1949 ms:i:1949 np:i:586 fs:i:0 st:i:0 da:i:-1 do:i:24 cg:Z:71M2D10M3I6M1I5M3I29M1D31M1I193M2D231M21D40M1D153M1D53M cs:Z::4*gaaQ:2*agaI*caaE:1*tatF*gatI:2*catY*caaS*agaD:1*tttY*gagD:3*gatE:1*accS*agcY*cttV*cacK:5*atcV:5*acgP*accF*agtE*cctA:3*ctcF*attN*gatW*gagD*aacE:1*ggtD*attE*cgtL*agaK:1*cctR*accI*aagL:1*ccgE*gcgE*gcgP*aagS*agtL*ccaQ*acgV*gcaS:1-ccgcca*ccaK*ccgA:1*ccaS*aagE:1*ataF*gcaG*agcT:1+TEV*ttaI*atcH*aatS:3+A:1*gttT*gaaD*ttcL:1+AQS*aaaN:1*caaL*caaK*gacQ*aatQ*gtgY:1*gctQ:2*gaaQ*agaL:1*gccE*agaQ:2*aatQ*gcgQ:3*gcgE:2*gaaH*gaaQ:1-gct*aatQ:2*gctL*gcaE*tttY*gagW*cagE*caaK:1*cgcK:3*caaE:3*atgL*gcaY*cagA:2*atgQ:1*caaE*caaS*tatD*catQ*acaL:1+R*gcgQ*gctV:4*gctG:7*gctI:1*aagR*aacG:1*tacF:1*caaR:3*ttgM:1*caaR:3*caaE:3*gttA:2*cagT:1*gcgL*atgS*aatS*gccT*aatT:1*gctN:1*actQ:2*attL*gcaG*ttgA:1*gatE:1*agtL:1*aatG*agtN*gtcI:3*ttgA*aacA*ttgQ*ttcW:4*gagD:1*ataL:8*caaE:6*caaS:3*aagT*ttgA:1*caaL:2*gcaS:2*cagR:6*gacE*aggK:2*aaaR:6*gttI:6*aaaR:7*gagD*attL*gacE*aagR*ttaS*agaK*gggS*tctD:1*gacN:1*ttgE*attT:1*aaaR:3*gaaR*gttL*aatR*actE*ttgQ*aagE*gatT:2*gatA*gtgD*acaI:1*agaK*aacL*cagH:2*aatE:1*aacK:1*attF*ttcL*aacS*gcaQ:1*cgaN:2*atgI:3*gaaQ*accN*aaaQ:1-aaagaa*agaQ*gaaA:1*caaS*atcL:2*atgS*tcaA*ccaN:1*tcaR*aatL*gctK*gagA:1*cagE*gaaA*acaQ:1*cgtQ:3*gagD:1*atcL*gaaA:1*ttaA*caaH:3*gatE*gatA*gcgT*ttaI:1*cagE:1*gccT*gagG*tctQ*aaaQ*aggS*gaaI*agcQ*gaaN*gaaS:7*acaA*gtgI:1*caaL:3*atgD:2*gttT*gctE*attV:2*tctA:2*caaT:3*aaaQ:2*gaaQ:1*agtG:6*tcgP:2*ggcA:7*tcaE:2*ctaS*accS:4*gcaS*ggcS*gaaN*acaL*agtA*caaT:2*gctT*acgS*gctS:2*aacG:6*agcN:2*tatH*gctV*gagS*atcV:1*tctQ:2*tcaT:3*ctgT*tgtS:1*acaV:1*gttL*gagL:2*gttC:2*atcV*attV*aagR*tttL*tgcA*aagS*acaS*gagD*aatQ*ttgE*gaaA*aacE*tcgA:2*tcaN:3*ttgD:1*ggtA:1*acaE*tgcS*attE*gaaS:1*ttgI*gaaV*gatS:1*ttgY:1*aagS*aatS:1*gaaK*agcG:2*gaaD*gaaQ*caaE:1*tcaT:2*gttA:3*gtcN:1*gaaD:1*catQ*gaaQ*agaE:1*gaaQ*gaaT:1*actS*acaS:1*attV:1*actK*attL*gcaI:1*acgS-agcggtggcggcggcggcggcggcggtggcagtagcagcagcaacagcaacaacaagttcatt*gagQ*atcV*gaaN*aaaI*caaN*acaV*gaaN*gagD*gagN*ttaV*gaaG*agcE:3*aacR:2*aacA*gctH:3*gttT:1*aagA*caaK:1*acaS*ttaD:3*tcgD:3*agcN*aaaA*aacK-tta:2*ttgI:1*cctT:2*ttaM*gaaK*gtcI:1*aagN*gctS:2*gcaS:1*tccA:2*atcV:4*tcgI*atgL:2*tctK*gcaT:1*atcT:1*actC:1*catN:3*gcaN*aatH:1*aaaR:3*acaS:1*gccT*caaS:4*aatH:1*agaK:8*gctS:1*gctS:2*tctY*gctS:2*ttaS:3*actI:3*aatV:2*ggtS*aagT*aatS*acaS*cacP:1*gaaQ:4*tctC:1*gaaD:2*tctA:2*attA:5*gcaS:4*acgS*cagF*ttcM:5*aatK:2*gatL:3*aagS:1*tctT*attS:2*aagR:3*agcR:4*ttgI*attL*aatS*aaaQ*tctK*acaD*caaK-tta*gttE*aatE*gatL*gatE:2*ttcY:4*atcA*attH*gatE:1*agaK*aaaT*gaaV*gaaQ:1*aaaE:2*gcaV:2*atcL:3*aatT:2*ggtQ*gctN:2*aagR:3*gatE:2*aaaR*tatF*agtG:1*caaH*gatA:1*gatE*gatE +CM143128.1 miniprot mRNA 2744264 2746813 1949 - . ID=SS000035;Rank=2;Identity=0.4907;Positive=0.6830;Target=460519_cbs-7435_MATkp_MATa|gene_index=3|name=sla2|role=flanking_conserved 216 1045 +CM143128.1 miniprot CDS 2744264 2746813 1949 - 0 Parent=SS000035;Rank=2;Identity=0.4907;Target=460519_cbs-7435_MATkp_MATa|gene_index=3|name=sla2|role=flanking_conserved 216 1045 +##PAF 460519_cbs-7435_MATkp_MATalpha|gene_index=0|name=sla2|role=flanking_conserved 1044 215 1044 + CM143127.1 3497966 497892 500439 1266 2571 0 AS:i:1948 ms:i:1948 np:i:584 fs:i:0 st:i:0 da:i:-1 do:i:27 cg:Z:71M2D10M3I6M1I5M3I29M1D31M1I193M2D231M21D40M1D153M1D52M cs:Z::4*gaaQ:2*agaI*caaE:1*tatF*gatI:2*catY*caaS*agaD:1*tttY*gagD:3*gatE:1*accS*agcY*cttV*cacK:5*atcV:5*acaP*accF*actE*cctA:3*ctcF*attN*gatW*gagD*aacE:1*ggtD*attE*cgtL*agaK:1*cctR*accI*aagL:1*ccgE*gcgE*gcgP*aagS*agtL*ccaQ*acgV*gcaS:1-ccgcca*ccaK*ccgA:1*ccaS*aagE:1*ataF*gcaG*aacT:1+TEV*ttaI*atcH*aatS:3+A:1*gttT*gaaD*ttcL:1+AQS*aaaN:1*caaL*caaK*gacQ*aatQ*gtgY:1*gctQ:2*gaaQ*agaL:1*gccE*agaQ:2*aatQ*gcgQ:3*gcgE:2*gaaH*gaaQ:1-gct*aatQ:2*gctL*gcaE*tttY*gagW*cagE*caaK:1*cgcK:3*caaE:3*atgL*gcaY*cagA:2*atgQ:1*caaE*caaS*tatD*catQ*acaL:1+R*gcgQ*gctV:4*gctG:7*gctI:1*aagR*aacG:1*tacF:1*caaR:3*ttgM:1*caaR:3*caaE:3*gttA:2*cagT:1*gcgL*atgS*aatS*gccT*aatT:1*gctN:1*actQ:2*attL*gcaG*ttgA:1*gatE:1*agtL:1*aatG*agtN*gtcI:3*ttgA*aacA*ttgQ*ttcW:4*gagD:1*ataL:8*caaE:6*caaS:3*aagT*ttgA:1*caaL:2*gcaS:2*cagR:6*gacE*aggK:2*aaaR:6*gttI:6*aaaR:7*gagD*attL*gacE*aagR*ttaS*agaK*gggS*tctD:1*gacN:1*ttgE*attT:1*aaaR:3*gaaR*gttL*aatR*actE*ttgQ*aagE*gatT:2*gatA*gtgD*acaI:1*agaK*aacL*cagH:2*aatE:1*aacK:1*attF*ttcL*aacS*gcaQ:1*cgaN:2*atgI:3*gaaQ*accN*aaaQ:1-aaagaa*agaQ*gaaA:1*caaS*atcL:2*atgS*tcaA*ccaN:1*tcaR*aatL*gctK*gagA:1*cagE*gaaA*acaQ:1*cgtQ:3*gagD:1*atcL*gaaA:1*ttaA*caaH:3*gatE*gatA*gcgT*ttaI:1*cagE:1*gccT*gagG*tctQ*aaaQ*aggS*gaaI*agcQ*gaaN*gaaS:7*acaA*gtgI:1*caaL:3*atgD:2*gttT*gctE*attV:2*tctA:2*caaT:3*aaaQ:2*gaaQ:1*agtG:6*tcgP:2*ggcA:7*tcaE:2*ctaS*accS:4*gcaS*ggcS*gaaN*acaL*agtA*caaT:2*gctT*acgS*gctS:2*aacG:6*agcN:2*tatH*gctV*gagS*atcV:1*tctQ:2*tcaT:3*ctgT*tgtS:1*acaV:1*gttL*gagL:2*gttC:2*atcV*attV*aagR*tttL*tgcA*aagS*acaS*gagD*aatQ*ttgE*gaaA*aacE*tcgA:2*tcaN:3*ttgD:1*ggtA:1*acaE*tgcS*attE*gaaS:1*ttgI*gaaV*gatS:1*ttgY:1*aagS*aatS:1*caaK*agcG:2*gaaD*gaaQ*caaE:1*tcaT:2*gttA:3*gtcN:1*gaaD:1*catQ*gaaQ*agaE:1*gaaQ*gaaT:1*actS*acaS:1*attV:1*actK*attL*gcaI:1*acgS-agcggtggcggcggcggcggcggcggtggcggtagcagcagcaacagcaacaacaagttcatt*gagQ*atcV*gaaN*aaaI*caaN*acaV*gaaN*gagD*gagN*ttaV*gaaG*agcE:3*aacR:2*aacA*gctH:3*gttT:1*aagA*caaK:1*accS*ttaD:3*tcgD:3*agcN*aaaA*aacK-tta:2*ttgI:1*cctT:2*ttaM*gaaK*gtcI:1*aagN*gctS:2*gcaS:1*tccA:2*atcV:4*tcgI*atgL:2*tctK*gcaT:1*atcT:1*actC:1*catN:3*gcaN*aatH:1*aaaR:5*gccT*caaS:4*aatH:1*agaK:8*gctS:1*gctS:2*tctY*gctS:2*ttaS:3*actI:3*aatV:2*ggtS*aagT*aatS*acaS*cacP:1*gaaQ:4*tctC:1*gaaD:2*tctA:2*attA:5*gcaS:4*acgS*cagF*ttcM:5*aatK:2*gatL:3*aagS:1*tctT*attS:2*aagR:3*agcR:4*ttgI*attL*aatS*aaaQ*tctK*acaD*caaK-tta*gttE*aatE*gatL*gatE:2*ttcY:4*atcA*attH*gatE:1*agaK*aaaT*gaaV*gaaQ:1*aaaE:2*gcaV:2*atcL:3*aatT:2*ggtQ*gctN:2*aagR:3*gatE:2*aaaR*tatF*agtG:1*caaH*gatA:1*gatE +CM143127.1 miniprot mRNA 497893 500439 1948 + . ID=SS000036;Rank=1;Identity=0.4924;Positive=0.6814;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=0|name=sla2|role=flanking_conserved 216 1044 +CM143127.1 miniprot CDS 497893 500439 1948 + 0 Parent=SS000036;Rank=1;Identity=0.4924;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=0|name=sla2|role=flanking_conserved 216 1044 +##PAF 460519_cbs-7435_MATkp_MATalpha|gene_index=0|name=sla2|role=flanking_conserved 1044 215 1044 - CM143128.1 3172219 2744266 2746813 1263 2571 0 AS:i:1947 ms:i:1947 np:i:585 fs:i:0 st:i:0 da:i:-1 do:i:27 cg:Z:71M2D10M3I6M1I5M3I29M1D31M1I193M2D231M21D40M1D153M1D52M cs:Z::4*gaaQ:2*agaI*caaE:1*tatF*gatI:2*catY*caaS*agaD:1*tttY*gagD:3*gatE:1*accS*agcY*cttV*cacK:5*atcV:5*acgP*accF*agtE*cctA:3*ctcF*attN*gatW*gagD*aacE:1*ggtD*attE*cgtL*agaK:1*cctR*accI*aagL:1*ccgE*gcgE*gcgP*aagS*agtL*ccaQ*acgV*gcaS:1-ccgcca*ccaK*ccgA:1*ccaS*aagE:1*ataF*gcaG*agcT:1+TEV*ttaI*atcH*aatS:3+A:1*gttT*gaaD*ttcL:1+AQS*aaaN:1*caaL*caaK*gacQ*aatQ*gtgY:1*gctQ:2*gaaQ*agaL:1*gccE*agaQ:2*aatQ*gcgQ:3*gcgE:2*gaaH*gaaQ:1-gct*aatQ:2*gctL*gcaE*tttY*gagW*cagE*caaK:1*cgcK:3*caaE:3*atgL*gcaY*cagA:2*atgQ:1*caaE*caaS*tatD*catQ*acaL:1+R*gcgQ*gctV:4*gctG:7*gctI:1*aagR*aacG:1*tacF:1*caaR:3*ttgM:1*caaR:3*caaE:3*gttA:2*cagT:1*gcgL*atgS*aatS*gccT*aatT:1*gctN:1*actQ:2*attL*gcaG*ttgA:1*gatE:1*agtL:1*aatG*agtN*gtcI:3*ttgA*aacA*ttgQ*ttcW:4*gagD:1*ataL:8*caaE:6*caaS:3*aagT*ttgA:1*caaL:2*gcaS:2*cagR:6*gacE*aggK:2*aaaR:6*gttI:6*aaaR:7*gagD*attL*gacE*aagR*ttaS*agaK*gggS*tctD:1*gacN:1*ttgE*attT:1*aaaR:3*gaaR*gttL*aatR*actE*ttgQ*aagE*gatT:2*gatA*gtgD*acaI:1*agaK*aacL*cagH:2*aatE:1*aacK:1*attF*ttcL*aacS*gcaQ:1*cgaN:2*atgI:3*gaaQ*accN*aaaQ:1-aaagaa*agaQ*gaaA:1*caaS*atcL:2*atgS*tcaA*ccaN:1*tcaR*aatL*gctK*gagA:1*cagE*gaaA*acaQ:1*cgtQ:3*gagD:1*atcL*gaaA:1*ttaA*caaH:3*gatE*gatA*gcgT*ttaI:1*cagE:1*gccT*gagG*tctQ*aaaQ*aggS*gaaI*agcQ*gaaN*gaaS:7*acaA*gtgI:1*caaL:3*atgD:2*gttT*gctE*attV:2*tctA:2*caaT:3*aaaQ:2*gaaQ:1*agtG:6*tcgP:2*ggcA:7*tcaE:2*ctaS*accS:4*gcaS*ggcS*gaaN*acaL*agtA*caaT:2*gctT*acgS*gctS:2*aacG:6*agcN:2*tatH*gctV*gagS*atcV:1*tctQ:2*tcaT:3*ctgT*tgtS:1*acaV:1*gttL*gagL:2*gttC:2*atcV*attV*aagR*tttL*tgcA*aagS*acaS*gagD*aatQ*ttgE*gaaA*aacE*tcgA:2*tcaN:3*ttgD:1*ggtA:1*acaE*tgcS*attE*gaaS:1*ttgI*gaaV*gatS:1*ttgY:1*aagS*aatS:1*gaaK*agcG:2*gaaD*gaaQ*caaE:1*tcaT:2*gttA:3*gtcN:1*gaaD:1*catQ*gaaQ*agaE:1*gaaQ*gaaT:1*actS*acaS:1*attV:1*actK*attL*gcaI:1*acgS-agcggtggcggcggcggcggcggcggtggcagtagcagcagcaacagcaacaacaagttcatt*gagQ*atcV*gaaN*aaaI*caaN*acaV*gaaN*gagD*gagN*ttaV*gaaG*agcE:3*aacR:2*aacA*gctH:3*gttT:1*aagA*caaK:1*acaS*ttaD:3*tcgD:3*agcN*aaaA*aacK-tta:2*ttgI:1*cctT:2*ttaM*gaaK*gtcI:1*aagN*gctS:2*gcaS:1*tccA:2*atcV:4*tcgI*atgL:2*tctK*gcaT:1*atcT:1*actC:1*catN:3*gcaN*aatH:1*aaaR:3*acaS:1*gccT*caaS:4*aatH:1*agaK:8*gctS:1*gctS:2*tctY*gctS:2*ttaS:3*actI:3*aatV:2*ggtS*aagT*aatS*acaS*cacP:1*gaaQ:4*tctC:1*gaaD:2*tctA:2*attA:5*gcaS:4*acgS*cagF*ttcM:5*aatK:2*gatL:3*aagS:1*tctT*attS:2*aagR:3*agcR:4*ttgI*attL*aatS*aaaQ*tctK*acaD*caaK-tta*gttE*aatE*gatL*gatE:2*ttcY:4*atcA*attH*gatE:1*agaK*aaaT*gaaV*gaaQ:1*aaaE:2*gcaV:2*atcL:3*aatT:2*ggtQ*gctN:2*aagR:3*gatE:2*aaaR*tatF*agtG:1*caaH*gatA:1*gatE +CM143128.1 miniprot mRNA 2744267 2746813 1947 - . ID=SS000037;Rank=2;Identity=0.4912;Positive=0.6826;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=0|name=sla2|role=flanking_conserved 216 1044 +CM143128.1 miniprot CDS 2744267 2746813 1947 - 0 Parent=SS000037;Rank=2;Identity=0.4912;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=0|name=sla2|role=flanking_conserved 216 1044 +##PAF 460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 173 44 173 + CM143131.1 1178080 298495 298888 114 420 0 AS:i:94 ms:i:83 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:27 cg:Z:25M2I1M2I10M7D9M3D22M4I39M1I11M1D3M cs:Z:*atcL:1*atcE:1*ctaG:1*ggcD*gaaQ*agaN*tatD*aatQ*cttT:1*aatR*gacE:1*tttL*tacV*tgtQ*caaI:2*attM*actC:1+AI*acgA+LM:1*tcaE:1*gttK*cctR*gttM*gttL:3-gagcctgcagaggaagtctca*ttcV*aacE:1*gtgI*acaL:1*tcaQ*caaI*ataL-aaacgtagt:1*tacS*aagN*gccS*ttaT*cggE*aaaR*tgcK:1*catR*ttcL*aatP*actR:1*accK*agaV:1*aagI:2*caaN:1+FADH*tacF*aagQ*ctaH*agtP*gacY*tttA*tcaT*aagQ*gaaQ*gcaD*attF*gaaD*aagE*tttL*ctgV*aatH*gaaL*gtcT*aatS:1*gacS*gttK*gttT:2*aagR:2*gttI:3*aaaR:3*aaaR*aaaS*gctS+T*ataV:1*aagT*ggtE*attL*atcL*gatQ*gttA:1*aagN*actK-ttt:3 +CM143131.1 miniprot mRNA 298496 298888 83 + . ID=SS000038;Rank=1;Identity=0.2714;Positive=0.4714;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 45 173 +CM143131.1 miniprot CDS 298496 298888 83 + 0 Parent=SS000038;Rank=1;Identity=0.2714;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 45 173 +##PAF 460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 173 44 173 + CM143129.1 2335549 470528 470921 114 420 0 AS:i:94 ms:i:83 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:27 cg:Z:25M2I1M2I10M7D9M3D22M4I39M1I11M1D3M cs:Z:*atcL:1*atcE:1*ctaG:1*ggcD*gaaQ*agaN*tatD*aatQ*cttT:1*aatR*gacE:1*tttL*tacV*tgtQ*caaI:2*attM*actC:1+AI*acgA+LM:1*tcaE:1*gttK*cctR*gttM*gttL:3-gagcctgcagaggaagtctca*ttcV*aacE:1*gtgI*acaL:1*tcaQ*caaI*ataL-aaacgtagt:1*tacS*aagN*gccS*ttaT*cggE*aaaR*tgcK:1*catR*ttcL*aatP*actR:1*accK*agaV:1*aagI:2*caaN:1+FADH*tacF*aagQ*ctaH*agtP*gacY*tttA*tcaT*aagQ*gaaQ*gcaD*attF*gaaD*aagE*tttL*ctgV*aatH*gaaL*gtcT*aatS:1*gacS*gttK*gttT:2*aagR:2*gttI:3*aaaR:3*aaaR*aaaS*gctS+T*ataV:1*aagT*ggtE*attL*atcL*gatQ*gttA:1*aagN*actK-ttt:3 +CM143129.1 miniprot mRNA 470529 470921 83 + . ID=SS000039;Rank=2;Identity=0.2714;Positive=0.4714;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 45 173 +CM143129.1 miniprot CDS 470529 470921 83 + 0 Parent=SS000039;Rank=2;Identity=0.2714;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 45 173 +##PAF 460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 173 44 173 + CM143128.1 3172219 2742054 2742447 114 420 0 AS:i:94 ms:i:83 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:27 cg:Z:25M2I1M2I10M7D9M3D22M4I39M1I11M1D3M cs:Z:*atcL:1*atcE:1*ctaG:1*ggcD*gaaQ*agaN*tatD*aacQ*cttT:1*aatR*gacE:1*tttL*tacV*tgtQ*caaI:2*attM*actC:1+AI*acgA+LM:1*tcaE:1*gttK*cctR*gttM*gttL:3-gagcctgcagaggaagtctca*ttcV*aacE:1*gtgI*acaL:1*tcaQ*caaI*ataL-aaacgtagt:1*tacS*aagN*gccS*ttaT*cggE*aaaR*tgcK:1*catR*ttcL*aatP*actR:1*accK*agaV:1*aagI:2*caaN:1+FADH*tacF*aagQ*ctaH*agtP*gacY*tttA*tcaT*aagQ*gaaQ*gcaD*attF*gaaD*aagE*tttL*ctgV*aatH*gaaL*gtcT*aatS:1*gacS*gttK*gttT:2*aagR:2*gttI:3*aaaR:3*aaaR*aaaS*gctS+T*ataV:1*aagT*ggtE*attL*atcL*gatQ*gttA:1*aagN*actK-ttt:3 +CM143128.1 miniprot mRNA 2742055 2742447 83 + . ID=SS000040;Rank=3;Identity=0.2714;Positive=0.4714;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 45 173 +CM143128.1 miniprot CDS 2742055 2742447 83 + 0 Parent=SS000040;Rank=3;Identity=0.2714;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 45 173 +##PAF 460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 173 44 173 - CM143127.1 3497966 502258 502651 114 420 0 AS:i:94 ms:i:83 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:27 cg:Z:25M2I1M2I10M7D9M3D22M4I39M1I11M1D3M cs:Z:*atcL:1*atcE:1*ctaG:1*ggcD*gaaQ*agaN*tatD*aacQ*cttT:1*aatR*gacE:1*tttL*tacV*tgtQ*caaI:2*attM*actC:1+AI*acgA+LM:1*tcaE:1*gttK*cctR*gttM*gttL:3-gagcctgcagaggaagtctca*ttcV*aacE:1*gtgI*acaL:1*tcaQ*caaI*ataL-aaacgtagt:1*tacS*aagN*gccS*ttaT*cggE*aaaR*tgcK:1*catR*ttcL*aatP*actR:1*accK*agaV:1*aagI:2*caaN:1+FADH*tacF*aagQ*ctaH*agtP*gacY*tttA*tcaT*aagQ*gaaQ*gcaD*attF*gaaD*aagE*tttL*ctgV*aatH*gaaL*gtcT*aatS:1*gacS*gttK*gttT:2*aagR:2*gttI:3*aaaR:3*aaaR*aaaS*gctS+T*ataV:1*aagT*ggtE*attL*atcL*gatQ*gttA:1*aagN*actK-ttt:3 +CM143127.1 miniprot mRNA 502259 502651 83 - . ID=SS000041;Rank=4;Identity=0.2714;Positive=0.4714;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 45 173 +CM143127.1 miniprot CDS 502259 502651 83 - 0 Parent=SS000041;Rank=4;Identity=0.2714;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 45 173 +##PAF 460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 173 44 173 + CM143126.1 1831595 1288359 1288752 114 420 0 AS:i:94 ms:i:83 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:27 cg:Z:25M2I1M2I10M7D9M3D22M4I39M1I11M1D3M cs:Z:*atcL:1*atcE:1*ctaG:1*ggcD*gaaQ*agaN*tatD*aacQ*cttT:1*aatR*gacE:1*tttL*tacV*tgtQ*caaI:2*attM*actC:1+AI*acgA+LM:1*tcaE:1*gttK*cctR*gttM*gttL:3-gagcctgcagaggaagtctca*ttcV*aacE:1*gtgI*acaL:1*tcaQ*caaI*ataL-aaacgtagt:1*tacS*aagN*gccS*ttaT*cggE*aaaR*tgcK:1*catR*ttcL*aatP*actR:1*accK*agaV:1*aagI:2*caaN:1+FADH*tacF*aagQ*ctaH*agtP*gacY*tttA*tcaT*aagQ*gaaQ*gcaD*attF*gaaD*aagE*tttL*ctgV*aatH*gaaL*gtcT*aatS:1*gacS*gttK*gttT:2*aagR:2*gttI:3*aaaR:3*aaaR*aaaS*gctS+T*ataV:1*aagT*ggtE*attL*atcL*gatQ*gttA:1*aagN*actK-ttt:3 +CM143126.1 miniprot mRNA 1288360 1288752 83 + . ID=SS000042;Rank=5;Identity=0.2714;Positive=0.4714;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 45 173 +CM143126.1 miniprot CDS 1288360 1288752 83 + 0 Parent=SS000042;Rank=5;Identity=0.2714;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 45 173 +##PAF 460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 173 44 173 - CM143130.1 2250200 2219117 2219510 114 420 0 AS:i:94 ms:i:83 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:27 cg:Z:25M2I1M2I10M7D9M3D22M4I39M1I11M1D3M cs:Z:*atcL:1*atcE:1*ctaG:1*ggcD*gaaQ*agaN*tatD*aacQ*cttT:1*aatR*gacE:1*tttL*tacV*tgtQ*caaI:2*attM*accC:1+AI*acgA+LM:1*tcaE:1*gttK*cctR*gttM*gttL:3-gagcctgcagaggaagtctca*ttcV*aacE:1*gtgI*acaL:1*tcaQ*caaI*attL-aaacgtagt:1*tacS*aagN*gccS*ttaT*cggE*aaaR*tgcK:1*catR*ttcL*aatP*actR:1*accK*agaV:1*aagI:2*caaN:1+FADH*tacF*aagQ*ctaH*agtP*gacY*tttA*tcaT*aagQ*gaaQ*gcaD*attF*gaaD*aagE*tttL*ctgV*aatH*gaaL*gtcT*aatS:1*gacS*gttK*gttT:2*aagR:2*gttI:3*aaaR:3*aaaR*aaaS*gctS+T*ataV:1*aagT*ggtE*attL*atcL*gatQ*gttA:1*aagN*actK-ttt:3 +CM143130.1 miniprot mRNA 2219118 2219510 83 - . ID=SS000043;Rank=6;Identity=0.2714;Positive=0.4714;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 45 173 +CM143130.1 miniprot CDS 2219118 2219510 83 - 0 Parent=SS000043;Rank=6;Identity=0.2714;Target=460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT 45 173 +##PAF 460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 173 44 173 + CM143131.1 1178080 298495 298888 114 420 0 AS:i:94 ms:i:83 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:27 cg:Z:25M2I1M2I10M7D9M3D22M4I39M1I11M1D3M cs:Z:*atcL:1*atcE:1*ctaG:1*ggcD*gaaQ*agaN*tatD*aatQ*cttT:1*aatR*gacE:1*tttL*tacV*tgtQ*caaI:2*attM*actC:1+AI*acgA+LM:1*tcaE:1*gttK*cctR*gttM*gttL:3-gagcctgcagaggaagtctca*ttcV*aacE:1*gtgI*acaL:1*tcaQ*caaI*ataL-aaacgtagt:1*tacS*aagN*gccS*ttaT*cggE*aaaR*tgcK:1*catR*ttcL*aatP*actR:1*accK*agaV:1*aagI:2*caaN:1+FADH*tacF*aagQ*ctaH*agtP*gacY*tttA*tcaT*aagQ*gaaQ*gcaD*attF*gaaD*aagE*tttL*ctgV*aatH*gaaL*gtcT*aatS:1*gacS*gttK*gttT:2*aagR:2*gttI:3*aaaR:3*aaaR*aaaS*gctS+T*ataV:1*aagT*ggtE*attL*atcL*gatQ*gttA:1*aagN*actK-ttt:3 +CM143131.1 miniprot mRNA 298496 298888 83 + . ID=SS000044;Rank=1;Identity=0.2714;Positive=0.4714;Target=460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 45 173 +CM143131.1 miniprot CDS 298496 298888 83 + 0 Parent=SS000044;Rank=1;Identity=0.2714;Target=460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 45 173 +##PAF 460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 173 44 173 + CM143129.1 2335549 470528 470921 114 420 0 AS:i:94 ms:i:83 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:27 cg:Z:25M2I1M2I10M7D9M3D22M4I39M1I11M1D3M cs:Z:*atcL:1*atcE:1*ctaG:1*ggcD*gaaQ*agaN*tatD*aatQ*cttT:1*aatR*gacE:1*tttL*tacV*tgtQ*caaI:2*attM*actC:1+AI*acgA+LM:1*tcaE:1*gttK*cctR*gttM*gttL:3-gagcctgcagaggaagtctca*ttcV*aacE:1*gtgI*acaL:1*tcaQ*caaI*ataL-aaacgtagt:1*tacS*aagN*gccS*ttaT*cggE*aaaR*tgcK:1*catR*ttcL*aatP*actR:1*accK*agaV:1*aagI:2*caaN:1+FADH*tacF*aagQ*ctaH*agtP*gacY*tttA*tcaT*aagQ*gaaQ*gcaD*attF*gaaD*aagE*tttL*ctgV*aatH*gaaL*gtcT*aatS:1*gacS*gttK*gttT:2*aagR:2*gttI:3*aaaR:3*aaaR*aaaS*gctS+T*ataV:1*aagT*ggtE*attL*atcL*gatQ*gttA:1*aagN*actK-ttt:3 +CM143129.1 miniprot mRNA 470529 470921 83 + . ID=SS000045;Rank=2;Identity=0.2714;Positive=0.4714;Target=460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 45 173 +CM143129.1 miniprot CDS 470529 470921 83 + 0 Parent=SS000045;Rank=2;Identity=0.2714;Target=460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 45 173 +##PAF 460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 173 44 173 + CM143128.1 3172219 2742054 2742447 114 420 0 AS:i:94 ms:i:83 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:27 cg:Z:25M2I1M2I10M7D9M3D22M4I39M1I11M1D3M cs:Z:*atcL:1*atcE:1*ctaG:1*ggcD*gaaQ*agaN*tatD*aacQ*cttT:1*aatR*gacE:1*tttL*tacV*tgtQ*caaI:2*attM*actC:1+AI*acgA+LM:1*tcaE:1*gttK*cctR*gttM*gttL:3-gagcctgcagaggaagtctca*ttcV*aacE:1*gtgI*acaL:1*tcaQ*caaI*ataL-aaacgtagt:1*tacS*aagN*gccS*ttaT*cggE*aaaR*tgcK:1*catR*ttcL*aatP*actR:1*accK*agaV:1*aagI:2*caaN:1+FADH*tacF*aagQ*ctaH*agtP*gacY*tttA*tcaT*aagQ*gaaQ*gcaD*attF*gaaD*aagE*tttL*ctgV*aatH*gaaL*gtcT*aatS:1*gacS*gttK*gttT:2*aagR:2*gttI:3*aaaR:3*aaaR*aaaS*gctS+T*ataV:1*aagT*ggtE*attL*atcL*gatQ*gttA:1*aagN*actK-ttt:3 +CM143128.1 miniprot mRNA 2742055 2742447 83 + . ID=SS000046;Rank=3;Identity=0.2714;Positive=0.4714;Target=460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 45 173 +CM143128.1 miniprot CDS 2742055 2742447 83 + 0 Parent=SS000046;Rank=3;Identity=0.2714;Target=460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 45 173 +##PAF 460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 173 44 173 - CM143127.1 3497966 502258 502651 114 420 0 AS:i:94 ms:i:83 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:27 cg:Z:25M2I1M2I10M7D9M3D22M4I39M1I11M1D3M cs:Z:*atcL:1*atcE:1*ctaG:1*ggcD*gaaQ*agaN*tatD*aacQ*cttT:1*aatR*gacE:1*tttL*tacV*tgtQ*caaI:2*attM*actC:1+AI*acgA+LM:1*tcaE:1*gttK*cctR*gttM*gttL:3-gagcctgcagaggaagtctca*ttcV*aacE:1*gtgI*acaL:1*tcaQ*caaI*ataL-aaacgtagt:1*tacS*aagN*gccS*ttaT*cggE*aaaR*tgcK:1*catR*ttcL*aatP*actR:1*accK*agaV:1*aagI:2*caaN:1+FADH*tacF*aagQ*ctaH*agtP*gacY*tttA*tcaT*aagQ*gaaQ*gcaD*attF*gaaD*aagE*tttL*ctgV*aatH*gaaL*gtcT*aatS:1*gacS*gttK*gttT:2*aagR:2*gttI:3*aaaR:3*aaaR*aaaS*gctS+T*ataV:1*aagT*ggtE*attL*atcL*gatQ*gttA:1*aagN*actK-ttt:3 +CM143127.1 miniprot mRNA 502259 502651 83 - . ID=SS000047;Rank=4;Identity=0.2714;Positive=0.4714;Target=460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 45 173 +CM143127.1 miniprot CDS 502259 502651 83 - 0 Parent=SS000047;Rank=4;Identity=0.2714;Target=460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 45 173 +##PAF 460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 173 44 173 + CM143126.1 1831595 1288359 1288752 114 420 0 AS:i:94 ms:i:83 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:27 cg:Z:25M2I1M2I10M7D9M3D22M4I39M1I11M1D3M cs:Z:*atcL:1*atcE:1*ctaG:1*ggcD*gaaQ*agaN*tatD*aacQ*cttT:1*aatR*gacE:1*tttL*tacV*tgtQ*caaI:2*attM*actC:1+AI*acgA+LM:1*tcaE:1*gttK*cctR*gttM*gttL:3-gagcctgcagaggaagtctca*ttcV*aacE:1*gtgI*acaL:1*tcaQ*caaI*ataL-aaacgtagt:1*tacS*aagN*gccS*ttaT*cggE*aaaR*tgcK:1*catR*ttcL*aatP*actR:1*accK*agaV:1*aagI:2*caaN:1+FADH*tacF*aagQ*ctaH*agtP*gacY*tttA*tcaT*aagQ*gaaQ*gcaD*attF*gaaD*aagE*tttL*ctgV*aatH*gaaL*gtcT*aatS:1*gacS*gttK*gttT:2*aagR:2*gttI:3*aaaR:3*aaaR*aaaS*gctS+T*ataV:1*aagT*ggtE*attL*atcL*gatQ*gttA:1*aagN*actK-ttt:3 +CM143126.1 miniprot mRNA 1288360 1288752 83 + . ID=SS000048;Rank=5;Identity=0.2714;Positive=0.4714;Target=460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 45 173 +CM143126.1 miniprot CDS 1288360 1288752 83 + 0 Parent=SS000048;Rank=5;Identity=0.2714;Target=460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 45 173 +##PAF 460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 173 44 173 - CM143130.1 2250200 2219117 2219510 114 420 0 AS:i:94 ms:i:83 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:27 cg:Z:25M2I1M2I10M7D9M3D22M4I39M1I11M1D3M cs:Z:*atcL:1*atcE:1*ctaG:1*ggcD*gaaQ*agaN*tatD*aacQ*cttT:1*aatR*gacE:1*tttL*tacV*tgtQ*caaI:2*attM*accC:1+AI*acgA+LM:1*tcaE:1*gttK*cctR*gttM*gttL:3-gagcctgcagaggaagtctca*ttcV*aacE:1*gtgI*acaL:1*tcaQ*caaI*attL-aaacgtagt:1*tacS*aagN*gccS*ttaT*cggE*aaaR*tgcK:1*catR*ttcL*aatP*actR:1*accK*agaV:1*aagI:2*caaN:1+FADH*tacF*aagQ*ctaH*agtP*gacY*tttA*tcaT*aagQ*gaaQ*gcaD*attF*gaaD*aagE*tttL*ctgV*aatH*gaaL*gtcT*aatS:1*gacS*gttK*gttT:2*aagR:2*gttI:3*aaaR:3*aaaR*aaaS*gctS+T*ataV:1*aagT*ggtE*attL*atcL*gatQ*gttA:1*aagN*actK-ttt:3 +CM143130.1 miniprot mRNA 2219118 2219510 83 - . ID=SS000049;Rank=6;Identity=0.2714;Positive=0.4714;Target=460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 45 173 +CM143130.1 miniprot CDS 2219118 2219510 83 - 0 Parent=SS000049;Rank=6;Identity=0.2714;Target=460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 45 173 +##PAF 460519_gs115_MATkp_MATalpha|gene_index=3|name=sla2|role=flanking_conserved 1044 215 1044 + CM143127.1 3497966 497892 500439 1266 2571 0 AS:i:1948 ms:i:1948 np:i:584 fs:i:0 st:i:0 da:i:-1 do:i:27 cg:Z:71M2D10M3I6M1I5M3I29M1D31M1I193M2D231M21D40M1D153M1D52M cs:Z::4*gaaQ:2*agaI*caaE:1*tatF*gatI:2*catY*caaS*agaD:1*tttY*gagD:3*gatE:1*accS*agcY*cttV*cacK:5*atcV:5*acaP*accF*actE*cctA:3*ctcF*attN*gatW*gagD*aacE:1*ggtD*attE*cgtL*agaK:1*cctR*accI*aagL:1*ccgE*gcgE*gcgP*aagS*agtL*ccaQ*acgV*gcaS:1-ccgcca*ccaK*ccgA:1*ccaS*aagE:1*ataF*gcaG*aacT:1+TEV*ttaI*atcH*aatS:3+A:1*gttT*gaaD*ttcL:1+AQS*aaaN:1*caaL*caaK*gacQ*aatQ*gtgY:1*gctQ:2*gaaQ*agaL:1*gccE*agaQ:2*aatQ*gcgQ:3*gcgE:2*gaaH*gaaQ:1-gct*aatQ:2*gctL*gcaE*tttY*gagW*cagE*caaK:1*cgcK:3*caaE:3*atgL*gcaY*cagA:2*atgQ:1*caaE*caaS*tatD*catQ*acaL:1+R*gcgQ*gctV:4*gctG:7*gctI:1*aagR*aacG:1*tacF:1*caaR:3*ttgM:1*caaR:3*caaE:3*gttA:2*cagT:1*gcgL*atgS*aatS*gccT*aatT:1*gctN:1*actQ:2*attL*gcaG*ttgA:1*gatE:1*agtL:1*aatG*agtN*gtcI:3*ttgA*aacA*ttgQ*ttcW:4*gagD:1*ataL:8*caaE:6*caaS:3*aagT*ttgA:1*caaL:2*gcaS:2*cagR:6*gacE*aggK:2*aaaR:6*gttI:6*aaaR:7*gagD*attL*gacE*aagR*ttaS*agaK*gggS*tctD:1*gacN:1*ttgE*attT:1*aaaR:3*gaaR*gttL*aatR*actE*ttgQ*aagE*gatT:2*gatA*gtgD*acaI:1*agaK*aacL*cagH:2*aatE:1*aacK:1*attF*ttcL*aacS*gcaQ:1*cgaN:2*atgI:3*gaaQ*accN*aaaQ:1-aaagaa*agaQ*gaaA:1*caaS*atcL:2*atgS*tcaA*ccaN:1*tcaR*aatL*gctK*gagA:1*cagE*gaaA*acaQ:1*cgtQ:3*gagD:1*atcL*gaaA:1*ttaA*caaH:3*gatE*gatA*gcgT*ttaI:1*cagE:1*gccT*gagG*tctQ*aaaQ*aggS*gaaI*agcQ*gaaN*gaaS:7*acaA*gtgI:1*caaL:3*atgD:2*gttT*gctE*attV:2*tctA:2*caaT:3*aaaQ:2*gaaQ:1*agtG:6*tcgP:2*ggcA:7*tcaE:2*ctaS*accS:4*gcaS*ggcS*gaaN*acaL*agtA*caaT:2*gctT*acgS*gctS:2*aacG:6*agcN:2*tatH*gctV*gagS*atcV:1*tctQ:2*tcaT:3*ctgT*tgtS:1*acaV:1*gttL*gagL:2*gttC:2*atcV*attV*aagR*tttL*tgcA*aagS*acaS*gagD*aatQ*ttgE*gaaA*aacE*tcgA:2*tcaN:3*ttgD:1*ggtA:1*acaE*tgcS*attE*gaaS:1*ttgI*gaaV*gatS:1*ttgY:1*aagS*aatS:1*caaK*agcG:2*gaaD*gaaQ*caaE:1*tcaT:2*gttA:3*gtcN:1*gaaD:1*catQ*gaaQ*agaE:1*gaaQ*gaaT:1*actS*acaS:1*attV:1*actK*attL*gcaI:1*acgS-agcggtggcggcggcggcggcggcggtggcggtagcagcagcaacagcaacaacaagttcatt*gagQ*atcV*gaaN*aaaI*caaN*acaV*gaaN*gagD*gagN*ttaV*gaaG*agcE:3*aacR:2*aacA*gctH:3*gttT:1*aagA*caaK:1*accS*ttaD:3*tcgD:3*agcN*aaaA*aacK-tta:2*ttgI:1*cctT:2*ttaM*gaaK*gtcI:1*aagN*gctS:2*gcaS:1*tccA:2*atcV:4*tcgI*atgL:2*tctK*gcaT:1*atcT:1*actC:1*catN:3*gcaN*aatH:1*aaaR:5*gccT*caaS:4*aatH:1*agaK:8*gctS:1*gctS:2*tctY*gctS:2*ttaS:3*actI:3*aatV:2*ggtS*aagT*aatS*acaS*cacP:1*gaaQ:4*tctC:1*gaaD:2*tctA:2*attA:5*gcaS:4*acgS*cagF*ttcM:5*aatK:2*gatL:3*aagS:1*tctT*attS:2*aagR:3*agcR:4*ttgI*attL*aatS*aaaQ*tctK*acaD*caaK-tta*gttE*aatE*gatL*gatE:2*ttcY:4*atcA*attH*gatE:1*agaK*aaaT*gaaV*gaaQ:1*aaaE:2*gcaV:2*atcL:3*aatT:2*ggtQ*gctN:2*aagR:3*gatE:2*aaaR*tatF*agtG:1*caaH*gatA:1*gatE +CM143127.1 miniprot mRNA 497893 500439 1948 + . ID=SS000050;Rank=1;Identity=0.4924;Positive=0.6814;Target=460519_gs115_MATkp_MATalpha|gene_index=3|name=sla2|role=flanking_conserved 216 1044 +CM143127.1 miniprot CDS 497893 500439 1948 + 0 Parent=SS000050;Rank=1;Identity=0.4924;Target=460519_gs115_MATkp_MATalpha|gene_index=3|name=sla2|role=flanking_conserved 216 1044 +##PAF 460519_gs115_MATkp_MATalpha|gene_index=3|name=sla2|role=flanking_conserved 1044 215 1044 - CM143128.1 3172219 2744266 2746813 1263 2571 0 AS:i:1947 ms:i:1947 np:i:585 fs:i:0 st:i:0 da:i:-1 do:i:27 cg:Z:71M2D10M3I6M1I5M3I29M1D31M1I193M2D231M21D40M1D153M1D52M cs:Z::4*gaaQ:2*agaI*caaE:1*tatF*gatI:2*catY*caaS*agaD:1*tttY*gagD:3*gatE:1*accS*agcY*cttV*cacK:5*atcV:5*acgP*accF*agtE*cctA:3*ctcF*attN*gatW*gagD*aacE:1*ggtD*attE*cgtL*agaK:1*cctR*accI*aagL:1*ccgE*gcgE*gcgP*aagS*agtL*ccaQ*acgV*gcaS:1-ccgcca*ccaK*ccgA:1*ccaS*aagE:1*ataF*gcaG*agcT:1+TEV*ttaI*atcH*aatS:3+A:1*gttT*gaaD*ttcL:1+AQS*aaaN:1*caaL*caaK*gacQ*aatQ*gtgY:1*gctQ:2*gaaQ*agaL:1*gccE*agaQ:2*aatQ*gcgQ:3*gcgE:2*gaaH*gaaQ:1-gct*aatQ:2*gctL*gcaE*tttY*gagW*cagE*caaK:1*cgcK:3*caaE:3*atgL*gcaY*cagA:2*atgQ:1*caaE*caaS*tatD*catQ*acaL:1+R*gcgQ*gctV:4*gctG:7*gctI:1*aagR*aacG:1*tacF:1*caaR:3*ttgM:1*caaR:3*caaE:3*gttA:2*cagT:1*gcgL*atgS*aatS*gccT*aatT:1*gctN:1*actQ:2*attL*gcaG*ttgA:1*gatE:1*agtL:1*aatG*agtN*gtcI:3*ttgA*aacA*ttgQ*ttcW:4*gagD:1*ataL:8*caaE:6*caaS:3*aagT*ttgA:1*caaL:2*gcaS:2*cagR:6*gacE*aggK:2*aaaR:6*gttI:6*aaaR:7*gagD*attL*gacE*aagR*ttaS*agaK*gggS*tctD:1*gacN:1*ttgE*attT:1*aaaR:3*gaaR*gttL*aatR*actE*ttgQ*aagE*gatT:2*gatA*gtgD*acaI:1*agaK*aacL*cagH:2*aatE:1*aacK:1*attF*ttcL*aacS*gcaQ:1*cgaN:2*atgI:3*gaaQ*accN*aaaQ:1-aaagaa*agaQ*gaaA:1*caaS*atcL:2*atgS*tcaA*ccaN:1*tcaR*aatL*gctK*gagA:1*cagE*gaaA*acaQ:1*cgtQ:3*gagD:1*atcL*gaaA:1*ttaA*caaH:3*gatE*gatA*gcgT*ttaI:1*cagE:1*gccT*gagG*tctQ*aaaQ*aggS*gaaI*agcQ*gaaN*gaaS:7*acaA*gtgI:1*caaL:3*atgD:2*gttT*gctE*attV:2*tctA:2*caaT:3*aaaQ:2*gaaQ:1*agtG:6*tcgP:2*ggcA:7*tcaE:2*ctaS*accS:4*gcaS*ggcS*gaaN*acaL*agtA*caaT:2*gctT*acgS*gctS:2*aacG:6*agcN:2*tatH*gctV*gagS*atcV:1*tctQ:2*tcaT:3*ctgT*tgtS:1*acaV:1*gttL*gagL:2*gttC:2*atcV*attV*aagR*tttL*tgcA*aagS*acaS*gagD*aatQ*ttgE*gaaA*aacE*tcgA:2*tcaN:3*ttgD:1*ggtA:1*acaE*tgcS*attE*gaaS:1*ttgI*gaaV*gatS:1*ttgY:1*aagS*aatS:1*gaaK*agcG:2*gaaD*gaaQ*caaE:1*tcaT:2*gttA:3*gtcN:1*gaaD:1*catQ*gaaQ*agaE:1*gaaQ*gaaT:1*actS*acaS:1*attV:1*actK*attL*gcaI:1*acgS-agcggtggcggcggcggcggcggcggtggcagtagcagcagcaacagcaacaacaagttcatt*gagQ*atcV*gaaN*aaaI*caaN*acaV*gaaN*gagD*gagN*ttaV*gaaG*agcE:3*aacR:2*aacA*gctH:3*gttT:1*aagA*caaK:1*acaS*ttaD:3*tcgD:3*agcN*aaaA*aacK-tta:2*ttgI:1*cctT:2*ttaM*gaaK*gtcI:1*aagN*gctS:2*gcaS:1*tccA:2*atcV:4*tcgI*atgL:2*tctK*gcaT:1*atcT:1*actC:1*catN:3*gcaN*aatH:1*aaaR:3*acaS:1*gccT*caaS:4*aatH:1*agaK:8*gctS:1*gctS:2*tctY*gctS:2*ttaS:3*actI:3*aatV:2*ggtS*aagT*aatS*acaS*cacP:1*gaaQ:4*tctC:1*gaaD:2*tctA:2*attA:5*gcaS:4*acgS*cagF*ttcM:5*aatK:2*gatL:3*aagS:1*tctT*attS:2*aagR:3*agcR:4*ttgI*attL*aatS*aaaQ*tctK*acaD*caaK-tta*gttE*aatE*gatL*gatE:2*ttcY:4*atcA*attH*gatE:1*agaK*aaaT*gaaV*gaaQ:1*aaaE:2*gcaV:2*atcL:3*aatT:2*ggtQ*gctN:2*aagR:3*gatE:2*aaaR*tatF*agtG:1*caaH*gatA:1*gatE +CM143128.1 miniprot mRNA 2744267 2746813 1947 - . ID=SS000051;Rank=2;Identity=0.4912;Positive=0.6826;Target=460519_gs115_MATkp_MATalpha|gene_index=3|name=sla2|role=flanking_conserved 216 1044 +CM143128.1 miniprot CDS 2744267 2746813 1947 - 0 Parent=SS000051;Rank=2;Identity=0.4912;Target=460519_gs115_MATkp_MATalpha|gene_index=3|name=sla2|role=flanking_conserved 216 1044 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 163 70 163 + CM143131.1 1178080 298633 298897 90 288 0 AS:i:110 ms:i:100 np:i:55 fs:i:0 st:i:0 da:i:246 do:i:18 cg:Z:7M3D26M4I33M1I10M1I1M2I8M cs:Z::2*cagT:2*ataP*aaaR-cgtagtgac:1*aagR*gccI*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actR*tttC:2*agcN*aatD:1*tacV +CM143131.1 miniprot mRNA 298634 298897 100 + . ID=SS000052;Rank=1;Identity=0.3125;Positive=0.5729;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 71 163 +CM143131.1 miniprot CDS 298634 298897 100 + 0 Parent=SS000052;Rank=1;Identity=0.3125;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 71 163 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 163 70 163 - CM143130.1 2250200 2219108 2219372 90 288 0 AS:i:110 ms:i:100 np:i:55 fs:i:0 st:i:0 da:i:246 do:i:18 cg:Z:7M3D26M4I33M1I10M1I1M2I8M cs:Z::2*cagT:2*attP*aaaR-cgtagtgac:1*aagR*gccI*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actR*tttC:2*agcN*aatD:1*tacV +CM143130.1 miniprot mRNA 2219109 2219372 100 - . ID=SS000053;Rank=2;Identity=0.3125;Positive=0.5729;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 71 163 +CM143130.1 miniprot CDS 2219109 2219372 100 - 0 Parent=SS000053;Rank=2;Identity=0.3125;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 71 163 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 163 70 163 + CM143129.1 2335549 470666 470930 90 288 0 AS:i:110 ms:i:100 np:i:55 fs:i:0 st:i:0 da:i:246 do:i:18 cg:Z:7M3D26M4I33M1I10M1I1M2I8M cs:Z::2*cagT:2*ataP*aaaR-cgtagtgac:1*aagR*gccI*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actR*tttC:2*agcN*aatD:1*tacV +CM143129.1 miniprot mRNA 470667 470930 100 + . ID=SS000054;Rank=3;Identity=0.3125;Positive=0.5729;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 71 163 +CM143129.1 miniprot CDS 470667 470930 100 + 0 Parent=SS000054;Rank=3;Identity=0.3125;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 71 163 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 163 70 163 + CM143128.1 3172219 2742192 2742456 90 288 0 AS:i:110 ms:i:100 np:i:55 fs:i:0 st:i:0 da:i:246 do:i:18 cg:Z:7M3D26M4I33M1I10M1I1M2I8M cs:Z::2*cagT:2*ataP*aaaR-cgtagtgac:1*aagR*gccI*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actR*tttC:2*agcN*aatD:1*tacV +CM143128.1 miniprot mRNA 2742193 2742456 100 + . ID=SS000055;Rank=4;Identity=0.3125;Positive=0.5729;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 71 163 +CM143128.1 miniprot CDS 2742193 2742456 100 + 0 Parent=SS000055;Rank=4;Identity=0.3125;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 71 163 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 163 70 163 - CM143127.1 3497966 502249 502513 90 288 0 AS:i:110 ms:i:100 np:i:55 fs:i:0 st:i:0 da:i:246 do:i:18 cg:Z:7M3D26M4I33M1I10M1I1M2I8M cs:Z::2*cagT:2*ataP*aaaR-cgtagtgac:1*aagR*gccI*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actR*tttC:2*agcN*aatD:1*tacV +CM143127.1 miniprot mRNA 502250 502513 100 - . ID=SS000056;Rank=5;Identity=0.3125;Positive=0.5729;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 71 163 +CM143127.1 miniprot CDS 502250 502513 100 - 0 Parent=SS000056;Rank=5;Identity=0.3125;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 71 163 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 163 70 163 + CM143126.1 1831595 1288497 1288761 90 288 0 AS:i:110 ms:i:100 np:i:55 fs:i:0 st:i:0 da:i:246 do:i:18 cg:Z:7M3D26M4I33M1I10M1I1M2I8M cs:Z::2*cagT:2*ataP*aaaR-cgtagtgac:1*aagR*gccI*ttaE*cggK*aaaR*tgcS*cgtK*catR:1*aatP*actK*gaaT*accA*agaQ*cggM*aagE:2*caaN:2*aagT*ctaE*agtN*gacE+DNPY*tttL:2*gaaR*gcaD*attL*gaaQ*aagQ*tttL*ctgV*aatH*gaaK*gtcT*aatG:1*gacC*gttA*gttP:1*atcV*aagR:5*aagR*aaaR:3*aaaR*aaaT+L*gctT:3*ggtE*attL*atcS:1*gttL:1+N*aagQ+DT*actR*tttC:2*agcN*aatD:1*tacV +CM143126.1 miniprot mRNA 1288498 1288761 100 + . ID=SS000057;Rank=6;Identity=0.3125;Positive=0.5729;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 71 163 +CM143126.1 miniprot CDS 1288498 1288761 100 + 0 Parent=SS000057;Rank=6;Identity=0.3125;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT 71 163 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 195 39 159 + CM143130.1 2250200 2218551 2218911 126 360 0 AS:i:202 ms:i:202 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:105 cg:Z:120M cs:Z::1*acgL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:4*ttcY*aagG*aaaA*actI*cctD*agaN*atgG*aatK*gaaD*ataS*agcL*gatN*caaK*tgtV:1*gaaP:2*aaaS*aacS*aagR*gcaH*cagR*aaaV*aaaQ*ccaK*accE:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaR:2*aatE*gtcM:1*actL:1 +CM143130.1 miniprot mRNA 2218552 2218911 202 + . ID=SS000058;Rank=1;Identity=0.3500;Positive=0.5500;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 40 159 +CM143130.1 miniprot CDS 2218552 2218911 202 + 0 Parent=SS000058;Rank=1;Identity=0.3500;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 40 159 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 195 39 159 - CM143131.1 1178080 299094 299454 123 360 0 AS:i:200 ms:i:200 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:105 cg:Z:120M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:4*ttcY*aagG*aaaA*actI*cccD*agaN*atgG*aatK*gaaD*ataS*agcL*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacS*aagR*gcaH*cagR*aagV*aaaQ*ccaK*accE:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaR:2*gatE*gtcM:1*actL:1 +CM143131.1 miniprot mRNA 299095 299454 200 - . ID=SS000059;Rank=2;Identity=0.3417;Positive=0.5500;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 40 159 +CM143131.1 miniprot CDS 299095 299454 200 - 0 Parent=SS000059;Rank=2;Identity=0.3417;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 40 159 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 195 39 159 - CM143129.1 2335549 471127 471487 123 360 0 AS:i:200 ms:i:200 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:105 cg:Z:120M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:4*ttcY*aagG*aaaA*actI*cccD*agaN*atgG*aatK*gaaD*ataS*agcL*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacS*aagR*gcaH*cagR*aagV*aaaQ*ccaK*accE:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaR:2*gatE*gtcM:1*actL:1 +CM143129.1 miniprot mRNA 471128 471487 200 - . ID=SS000060;Rank=3;Identity=0.3417;Positive=0.5500;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 40 159 +CM143129.1 miniprot CDS 471128 471487 200 - 0 Parent=SS000060;Rank=3;Identity=0.3417;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 40 159 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 195 39 159 - CM143128.1 3172219 2742649 2743009 123 360 0 AS:i:200 ms:i:200 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:105 cg:Z:120M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:4*ttcY*aagG*aaaA*actI*cccD*agaN*atgG*aatK*gaaD*ataS*agcL*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacS*aagR*gcgH*cagR*aagV*aaaQ*ccaK*accE:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaR:2*gatE*gtcM:1*actL:1 +CM143128.1 miniprot mRNA 2742650 2743009 200 - . ID=SS000061;Rank=4;Identity=0.3417;Positive=0.5500;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 40 159 +CM143128.1 miniprot CDS 2742650 2743009 200 - 0 Parent=SS000061;Rank=4;Identity=0.3417;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 40 159 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 195 39 159 + CM143127.1 3497966 501696 502056 123 360 0 AS:i:200 ms:i:200 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:105 cg:Z:120M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:4*ttcY*aagG*aaaA*actI*cccD*agaN*atgG*aatK*gaaD*ataS*agcL*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacS*aagR*gcgH*cagR*aagV*aaaQ*ccaK*accE:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaR:2*gatE*gtcM:1*actL:1 +CM143127.1 miniprot mRNA 501697 502056 200 + . ID=SS000062;Rank=5;Identity=0.3417;Positive=0.5500;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 40 159 +CM143127.1 miniprot CDS 501697 502056 200 + 0 Parent=SS000062;Rank=5;Identity=0.3417;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 40 159 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 195 39 159 - CM143126.1 1831595 1288954 1289314 123 360 0 AS:i:200 ms:i:200 np:i:66 fs:i:0 st:i:0 da:i:108 do:i:105 cg:Z:120M cs:Z::1*acaL*tttS*tatF*ttcL*gatT*tctH:2*aaaQ:2*aaaT*tgtT*tatS*ctgP*aagL:1*gaaK*gatR:4*ttcY*aagG*aaaA*actI*cccD*agaN*atgG*aatK*gaaD*ataS*agcL*gatN*caaK*tgtV*acgA*gaaP:2*aaaS*aacS*aagR*gcgH*cagR*aagV*aaaQ*ccaK*accE:1*agaK*aagR:4*attM:1*tacF:2*tatF:2*aaaR:2*cacA*gatN*acaY*gctN*ctcS:1*attK*gaaA*gtaL:1*aaaQ*aggD:2*acaD*gtgA:1*aaaN*gatR*gacE*ccgK*tcaH*gcgQ*gatQ:2*aaaS*agaL*tttY:1*tttI*gagQ:2*aagH:1*gacK*gaaS*aacK*atgE:2*ctaS*gaaR:2*gatE*gtcM:1*actL:1 +CM143126.1 miniprot mRNA 1288955 1289314 200 - . ID=SS000063;Rank=6;Identity=0.3417;Positive=0.5500;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 40 159 +CM143126.1 miniprot CDS 1288955 1289314 200 - 0 Parent=SS000063;Rank=6;Identity=0.3417;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT 40 159 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 440 0 440 + CM143130.1 2250200 2215857 2217264 543 1410 0 AS:i:773 ms:i:773 np:i:290 fs:i:0 st:i:0 da:i:60 do:i:21 cg:Z:15M4D11M7D70M1I30M1D66M4D8M12D182M2D57M cs:Z:*gaaQ*attM:3*acaA:3*gcgT*ttaM*aaaQ*cagE:2-gagtctaaaagg:1*agcQ*gaaH*gaaQ:2*gatE*gaaK*caaE*attA*gatE-acagtgttacaagaacatatc:1*aagR*ctaV*gttL*gctR*attL:2*tctT*attL:1*caaK*agcV*ggtS*gtgT*aaaD:1*atcL*gaaR*gatE*agtF*ttaV:1*gagN:1*gatE:1*tcgP*atgV*caaY*ggcS*ggtN*aatT*caaD*aacI*tcaP*tcaT*ccaA*tcaE:2*ctaG:1*attM*attL:2*gcaV*ggcS*gaaH*acaL:1*caaT*gaaQ:1*gctS:1*gctT*ttcM*aatT*aacD*tttY:3*ggaN*ccaM*agcR:2+S*tatE*gctS*gagG*atcL:1*tctK*actA:1*tcaT:3*ctgD*tgtS:1*acaG*gatN*gttL*gagF*ttgS:3*ggcA*atcV*attL*aagR*tttD*tgcR:1-aca*gagD*aatD*ttgV*gaaQ*aacE*tcaI:1*ttaV*tcaE*tctG:1*agaK*ttgD*gttL*ggtA*gagH*acaM*tgcV*attE*gaaL:1*ttgF:1*gatS*ttaM:2*aagD*aatH:1*caaL*agcK:1*agcE*gaaI*gaaH*caaE*aagR*tcaT:4*aagT:1*gtcN*gttI*gaaN*atcV*catQ:1*agaV*ttaI*gaaQ*gaaS:1*actM*acaQ*ttgV*attV:1*actV*attF*gcaR*tctD*acgP-agcggcggcggc:1*ggcR*ggcK:1*agcP*agcV:1*aacS-aacaacaagttcattgcggtcgaaaaacaaacagaa*gagD:2*gaaG*agcY*ttgF*gtgL:1*aacK:1*atgL*aacA*gctN*gctT*gcgQ*gagA*gttA*atcV*aagE*caaK:1*acaA*ttaD*cacL:1*acgE:1*ttgM*ctaS:1*agcR*aaaH*aacK:1*cagE*gacV*ttgQ*tcaE*cctG*attG*gacS:4*aagE:2*ttgI*gcaS*gcaC*tccA*attS:2*accI*aaaN:1*attV*tcgK*atgL:1*atcL*tctE:1*gccC:1*gatE*actA:1*catE:3*gcaS*aatR:4*agtL*acaS:2*caaL:6*aaaR:8*gctS:1*gctQ:2*tctY:2*aacG*ttaI:2*caaR*actM:3*aatV:1*agtA:1*aagT:1*acaS*cacS:12*tctA:1*attA:3*gcaS*gctS*gcaS:3*gctS*acgD*cagL*ttcM:1*aagQ*actS*caaH*gacL:3*gatE:2*aagR:2*tctT*attS*gctS:2*agcM:2*agcT*cagK:1*caaR*gaaS:1*attL-aataaa*tctL:1*caaD*ttaE*gttS:1*gatK*gatT*attV:1*ttcY:1*aagQ:1*agtT*atcA*attH*gatE:2*aaaT*gaaA:1*atgL*aaaE:2*gcaV:2*attL:3*aatS:2*ggtS*gctQ:6*gatE:3*tatF:2*caaR:1*gatE*gatE*gatS +CM143130.1 miniprot mRNA 2215858 2217264 773 + . ID=SS000064;Rank=1;Identity=0.3851;Positive=0.6170;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +CM143130.1 miniprot CDS 2215858 2217264 773 + 0 Parent=SS000064;Rank=1;Identity=0.3851;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 440 0 440 + CM143127.1 3497966 499023 500442 546 1422 0 AS:i:773 ms:i:773 np:i:290 fs:i:0 st:i:0 da:i:60 do:i:24 cg:Z:15M4D12M7D69M1I30M1D66M9D8M11D182M2D57M cs:Z:*gaaQ*attM:3*acaA:3*gcgT*ttaM*aaaQ*cagE:2-gagtctaaaagg:1*agcQ*gaaH*gaaQ:2*gatE*gaaK*caaE*attA*gatE:1-gtgttacaagaacatatcatg*aagR*ctaV*gttL*gctR*attL:2*tctT*attL:1*caaK*agcV*ggtS*gtgT*aaaD:1*atcL*gaaR*gatE*agtF*ttaV:1*gagN:1*gatE:1*tcgP*atgV*caaY*ggcS*ggtN*aatT*caaD*aacI*tcaP*tcaT*ccaA*tcaE:2*ctaG:1*attM*attL:2*gcaV*ggcS*gaaH*acaL:1*caaT*gaaQ:1*gctS:1*gctT*ttcM*aatT*aacD*tttY:3*ggaN*ccaM*agcR:2+S*tatE*gctS*gagG*atcL:1*tctK*actA:1*tcaT:3*ctgD*tgtS:1*acaG*gatN*gttL*gagF*ttgS:3*ggcA*atcV*attL*aagR*tttD*tgcR:1-aca*gagD*aatD*ttgV*gaaQ*aacE*tcgI:1*ttaV*tcaE*tctG:1*agaK*ttgD*gttL*ggtA*gagH*acaM*tgcV*attE*gaaL:1*ttgF:1*gatS*ttaM:2*aagD*aatH:1*caaL*agcK:1*agcE*gaaI*gaaH*caaE*aagR*tcaT:1*aaaR:2*gaaT:1*gtcN*gttI*gaaN*atcV*catQ:1*agaV*ttaI*gaaQ*gaaS:1*actM*acaQ*ttgV*attV:1*actV*attF*gcaR*tctD*acgP-agcggtggcggcggcggcggcggcggt:1*ggtR*agcK:1*agcP*aacV:1*aacS-aacaagttcattgagatcgaaaaacaaacagaa*gagD:2*gaaG*agcY*ttgF*gtgL:1*aacK:1*atgL*aacA*gctN*gctT*gcgQ*gagA*gttA*atcV*aagE*caaK:1*accA*ttaD*cacL:1*acgE:1*ttgM*ctaS:1*agcR*aaaH*aacK:1*cagE*gacV*ttgQ*tcaE*cctG*attG*gacS:4*aagE:2*ttgI*gcaS*gcaC*tccA*attS:2*accI*aaaN:1*attV*tcgK*atgL:1*atcL*tctE:1*gccC:1*gatE*actA:1*catE:3*gcaS*aatR:4*agtL:3*caaL:15*gctS:1*gctQ:2*tctY:2*aacG*ttaI:2*caaR*actM:3*aatV:1*agtA:1*aagT:1*acaS*cacS:12*tctA:1*attA:3*gcaS*gctS*gcaS:3*gctS*acgD*cagL*ttcM:1*aagQ*actS*caaH*gacL:3*gatE:2*aagR:2*tctT*attS*gctS:2*agcM:2*agcT*caaK:1*caaR*gaaS:1*attL-aataaa*tctL:1*caaD*ttaE*gttS:1*gatK*gatT*attV:1*ttcY:1*aagQ:1*agtT*atcA*attH*gatE:2*aaaT*gaaA:1*atgL*aaaE:2*gcaV:2*atcL:3*aatS:2*ggtS*gctQ:6*gatE:3*tatF:2*caaR:1*gatE*gatE*gatS +CM143127.1 miniprot mRNA 499024 500442 773 + . ID=SS000065;Rank=2;Identity=0.3840;Positive=0.6118;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +CM143127.1 miniprot CDS 499024 500442 773 + 0 Parent=SS000065;Rank=2;Identity=0.3840;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 440 0 440 - CM143131.1 1178080 300680 302096 543 1419 0 AS:i:772 ms:i:772 np:i:290 fs:i:0 st:i:0 da:i:60 do:i:24 cg:Z:15M4D12M7D69M1I30M1D66M8D8M11D182M2D57M cs:Z:*gaaQ*attM:3*acaA:3*gcgT*ttaM*aaaQ*cagE:2-gagtctaaaagg:1*agcQ*gaaH*gaaQ:2*gatE*gaaK*caaE*attA*gatE:1-gtgttacaagaacatatcatg*aagR*ctaV*gttL*gctR*attL:2*tctT*attL:1*caaK*agcV*ggtS*gtgT*aaaD:1*atcL*gaaR*gatE*agtF*ttaV:1*gagN:1*gatE:1*tcgP*atgV*caaY*ggcS*ggtN*aatT*caaD*aacI*tcaP*tcaT*ccaA*tcaE:2*ctaG:1*attM*attL:2*gcaV*ggcS*gaaH*acaL:1*caaT*gaaQ:1*gctS:1*gctT*ttcM*aatT*aacD*tttY:3*ggaN*ccaM*agcR:2+S*tatE*gctS*gagG*atcL:1*tctK*actA:1*tcaT:3*ctgD*tgtS:1*acaG*gatN*gttL*gagF*ttgS:3*ggcA*atcV*attL*aagR*tttD*tgcR:1-aca*gagD*aatD*ttgV*gaaQ*aacE*tcgI:1*ttaV*tcaE*tctG:1*agaK*ttgD*gttL*ggtA*gagH*acaM*tgcV*attE*gaaL:1*ttgF:1*gatS*ttaM:2*aagD*aatH:1*caaL*agcK:1*agcE*gaaI*gaaH*caaE*aagR*tcaT:1*aaaR:2*gaaT:1*gttN*gttI*gaaN*atcV*catQ:1*agaV*ttaI*gaaQ*gaaS:1*actM*acaQ*ttgV*attV:1*actV*attF*gcaR*tctD*acgP-agcggtggcggcggcggcggcggt:1*agtR*agcK:1*agcP*aacV:1*aacS-aacaagttcattgagatcgaaaaacaaacagaa*gagD:2*gaaG*agcY*ttgF*gtgL:1*aacK:1*atgL*aacA*gctN*gctT*gcgQ*gagA*gttA*atcV*aagE*caaK:1*acaA*ttaD*cacL:1*acgE:1*ttgM*ctaS:1*agcR*aaaH*aacK:1*cagE*gacV*ttgQ*tcaE*cctG*attG*gacS:4*aagE:2*ttgI*gcaS*gcaC*tccA*attS:2*accI*aaaN:1*attV*tcgK*atgL:1*atcL*tctE:1*gccC:1*gatE*actA:1*catE:3*gcaS*aatR:4*agtL*acaS:2*caaL:15*gctS:1*gctQ:2*tctY:2*aacG*ttaI:2*caaR*actM:3*aatV:1*agtA:1*aagT:1*acaS*cacS:12*tctA:1*attA:3*gcaS*gctS*gcaS:3*gctS*acgD*cagL*ttcM:1*aagQ*actS*caaH*gacL:3*gatE:2*aagR:2*tctT*attS*gctS:2*agcM:2*agcT*caaK:1*caaR*gaaS:1*attL-aataaa*tctL:1*caaD*ttaE*gttS:1*gatK*gatT*attV:1*ttcY:1*aagQ:1*agtT*atcA*attH*gatE:2*aaaT*gaaA:1*atgL*aaaE:2*gcaV:2*atcL:3*aatS:2*ggtS*gctQ:6*gatE:3*tatF:2*caaR:1*gatE*gatE*gatS +CM143131.1 miniprot mRNA 300681 302096 772 - . ID=SS000066;Rank=3;Identity=0.3827;Positive=0.6131;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +CM143131.1 miniprot CDS 300681 302096 772 - 0 Parent=SS000066;Rank=3;Identity=0.3827;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 440 0 440 - CM143129.1 2335549 472734 474153 543 1422 0 AS:i:771 ms:i:771 np:i:290 fs:i:0 st:i:0 da:i:60 do:i:24 cg:Z:15M4D12M7D69M1I30M1D66M9D8M11D182M2D57M cs:Z:*gaaQ*attM:3*acaA:3*gcgT*ttaM*aaaQ*cagE:2-gagtctaaaagg:1*agcQ*gaaH*gaaQ:2*gatE*gaaK*caaE*attA*gatE:1-gtgttacaagaacatatcatg*aagR*ctaV*gttL*gctR*attL:2*tccT*attL:1*caaK*agcV*ggtS*gtgT*aaaD:1*atcL*gaaR*gacE*agtF*ttaV:1*gagN:1*gatE:1*tcgP*atgV*caaY*ggcS*ggtN*aatT*caaD*aacI*tcaP*tcaT*ccaA*tcaE:2*ctaG:1*attM*attL:2*gcaV*ggcS*gaaH*acaL:1*caaT*gaaQ:1*gctS:1*gctT*ttcM*aatT*aacD*tttY:3*ggaN*ccaM*agcR:2+S*tatE*gctS*gagG*atcL:1*tctK*actA:1*tcaT:3*ctgD*tgtS:1*acaG*gatN*gttL*gagF*ttgS:3*ggcA*atcV*attL*aagR*tttD*tgcR:1-aca*gagD*aatD*ttgV*gaaQ*aacE*tcgI:1*ttaV*tcaE*tctG:1*agaK*ttgD*gttL*ggtA*gagH*acaM*tgcV*attE*gaaL:1*ttgF:1*gatS*ttaM:2*aagD*aatH:1*caaL*agcK:1*agcE*gaaI*gaaH*caaE*aagR*tcaT:1*aaaR:2*gaaT:1*gtcN*gttI*gaaN*atcV*catQ:1*agaV*ttaI*gaaQ*gaaS:1*actM*acaQ*ttgV*attV:1*actV*attF*gcaR*tctD*acgP-agcggtggcggcggcggcggcggcggt:1*agtR*agcK:1*agcP*aacV:1*aacS-aacaagttcattgagatcgaaaaacaaacagaa*gagD:2*gaaG*agcY*ttgF*gtgL:1*aacK:1*atgL*aacA*gctN*gctT*gcgQ*gagA*gttA*atcV*aagE*caaK:1*acaA*ttaD*cacL:1*acgE:1*ttgM*ctaS:1*agcR*aaaH*aacK:1*cagE*gacV*ttgQ*tcaE*cctG*attG*gacS:4*aagE:2*ttgI*gcaS*gcaC*tccA*attS:2*accI*aaaN:1*attV*tcgK*atgL:1*atcL*tctE:1*gccC:1*gatE*actA:1*catE:3*gcaS*aatR:4*agtL*acaS:2*caaL:15*gctS:1*gctQ:2*tctY:2*aacG*ttaI:2*caaR*actM:3*aatV:1*agtA:1*aagT:1*acaS*cacS:12*tctA:1*attA:3*gcaS*gctS*gcaS:3*gctS*acgD*cagL*ttcM:1*aagQ*actS*caaH*gacL:3*gatE:2*aagR:2*tctT*attS*gctS:2*agcM:2*agcT*caaK:1*caaR*gaaS:1*attL-aataaa*tctL:1*caaD*ttaE*gttS:1*gatK*gatT*attV:1*ttcY:1*aagQ:1*agtT*atcA*attH*gatE:2*aaaT*gaaA:1*atgL*aaaE:2*gcaV:2*atcL:3*aatS:2*ggtS*gctQ:6*gatE:3*tatF:2*caaR:1*gatE*gatE*gatS +CM143129.1 miniprot mRNA 472735 474153 771 - . ID=SS000067;Rank=4;Identity=0.3819;Positive=0.6118;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +CM143129.1 miniprot CDS 472735 474153 771 - 0 Parent=SS000067;Rank=4;Identity=0.3819;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 440 0 440 - CM143129.1 2335549 530018 531437 543 1422 0 AS:i:770 ms:i:770 np:i:290 fs:i:0 st:i:0 da:i:60 do:i:24 cg:Z:15M4D12M7D69M1I30M1D66M9D8M11D182M2D57M cs:Z:*gaaQ*attM:3*acaA:3*gcgT*ttaM*aaaQ*cagE:2-gagtctaaaagg:1*agcQ*gaaH*gaaQ:2*gatE*gaaK*caaE*attA*gatE:1-gtgttacaagaacatatcatg*aagR*ctaV*gttL*gctR*attL:2*tccT*attL:1*caaK*agcV*ggtS*gtgT*aaaD:1*atcL*gaaR*gatE*agtF*ttaV:1*gagN:1*gatE:1*tcgP*atgV*caaY*ggcS*ggtN*aatT*caaD*aacI*tcaP*tcaT*ccaA*tcaE:2*ctaG:1*attM*attL:2*gcaV*ggcS*gaaH*acaL:1*caaT*gaaQ:1*gctS:1*gctT*ttcM*aatT*aacD*tttY:3*ggaN*ccaM*agcR:2+S*tatE*gctS*gagG*atcL:1*tctK*actA:1*tcaT:3*ctgD*tgtS:1*acaG*gatN*gttL*gagF*ttgS:3*ggcA*atcV*attL*aagR*tttD*tgcR:1-aca*gagD*aatD*ttgV*gaaQ*aacE*tcgI:1*ttaV*tcaE*tctG:1*agaK*ttgD*gttL*ggtA*gagH*acaM*tgcV*attE*gaaL:1*ttgF:1*gatS*ttaM:2*aagD*aatH:1*gaaL*agcK:1*agcE*gaaI*gaaH*caaE*aagR*tcaT:1*aaaR:2*gaaT:1*gtcN*gttI*gaaN*atcV*catQ:1*agaV*ttaI*gaaQ*gaaS:1*actM*acaQ*ttgV*attV:1*actV*attF*gcaR*tctD*acgP-agcggtggcggcggcggcggcggcggt:1*agtR*agcK:1*agcP*aacV:1*aacS-aagaagttcattgagatcgaaaaacaaacagaa*gagD:2*gaaG*agcY*ttgF*gtgL:1*aacK:1*atgL*aacA*gctN*gctT*gcgQ*gagA*gttA*atcV*aagE*caaK:1*acaA*ttaD*cacL:1*acgE:1*ttgM*ctaS:1*agcR*aaaH*aacK:1*cagE*gacV*ttgQ*tcaE*cctG*attG*gacS:4*aagE:2*ttgI*gcaS*gcaC*tccA*attS:2*accI*aaaN:1*attV*tcgK*atgL:1*atcL*tctE:1*gccC:1*gatE*actA:1*catE:3*gcaS*aatR:4*agtL*acaS:2*caaL:15*gctS:1*gctQ:2*tctY:2*aacG*ttaI:2*caaR*actM:3*aatV:1*agtA:1*aagT:1*acaS*cacS:12*tctA:1*attA:3*gcaS*gctS*gcaS:3*gctS*acgD*cagL*ttcM:1*aagQ*actS*caaH*gacL:3*gatE:2*aagR:2*tctT*attS*gctS:2*agcM:2*agcT*caaK:1*caaR*gaaS:1*attL-aataaa*tctL:1*caaD*ttaE*gttS:1*gatK*gatT*attV:1*ttcY:1*aagQ:1*agtT*atcA*attH*gatE:2*aaaT*gaaA:1*atgL*aaaE:2*gcaV:2*atcL:3*aatS:2*ggtS*gctQ:6*gatE:3*tatF:2*caaR:1*gatE*gatE*gatS +CM143129.1 miniprot mRNA 530019 531437 770 - . ID=SS000068;Rank=5;Identity=0.3819;Positive=0.6118;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +CM143129.1 miniprot CDS 530019 531437 770 - 0 Parent=SS000068;Rank=5;Identity=0.3819;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 440 0 440 + CM143129.1 2335549 534382 535801 543 1422 0 AS:i:770 ms:i:770 np:i:290 fs:i:0 st:i:0 da:i:60 do:i:24 cg:Z:15M4D12M7D69M1I30M1D66M9D8M11D182M2D57M cs:Z:*gaaQ*attM:3*acaA:3*gcgT*ttaM*aaaQ*cagE:2-gagtctaaaagg:1*agcQ*gaaH*gaaQ:2*gatE*gaaK*caaE*attA*gatE:1-gtgttacaagaacatatcatg*aagR*ctaV*gttL*gctR*attL:2*tccT*attL:1*caaK*agcV*ggtS*gtgT*aaaD:1*atcL*gaaR*gatE*agtF*ttaV:1*gagN:1*gatE:1*tcgP*atgV*caaY*ggcS*ggtN*aatT*caaD*aacI*tcaP*tcaT*ccaA*tcaE:2*ctaG:1*attM*attL:2*gcaV*ggcS*gaaH*acaL:1*caaT*gaaQ:1*gctS:1*gctT*ttcM*aatT*aacD*tttY:3*ggaN*ccaM*agcR:2+S*tatE*gctS*gagG*atcL:1*tctK*actA:1*tcaT:3*ctgD*tgtS:1*acaG*gatN*gttL*gagF*ttgS:3*ggcA*atcV*attL*aagR*tttD*tgcR:1-aca*gagD*aatD*ttgV*gaaQ*aacE*tcgI:1*ttaV*tcaE*tctG:1*agaK*ttgD*gttL*ggtA*gagH*acaM*tgcV*attE*gaaL:1*ttgF:1*gatS*ttaM:2*aagD*aatH:1*gaaL*agcK:1*agcE*gaaI*gaaH*caaE*aagR*tcaT:1*aaaR:2*gaaT:1*gtcN*gttI*gaaN*atcV*catQ:1*agaV*ttaI*gaaQ*gaaS:1*actM*acaQ*ttgV*attV:1*actV*attF*gcaR*tctD*acgP-agcggtggcggcggcggcggcggcggt:1*agtR*agcK:1*agcP*aacV:1*aacS-aagaagttcattgagatcgaaaaacaaacagaa*gagD:2*gaaG*agcY*ttgF*gtgL:1*aacK:1*atgL*aacA*gctN*gctT*gcgQ*gagA*gttA*atcV*aagE*caaK:1*acaA*ttaD*cacL:1*acgE:1*ttgM*ctaS:1*agcR*aaaH*aacK:1*cagE*gacV*ttgQ*tcaE*cctG*attG*gacS:4*aagE:2*ttgI*gcaS*gcaC*tccA*attS:2*accI*aaaN:1*attV*tcgK*atgL:1*atcL*tctE:1*gccC:1*gatE*actA:1*catE:3*gcaS*aatR:4*agtL*acaS:2*caaL:15*gctS:1*gctQ:2*tctY:2*aacG*ttaI:2*caaR*actM:3*aatV:1*agtA:1*aagT:1*acaS*cacS:12*tctA:1*attA:3*gcaS*gctS*gcaS:3*gctS*acgD*cagL*ttcM:1*aagQ*actS*caaH*gacL:3*gatE:2*aagR:2*tctT*attS*gctS:2*agcM:2*agcT*caaK:1*caaR*gaaS:1*attL-aataaa*tctL:1*caaD*ttaE*gttS:1*gatK*gatT*attV:1*ttcY:1*aagQ:1*agtT*atcA*attH*gatE:2*aaaT*gaaA:1*atgL*aaaE:2*gcaV:2*atcL:3*aatS:2*ggtS*gctQ:6*gatE:3*tatF:2*caaR:1*gatE*gatE*gatS +CM143129.1 miniprot mRNA 534383 535801 770 + . ID=SS000069;Rank=6;Identity=0.3819;Positive=0.6118;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +CM143129.1 miniprot CDS 534383 535801 770 + 0 Parent=SS000069;Rank=6;Identity=0.3819;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +##PAF 460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 440 0 440 - CM143128.1 3172219 2744263 2745682 543 1422 0 AS:i:770 ms:i:770 np:i:290 fs:i:0 st:i:0 da:i:60 do:i:24 cg:Z:15M4D12M7D69M1I30M1D66M9D8M11D182M2D57M cs:Z:*gaaQ*attM:3*acaA:3*gcgT*ttaM*aaaQ*cagE:2-gagtctaaaagg:1*agcQ*gaaH*gaaQ:2*gatE*gaaK*caaE*attA*gatE:1-gtgttacaagaacatatcatg*aagR*ctaV*gttL*gctR*attL:2*tctT*attL:1*caaK*agcV*ggtS*gtgT*aaaD:1*atcL*gaaR*gacE*agtF*ttaV:1*gagN:1*gatE:1*tcgP*atgV*caaY*ggcS*ggtN*aatT*caaD*aacI*tcaP*tcaT*ccaA*tcaE:2*ctaG:1*attM*attL:2*gcaV*ggcS*gaaH*acaL:1*caaT*gaaQ:1*gctS:1*gctT*ttcM*aatT*aacD*tttY:3*ggaN*ccaM*agcR:2+S*tatE*gctS*gagG*atcL:1*tctK*actA:1*tcaT:3*ctgD*tgtS:1*acaG*gatN*gttL*gagF*ttgS:3*ggcA*atcV*attL*aagR*tttD*tgcR:1-aca*gagD*aatD*ttgV*gaaQ*aacE*tcgI:1*ttaV*tcaE*tctG:1*agaK*ttgD*gttL*ggtA*gagH*acaM*tgcV*attE*gaaL:1*ttgF:1*gatS*ttaM:2*aagD*aatH:1*gaaL*agcK:1*agcE*gaaI*gaaH*caaE*aagR*tcaT:1*aaaR:2*gaaT:1*gtcN*gttI*gaaN*atcV*catQ:1*agaV*ttaI*gaaQ*gaaS:1*actM*acaQ*ttgV*attV:1*actV*attF*gcaR*tctD*acgP-agcggtggcggcggcggcggcggcggt:1*agtR*agcK:1*agcP*aacV:1*aacS-aacaagttcattgagatcgaaaaacaaacagaa*gagD:2*gaaG*agcY*ttgF*gtgL:1*aacK:1*atgL*aacA*gctN*gctT*gcgQ*gagA*gttA*atcV*aagE*caaK:1*acaA*ttaD*cacL:1*acgE:1*ttgM*ctaS:1*agcR*aaaH*aacK:1*cagE*gacV*ttgQ*tcaE*cctG*attG*gacS:4*aagE:2*ttgI*gcaS*gcaC*tccA*attS:2*accI*aaaN:1*attV*tcgK*atgL:1*atcL*tctE:1*gccC:1*gatE*actA:1*catE:3*gcaS*aatR:4*agtL*acaS:2*caaL:15*gctS:1*gctQ:2*tctY:2*aacG*ttaI:2*caaR*actM:3*aatV:1*agtA:1*aagT:1*acaS*cacS:12*tctA:1*attA:3*gcaS*gctS*gcaS:3*gctS*acgD*cagL*ttcM:1*aagQ*actS*caaH*gacL:3*gatE:2*aagR:2*tctT*attS*gctS:2*agcM:2*agcT*caaK:1*caaR*gaaS:1*attL-aataaa*tctL:1*caaD*ttaE*gttS:1*gatK*gatT*attV:1*ttcY:1*aagQ:1*agtT*atcA*attH*gatE:2*aaaT*gaaA:1*atgL*aaaE:2*gcaV:2*atcL:3*aatS:2*ggtS*gctQ:6*gatE:3*tatF:2*caaR:1*gatE*gatE*gatS +CM143128.1 miniprot mRNA 2744264 2745682 770 - . ID=SS000070;Rank=7;Identity=0.3819;Positive=0.6118;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +CM143128.1 miniprot CDS 2744264 2745682 770 - 0 Parent=SS000070;Rank=7;Identity=0.3819;Target=460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved 1 440 +##PAF 28985_nrrl-y-1140_MATsc_MATa|gene_index=0|name=sla2|role=flanking_conserved 671 242 671 - CM143131.1 1178080 300671 303209 411 1389 0 AS:i:378 ms:i:404 np:i:212 fs:i:0 st:i:0 da:i:-1 do:i:15 cg:Z:45M15I16M11I5M8I10M13I12M5I34M2D25M3I40M18D6M4D41M9D10M1I25M1I11M10I17M1D33M1353U31M cs:Z::1*agaF*caaD:2*gatT*tctE:1*catC*caaA:2*tttN:3*gcgF:2*accN*agcT*cttV*cacQ*tatP:1*acgK*tctN:2*aacT:2*aaaT:1*acaP*accS*agtD:1*ccgM*gatS*ttgR*ctcI:2*gagD+EDDAEVNDVVFEKRS*aacK*acgS*ggtS*attV*cgtS*agaS*ccaL:1*accS*aagR*gcgT:1*gcgT*gcgR*aagE*agtN+LRDPSPVHEAP:1*acgV:1*agtR:1+AEVRSLSQ:1*ccaA*ccgA:1*ccaV*aagV*gaaP:2*agcT+GVVMPVVTGYSQP:2*atcQ*aatV*caaV:3*gttA:3+SIPST*aaaS:1*caaP*caaT*gacR*aatS:1*gaaV:1*gaaS*caaH*gaaD*agaD:1*gccL*agaI:1*agaQ*aatQ*gcgK:1*ctcQ*ttaQ*gcgI:2*gaaQ*gaaQ*caaY:1*aatL:1*caaL*gctE-gcattt*gagH:1*caaK:1*cgcL*gaaQ:3*cagE:2*atgA*gcaL*cagL:2*atgR*ctaI:2*tatQ*catE*acaM*caaE+KEA*gcgL*gctI:1*ggaQ*agaK*gtaT:1*gaaS:1*gaaQ*cgcN:1*ctaI*ttgM*gctS*ctaF:4*gatE*caaR:2*ttgV*ttgM:1*caaE:3*caaK:2*aaaQ*gttK:2*cagS:1-gcgatgaatgccaatcaagctgctactcaacagattgcattgaaagatgaaagt:1*aatE:2*caaK:1-caattgaacttg:2*agcE:2*gagQ:1*ataL:13*ttaI:1*caaK:1*ttcM:2*ttgT:1*caaD*aagD*gctL:1*tctE:1*cagE*gagS*gctE*attV*gatK-aagagagacaggattgagaaagatttg:1*gcgL:1*aatS*gttS*gaaA:1*gcaS*gatN*ttgV+G:1*aaaR*gaaN*cgtN*gacN*agaK*gctG*aggE*ttgS:1*attR*gacE*aagE*ttaA*agaK*gggD*tctR*aagS*gacG*tctM*ttgI*attL*gaaK*aaaS:1+V:1*gccS*gaaS*gttI*aatK*actS:1*aagQ:1*aagP*ttgI+ASLDVSDLAT:1*gtgL*acaS*gaaN*agaA*aacF*cagI*tcgD*tctG*aatD*ttgI:1*tccT:1*ttcV:1*gcaI-cac*cgaL*aaaP:1*atgF*gaaV*gaaS:1*gaaL*accL*aaaR*ttgC*aaaP*gaaQ*agaE*gaaM*tcgQ*caaT:1*tcaA:1*atgD*tcaF*ccaL*gagR*tcaC*aatL*gctS*gagS*ctaA*cagK*gaaQ:1*ttgD*cS~gt1350ag-aa*atcV:1*aagN*ttgA*gagN*aatI:1*ttaF*ggtQ*gctE*gctK*agaL:4*gatE:2*aaaQ:3*caaR*gatY*gatG:1*gatS:1*agcE*gatV +CM143131.1 miniprot mRNA 300672 303209 404 - . ID=SS000071;Rank=1;Identity=0.2959;Positive=0.4579;Target=28985_nrrl-y-1140_MATsc_MATa|gene_index=0|name=sla2|role=flanking_conserved 243 671 +CM143131.1 miniprot CDS 302117 303209 347 - 0 Parent=SS000071;Rank=1;Identity=0.2870;Target=28985_nrrl-y-1140_MATsc_MATa|gene_index=0|name=sla2|role=flanking_conserved 243 639 +CM143131.1 miniprot CDS 300672 300766 57 - 2 Parent=SS000071;Rank=1;Identity=0.4194;Target=28985_nrrl-y-1140_MATsc_MATa|gene_index=0|name=sla2|role=flanking_conserved 640 671 +##PAF 28985_nrrl-y-1140_MATsc_MATa|gene_index=0|name=sla2|role=flanking_conserved 671 237 671 - CM143128.1 3172219 2744254 2746810 417 1404 0 AS:i:386 ms:i:401 np:i:215 fs:i:0 st:i:0 da:i:-1 do:i:15 cg:Z:50M15I16M11I5M8I10M13I12M5I34M2D21M2I4M1I40M18D6M4D41M9D10M1I25M1I11M10I17M1D33M1356U31M cs:Z:*gagD:2*gaaS*cctG:1*agaF*caaD:2*gatT*tctE:1*catC*caaA:2*tttN:3*gcgF:2*accN*agcT*cttV*cacQ*tatP:1*acgK*tctN:2*aacT:2*aagT:1*acgP*accS*agtD:1*ccgM*gatS*ttgR*ctcI:2*gagD+EDDAEVNDVVFEKRS*aacK*acgS*ggtS*attV*cgtS*agaS*ccaL:1*accS*aagR*gcgT:1*gcgT*gcgR*aagE*agtN+LRDPSPVHEAP:1*acgV:1*agtR:1+AEVRSLSQ:1*ccaA*ccgA:1*ccaV*aagV*gaaP:2*agcT+GVVMPVVTGYSQP:2*atcQ*aatV*caaV:3*gttA:3+SIPST*aaaS:1*caaP*caaT*gacR*aatS:1*gaaV:1*gaaS*caaH*gaaD*agaD:1*gccL*agaI:1*agaQ*aatQ*gcgK:1*ctcQ*ttaQ*gcgI:2*gaaQ*gaaQ*caaY:1*aatL:1*caaL*gctE-gcattt*gagH:1*caaK:1*cgcL*gaaQ:3*cagE:2*atgA*gcaL*cagL:2*atgR*ctaI:2+QE*tatM*catE*acaK*caaE+A*gcgL*gctI:1*ggaQ*agaK*gtaT:1*gaaS:1*gaaQ*cgcN:1*ctaI*ttgM*gctS*ctaF:4*gatE*caaR:2*ttgV*ttgM:1*caaE:3*caaK:2*aaaQ*gttK:2*cagS:1-gcgatgaatgccaatcaagctgctactcaacagattgcattgaaagatgaaagt:1*aatE:2*caaK:1-caattgaacttg:2*agcE:2*gagQ:1*ataL:13*ttaI:1*caaK:1*ttcM:2*ttgT:1*caaD*aagD*gctL:1*tctE:1*cagE*gagS*gctE*attV*gatK-aagagagacaggattgagaaagatttg:1*gcgL:1*aatS*gttS*gaaA:1*gcaS*gatN*ttgV+G:1*aaaR*gaaN*cgtN*gacN*agaK*gctG*aggE*ttgS:1*attR*gacE*aagE*ttaA*agaK*gggD*tctR*aagS*gacG*tctM*ttgI*attL*gaaK*aaaS:1+V:1*gccS*gaaS*gttI*aatK*actS:1*aagQ:1*aagP*ttgI+ASLDVSDLAT:1*gtgL*acaS*gaaN*agaA*aacF*cagI*tcgD*tctG*aatD*ttgI:1*tccT:1*ttcV:1*gcaI-cac*cgaL*aaaP:1*atgF*gaaV*gaaS:1*gaaL*accL*aaaR*ttgC*aaaP*gaaQ*agaE*gaaM*tcgQ*caaT:1*tcaA:1*atgD*tcaF*ccaL*gagR*tcaC*aatL*gctS*gagS*ctaA*cagK*gaaQ:1*ttgD*cS~gt1353ag-aa*atcV:1*aagN*ttgA*gagN*aatI:1*ttaF*ggtQ*gctE*gctK*agaL:4*gatE:2*aaaQ:3*caaR*gatY*gatG:1*gatS:1*agcE*gatV +CM143128.1 miniprot mRNA 2744255 2746810 401 - . ID=SS000072;Rank=2;Identity=0.2970;Positive=0.4594;Target=28985_nrrl-y-1140_MATsc_MATa|gene_index=0|name=sla2|role=flanking_conserved 238 671 +CM143128.1 miniprot CDS 2745703 2746810 344 - 0 Parent=SS000072;Rank=2;Identity=0.2883;Target=28985_nrrl-y-1140_MATsc_MATa|gene_index=0|name=sla2|role=flanking_conserved 238 639 +CM143128.1 miniprot CDS 2744255 2744349 57 - 2 Parent=SS000072;Rank=2;Identity=0.4194;Target=28985_nrrl-y-1140_MATsc_MATa|gene_index=0|name=sla2|role=flanking_conserved 640 671 +##PAF 4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 119 0 109 + CM143131.1 1178080 298552 298870 111 333 0 AS:i:131 ms:i:131 np:i:57 fs:i:0 st:i:0 da:i:165 do:i:45 cg:Z:37M1D7M1D16M4I34M1I10M cs:Z:*caaM*aatR*agaS:1*actE*aggN*acgD*ttaR:2*gttY*cctQ*gttL*gttT*aaaQ*aacK*gacN*gagK*cctS:1*gagD*gaaG*gtcL*tcaV:2*ataV:3*tcaD*caaM:1*aaaN*cgtK:1*gacT-tac:1*gccP*ttaY:1*aaaG*tgcH:1-cat:1*aatT*actK:1*accN*agaV:1*aagI:2*caaS:1*tacF*aagA*ctaK*agtN+IENP*gacY*tttL*tcaD*aagT*gaaK*gcaG*attL:1*aagN*tttL*ctgM*aatK*gaaN*gtcT*aatS:1*gacS*gttR*gttI:8*aagR*aaaR:4*aaaT+I*gctT:1*agcA*aagP*ggtE*attL*atcA:1*gttL:1 +CM143131.1 miniprot mRNA 298553 298870 131 + . ID=SS000073;Rank=1;Identity=0.3333;Positive=0.5135;Target=4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 1 109 +CM143131.1 miniprot CDS 298553 298870 131 + 0 Parent=SS000073;Rank=1;Identity=0.3333;Target=4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 1 109 +##PAF 4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 119 0 109 + CM143129.1 2335549 470585 470903 111 333 0 AS:i:131 ms:i:131 np:i:57 fs:i:0 st:i:0 da:i:165 do:i:45 cg:Z:37M1D7M1D16M4I34M1I10M cs:Z:*caaM*aatR*agaS:1*actE*aggN*acgD*ttaR:2*gttY*cctQ*gttL*gttT*aaaQ*aacK*gacN*gagK*cctS:1*gagD*gaaG*gtcL*tcaV:2*ataV:3*tcaD*caaM:1*aaaN*cgtK:1*gacT-tac:1*gccP*ttaY:1*aaaG*tgcH:1-cat:1*aatT*actK:1*accN*agaV:1*aagI:2*caaS:1*tacF*aagA*ctaK*agtN+IENP*gacY*tttL*tcaD*aagT*gaaK*gcaG*attL:1*aagN*tttL*ctgM*aatK*gaaN*gtcT*aatS:1*gacS*gttR*gttI:8*aagR*aaaR:4*aaaT+I*gctT:1*agcA*aagP*ggtE*attL*atcA:1*gttL:1 +CM143129.1 miniprot mRNA 470586 470903 131 + . ID=SS000074;Rank=2;Identity=0.3333;Positive=0.5135;Target=4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 1 109 +CM143129.1 miniprot CDS 470586 470903 131 + 0 Parent=SS000074;Rank=2;Identity=0.3333;Target=4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 1 109 +##PAF 4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 119 0 109 + CM143128.1 3172219 2742111 2742429 111 333 0 AS:i:131 ms:i:131 np:i:57 fs:i:0 st:i:0 da:i:165 do:i:45 cg:Z:37M1D7M1D16M4I34M1I10M cs:Z:*caaM*aatR*agaS:1*actE*aggN*acgD*ttaR:2*gttY*cctQ*gttL*gttT*aaaQ*aacK*gacN*gagK*cctS:1*gagD*gaaG*gtcL*tcaV:2*ataV:3*tcaD*caaM:1*aaaN*cgtK:1*gacT-tac:1*gccP*ttaY:1*aaaG*tgcH:1-cat:1*aatT*actK:1*accN*agaV:1*aagI:2*caaS:1*tacF*aagA*ctaK*agtN+IENP*gacY*tttL*tcaD*aagT*gaaK*gcaG*attL:1*aagN*tttL*ctgM*aatK*gaaN*gtcT*aatS:1*gacS*gttR*gttI:8*aagR*aaaR:4*aaaT+I*gctT:1*agcA*aagP*ggtE*attL*atcA:1*gttL:1 +CM143128.1 miniprot mRNA 2742112 2742429 131 + . ID=SS000075;Rank=3;Identity=0.3333;Positive=0.5135;Target=4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 1 109 +CM143128.1 miniprot CDS 2742112 2742429 131 + 0 Parent=SS000075;Rank=3;Identity=0.3333;Target=4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 1 109 +##PAF 4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 119 0 109 - CM143127.1 3497966 502276 502594 111 333 0 AS:i:131 ms:i:131 np:i:57 fs:i:0 st:i:0 da:i:165 do:i:45 cg:Z:37M1D7M1D16M4I34M1I10M cs:Z:*caaM*aatR*agaS:1*actE*aggN*acgD*ttaR:2*gttY*cctQ*gttL*gttT*aaaQ*aacK*gacN*gagK*cctS:1*gagD*gaaG*gtcL*tcaV:2*ataV:3*tcaD*caaM:1*aaaN*cgtK:1*gacT-tac:1*gccP*ttaY:1*aaaG*tgcH:1-cat:1*aatT*actK:1*accN*agaV:1*aagI:2*caaS:1*tacF*aagA*ctaK*agtN+IENP*gacY*tttL*tcaD*aagT*gaaK*gcaG*attL:1*aagN*tttL*ctgM*aatK*gaaN*gtcT*aatS:1*gacS*gttR*gttI:8*aagR*aaaR:4*aaaT+I*gctT:1*agcA*aagP*ggtE*attL*atcA:1*gttL:1 +CM143127.1 miniprot mRNA 502277 502594 131 - . ID=SS000076;Rank=4;Identity=0.3333;Positive=0.5135;Target=4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 1 109 +CM143127.1 miniprot CDS 502277 502594 131 - 0 Parent=SS000076;Rank=4;Identity=0.3333;Target=4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 1 109 +##PAF 4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 119 0 109 + CM143126.1 1831595 1288416 1288734 111 333 0 AS:i:131 ms:i:131 np:i:57 fs:i:0 st:i:0 da:i:165 do:i:45 cg:Z:37M1D7M1D16M4I34M1I10M cs:Z:*caaM*aatR*agaS:1*actE*aggN*acgD*ttaR:2*gttY*cctQ*gttL*gttT*aaaQ*aacK*gacN*gagK*cctS:1*gagD*gaaG*gtcL*tcaV:2*ataV:3*tcaD*caaM:1*aaaN*cgtK:1*gacT-tac:1*gccP*ttaY:1*aaaG*tgcH:1-cat:1*aatT*actK:1*accN*agaV:1*aagI:2*caaS:1*tacF*aagA*ctaK*agtN+IENP*gacY*tttL*tcaD*aagT*gaaK*gcaG*attL:1*aagN*tttL*ctgM*aatK*gaaN*gtcT*aatS:1*gacS*gttR*gttI:8*aagR*aaaR:4*aaaT+I*gctT:1*agcA*aagP*ggtE*attL*atcA:1*gttL:1 +CM143126.1 miniprot mRNA 1288417 1288734 131 + . ID=SS000077;Rank=5;Identity=0.3333;Positive=0.5135;Target=4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 1 109 +CM143126.1 miniprot CDS 1288417 1288734 131 + 0 Parent=SS000077;Rank=5;Identity=0.3333;Target=4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 1 109 +##PAF 4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 119 0 109 - CM143130.1 2250200 2219135 2219453 111 333 0 AS:i:131 ms:i:131 np:i:57 fs:i:0 st:i:0 da:i:165 do:i:45 cg:Z:37M1D7M1D16M4I34M1I10M cs:Z:*caaM*aatR*agaS:1*accE*aggN*acgD*ttaR:2*gttY*cctQ*gttL*gttT*aaaQ*aacK*gacN*gagK*cctS:1*gagD*gaaG*gtcL*tcaV:2*ataV:3*tcaD*caaM:1*aaaN*cgtK:1*gacT-tac:1*gccP*ttaY:1*aaaG*tgcH:1-cat:1*aatT*actK:1*accN*agaV:1*aagI:2*caaS:1*tacF*aagA*ctaK*agtN+IENP*gacY*tttL*tcaD*aagT*gaaK*gcaG*attL:1*aagN*tttL*ctgM*aatK*gaaN*gtcT*aatS:1*gacS*gttR*gttI:8*aagR*aaaR:4*aaaT+I*gctT:1*agcA*aagP*ggtE*attL*atcA:1*gttL:1 +CM143130.1 miniprot mRNA 2219136 2219453 131 - . ID=SS000078;Rank=6;Identity=0.3333;Positive=0.5135;Target=4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 1 109 +CM143130.1 miniprot CDS 2219136 2219453 131 - 0 Parent=SS000078;Rank=6;Identity=0.3333;Target=4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT 1 109 +##PAF 4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 210 65 200 - CM143127.1 3497966 502276 502705 132 444 0 AS:i:140 ms:i:140 np:i:72 fs:i:0 st:i:0 da:i:54 do:i:45 cg:Z:33M11D30M1D7M1D16M4I34M1I10M cs:Z::3*tctD*cagE*aacE*aggK*acaK*tctL:1*ttgQ*tcgT*gttT*gctS*gatQ*ttcL*tgtT*gatT*atcT*ttgI*atcT*caaV:1*attL*ggcK:1*agaM*tatR*aacS*cttI*ttgE:2-attttttactgtcaaaatagaattactaggacg*ttaR:2*gttY*cctQ*gttL*gttT*aaaQ*aacK*gacN*gagK*cctS:1*gagD*gaaG*gtcL*tcaV:2*ataV:3*tcaD*caaM:1*aaaN*cgtK:1*gacT-tac:1*gccP*ttaY:1*aaaG*tgcH:1-cat:1*aatT*actK:1*accN*agaV:1*aagI:2*caaS:1*tacF*aagA*ctaK*agtN+IENP*gacY*tttL*tcaD*aagT*gaaK*gcaG*attL:1*aagN*tttL*ctgM*aatK*gaaN*gtcT*aatS:1*gacS*gttR*gttI:8*aagR*aaaR:4*aaaT+I*gctT:1*agcA*aagP*ggtE*attL*atcA:1*gttL:1 +CM143127.1 miniprot mRNA 502277 502705 140 - . ID=SS000079;Rank=1;Identity=0.2973;Positive=0.4865;Target=4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 66 200 +CM143127.1 miniprot CDS 502277 502705 140 - 0 Parent=SS000079;Rank=1;Identity=0.2973;Target=4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 66 200 +##PAF 4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 210 65 200 + CM143131.1 1178080 298441 298870 132 444 0 AS:i:140 ms:i:140 np:i:72 fs:i:0 st:i:0 da:i:54 do:i:45 cg:Z:33M11D30M1D7M1D16M4I34M1I10M cs:Z::3*tctD*cagE*aacE*aggK*acaK*tctL:1*ttgQ*tcgT*gttT*gctS*gatQ*ttcL*tgtT*gatT*atcT*ttgI*atcT*caaV:1*attL*ggcK:1*agaM*tatR*aatS*cttI*ttgE:2-attttttactgtcaaaatagaattactaggacg*ttaR:2*gttY*cctQ*gttL*gttT*aaaQ*aacK*gacN*gagK*cctS:1*gagD*gaaG*gtcL*tcaV:2*ataV:3*tcaD*caaM:1*aaaN*cgtK:1*gacT-tac:1*gccP*ttaY:1*aaaG*tgcH:1-cat:1*aatT*actK:1*accN*agaV:1*aagI:2*caaS:1*tacF*aagA*ctaK*agtN+IENP*gacY*tttL*tcaD*aagT*gaaK*gcaG*attL:1*aagN*tttL*ctgM*aatK*gaaN*gtcT*aatS:1*gacS*gttR*gttI:8*aagR*aaaR:4*aaaT+I*gctT:1*agcA*aagP*ggtE*attL*atcA:1*gttL:1 +CM143131.1 miniprot mRNA 298442 298870 140 + . ID=SS000080;Rank=2;Identity=0.2973;Positive=0.4865;Target=4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 66 200 +CM143131.1 miniprot CDS 298442 298870 140 + 0 Parent=SS000080;Rank=2;Identity=0.2973;Target=4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 66 200 +##PAF 4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 210 65 200 + CM143129.1 2335549 470474 470903 132 444 0 AS:i:140 ms:i:140 np:i:72 fs:i:0 st:i:0 da:i:54 do:i:45 cg:Z:33M11D30M1D7M1D16M4I34M1I10M cs:Z::3*tctD*cagE*aacE*aggK*acaK*tctL:1*ttgQ*tcgT*gttT*gctS*gatQ*ttcL*tgtT*gatT*atcT*ttgI*atcT*caaV:1*attL*ggcK:1*agaM*tatR*aatS*cttI*ttgE:2-attttttactgtcaaaatagaattactaggacg*ttaR:2*gttY*cctQ*gttL*gttT*aaaQ*aacK*gacN*gagK*cctS:1*gagD*gaaG*gtcL*tcaV:2*ataV:3*tcaD*caaM:1*aaaN*cgtK:1*gacT-tac:1*gccP*ttaY:1*aaaG*tgcH:1-cat:1*aatT*actK:1*accN*agaV:1*aagI:2*caaS:1*tacF*aagA*ctaK*agtN+IENP*gacY*tttL*tcaD*aagT*gaaK*gcaG*attL:1*aagN*tttL*ctgM*aatK*gaaN*gtcT*aatS:1*gacS*gttR*gttI:8*aagR*aaaR:4*aaaT+I*gctT:1*agcA*aagP*ggtE*attL*atcA:1*gttL:1 +CM143129.1 miniprot mRNA 470475 470903 140 + . ID=SS000081;Rank=3;Identity=0.2973;Positive=0.4865;Target=4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 66 200 +CM143129.1 miniprot CDS 470475 470903 140 + 0 Parent=SS000081;Rank=3;Identity=0.2973;Target=4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 66 200 +##PAF 4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 210 65 200 + CM143128.1 3172219 2742000 2742429 132 444 0 AS:i:140 ms:i:140 np:i:72 fs:i:0 st:i:0 da:i:54 do:i:45 cg:Z:33M11D30M1D7M1D16M4I34M1I10M cs:Z::3*tctD*cagE*aacE*aggK*acaK*tctL:1*ttgQ*tcgT*gttT*gctS*gatQ*ttcL*tgtT*gatT*atcT*ttgI*atcT*caaV:1*attL*ggcK:1*agaM*tatR*aacS*cttI*ttgE:2-attttttactgtcaaaatagaattactaggacg*ttaR:2*gttY*cctQ*gttL*gttT*aaaQ*aacK*gacN*gagK*cctS:1*gagD*gaaG*gtcL*tcaV:2*ataV:3*tcaD*caaM:1*aaaN*cgtK:1*gacT-tac:1*gccP*ttaY:1*aaaG*tgcH:1-cat:1*aatT*actK:1*accN*agaV:1*aagI:2*caaS:1*tacF*aagA*ctaK*agtN+IENP*gacY*tttL*tcaD*aagT*gaaK*gcaG*attL:1*aagN*tttL*ctgM*aatK*gaaN*gtcT*aatS:1*gacS*gttR*gttI:8*aagR*aaaR:4*aaaT+I*gctT:1*agcA*aagP*ggtE*attL*atcA:1*gttL:1 +CM143128.1 miniprot mRNA 2742001 2742429 140 + . ID=SS000082;Rank=4;Identity=0.2973;Positive=0.4865;Target=4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 66 200 +CM143128.1 miniprot CDS 2742001 2742429 140 + 0 Parent=SS000082;Rank=4;Identity=0.2973;Target=4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 66 200 +##PAF 4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 210 65 200 + CM143126.1 1831595 1288305 1288734 132 444 0 AS:i:140 ms:i:140 np:i:72 fs:i:0 st:i:0 da:i:54 do:i:45 cg:Z:33M11D30M1D7M1D16M4I34M1I10M cs:Z::3*tctD*cagE*aacE*aggK*acaK*tctL:1*ttgQ*tcgT*gttT*gctS*gatQ*ttcL*tgtT*gatT*atcT*ttgI*atcT*caaV:1*attL*ggcK:1*agaM*tatR*aacS*cttI*ttgE:2-attttttactgtcaaaatagaattactaggacg*ttaR:2*gttY*cctQ*gttL*gttT*aaaQ*aacK*gacN*gagK*cctS:1*gagD*gaaG*gtcL*tcaV:2*ataV:3*tcaD*caaM:1*aaaN*cgtK:1*gacT-tac:1*gccP*ttaY:1*aaaG*tgcH:1-cat:1*aatT*actK:1*accN*agaV:1*aagI:2*caaS:1*tacF*aagA*ctaK*agtN+IENP*gacY*tttL*tcaD*aagT*gaaK*gcaG*attL:1*aagN*tttL*ctgM*aatK*gaaN*gtcT*aatS:1*gacS*gttR*gttI:8*aagR*aaaR:4*aaaT+I*gctT:1*agcA*aagP*ggtE*attL*atcA:1*gttL:1 +CM143126.1 miniprot mRNA 1288306 1288734 140 + . ID=SS000083;Rank=5;Identity=0.2973;Positive=0.4865;Target=4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 66 200 +CM143126.1 miniprot CDS 1288306 1288734 140 + 0 Parent=SS000083;Rank=5;Identity=0.2973;Target=4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 66 200 +##PAF 4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 210 65 200 - CM143130.1 2250200 2219135 2219564 132 444 0 AS:i:140 ms:i:140 np:i:72 fs:i:0 st:i:0 da:i:54 do:i:45 cg:Z:33M11D30M1D7M1D16M4I34M1I10M cs:Z::3*tctD*cagE*aacE*aggK*acaK*tctL:1*ttgQ*tcgT*gttT*gctS*gatQ*ttcL*tgtT*gatT*atcT*ttgI*atcT*caaV:1*attL*ggcK:1*agaM*tatR*aacS*cttI*ttgE:2-attttttactgtcaaaatagaattaccaggacg*ttaR:2*gttY*cctQ*gttL*gttT*aaaQ*aacK*gacN*gagK*cctS:1*gagD*gaaG*gtcL*tcaV:2*ataV:3*tcaD*caaM:1*aaaN*cgtK:1*gacT-tac:1*gccP*ttaY:1*aaaG*tgcH:1-cat:1*aatT*actK:1*accN*agaV:1*aagI:2*caaS:1*tacF*aagA*ctaK*agtN+IENP*gacY*tttL*tcaD*aagT*gaaK*gcaG*attL:1*aagN*tttL*ctgM*aatK*gaaN*gtcT*aatS:1*gacS*gttR*gttI:8*aagR*aaaR:4*aaaT+I*gctT:1*agcA*aagP*ggtE*attL*atcA:1*gttL:1 +CM143130.1 miniprot mRNA 2219136 2219564 140 - . ID=SS000084;Rank=6;Identity=0.2973;Positive=0.4865;Target=4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 66 200 +CM143130.1 miniprot CDS 2219136 2219564 140 - 0 Parent=SS000084;Rank=6;Identity=0.2973;Target=4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT 66 200 +##PAF 4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 225 19 214 + CM143131.1 1178080 298318 298873 162 606 0 AS:i:104 ms:i:86 np:i:93 fs:i:0 st:i:0 da:i:3 do:i:42 cg:Z:27M2D12M1D44M4I1M1I3M2I21M3I4M2I11M4D10M4I34M1I11M cs:Z::1*tcaK:1*tccK:1*gtaI*tacN:1*agcK:2*tcgA*gagL*ctcC*acgS*gttK*gatL*tctP*attS*gtaE:1*aacE*aagQ*atgF:1*gtcK*aatD-gcaatc:1*caaA*aagE*gttL*gttE:3*aaaP*gaaS*tatL*tcgN-aaa:1*tccL*tctI*cagR*aacE*aggC*acaG:1*ttaS*ttgK*tcgE*gttD*gctQ*gatK*ttcM*tgtV*gatH*atcR*ttgI*atcH:2*attS*ggcS*gaaV*agaF*tatS*aatL:3*gacE*attV*tttS*tacE*tgtL*caaK*aatS*agaK*attR*actS*aggQ*acgF:1+RSKP*tcaK+Y*aacH*gttL:1+YA*gttA*gttA*aaaL*aacG*gacN*gagT*cctG*gcaK:1*gaaG*gtcM*tcaV:6*tcaD*caaT*ataL+NSA*aaaR:2*gacN+KT:1*aagR*gccG*ttaH:1*aaaL*tgcP*cgtK:1*ttcI*aatT-actgaaaccaga:1*aagL:2*caaS:1*tacF*aagN*ctaR*agtN+IEHP*gacY*tttL*tcaQ*aagT*gaaS*gcaS*attM*gaaK*aagE*tttL*ctgM*aatV:1*gtcT*aatK:1*gacS*gttG*gttP:8*aagR*aaaR:4*aaaS+L*gctT:2*aagF*ggtE*attV*atcS*gatE*gttL*ctgV:1 +CM143131.1 miniprot mRNA 298319 298873 86 + . ID=SS000085;Rank=1;Identity=0.2673;Positive=0.4604;Target=4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 20 214 +CM143131.1 miniprot CDS 298319 298873 86 + 0 Parent=SS000085;Rank=1;Identity=0.2673;Target=4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 20 214 +##PAF 4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 225 19 214 - CM143130.1 2250200 2219132 2219687 162 606 0 AS:i:104 ms:i:86 np:i:93 fs:i:0 st:i:0 da:i:3 do:i:42 cg:Z:27M2D12M1D44M4I1M1I3M2I21M3I4M2I11M4D10M4I34M1I11M cs:Z::1*tcaK:1*tccK:1*gtaI*tacN:1*agcK:2*tcgA*gagL*ctcC*acgS*gttK*gatL*tctP*attS*gtaE:1*aacE*aagQ*atgF:1*gtcK*aatD-gcaatc:1*caaA*aagE*gtcL*gttE:3*aaaP*gaaS*tatL*tcgN-aaa:1*tccL*tctI*cagR*aacE*aggC*acaG:1*ttaS*ttgK*tcgE*gttD*gctQ*gatK*ttcM*tgtV*gatH*atcR*ttgI*atcH:2*attS*ggcS*gaaV*agaF*tatS*aacL:3*gacE*attV*tttS*tacE*tgtL*caaK*aatS*agaK*attR*accS*aggQ*acgF:1+RSKP*tcaK+Y*aacH*gttL:1+YA*gttA*gttA*aaaL*aacG*gacN*gagT*cctG*gcaK:1*gaaG*gtcM*tcaV:6*tcaD*caaT*attL+NSA*aaaR:2*gacN+KT:1*aagR*gccG*ttaH:1*aaaL*tgcP*cgtK:1*ttcI*aatT-actgaaaccaga:1*aagL:2*caaS:1*tacF*aagN*ctaR*agtN+IEHP*gacY*tttL*tcaQ*aagT*gaaS*gcaS*attM*gaaK*aagE*tttL*ctgM*aatV:1*gtcT*aatK:1*gacS*gttG*gttP:8*aagR*aaaR:4*aaaS+L*gctT:2*aagF*ggtE*attV*atcS*gatE*gttL*ctgV:1 +CM143130.1 miniprot mRNA 2219133 2219687 86 - . ID=SS000086;Rank=2;Identity=0.2673;Positive=0.4604;Target=4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 20 214 +CM143130.1 miniprot CDS 2219133 2219687 86 - 0 Parent=SS000086;Rank=2;Identity=0.2673;Target=4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 20 214 +##PAF 4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 225 19 214 + CM143129.1 2335549 470351 470906 162 606 0 AS:i:104 ms:i:86 np:i:93 fs:i:0 st:i:0 da:i:3 do:i:42 cg:Z:27M2D12M1D44M4I1M1I3M2I21M3I4M2I11M4D10M4I34M1I11M cs:Z::1*tcaK:1*tccK:1*gtaI*tacN:1*agcK:2*tcgA*gagL*ctcC*acgS*gttK*gatL*tctP*attS*gtaE:1*aacE*aagQ*atgF:1*gtcK*aatD-gcaatc:1*caaA*aagE*gttL*gttE:3*aaaP*gaaS*tatL*tcgN-aaa:1*tccL*tctI*cagR*aacE*aggC*acaG:1*ttaS*ttgK*tcgE*gttD*gctQ*gatK*ttcM*tgtV*gatH*atcR*ttgI*atcH:2*attS*ggcS*gaaV*agaF*tatS*aatL:3*gacE*attV*tttS*tacE*tgtL*caaK*aatS*agaK*attR*actS*aggQ*acgF:1+RSKP*tcaK+Y*aacH*gttL:1+YA*gttA*gttA*aaaL*aacG*gacN*gagT*cctG*gcaK:1*gaaG*gtcM*tcaV:6*tcaD*caaT*ataL+NSA*aaaR:2*gacN+KT:1*aagR*gccG*ttaH:1*aaaL*tgcP*cgtK:1*ttcI*aatT-actgaaaccaga:1*aagL:2*caaS:1*tacF*aagN*ctaR*agtN+IEHP*gacY*tttL*tcaQ*aagT*gaaS*gcaS*attM*gaaK*aagE*tttL*ctgM*aatV:1*gtcT*aatK:1*gacS*gttG*gttP:8*aagR*aaaR:4*aaaS+L*gctT:2*aagF*ggtE*attV*atcS*gatE*gttL*ctgV:1 +CM143129.1 miniprot mRNA 470352 470906 86 + . ID=SS000087;Rank=3;Identity=0.2673;Positive=0.4604;Target=4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 20 214 +CM143129.1 miniprot CDS 470352 470906 86 + 0 Parent=SS000087;Rank=3;Identity=0.2673;Target=4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 20 214 +##PAF 4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 225 19 214 + CM143128.1 3172219 2741877 2742432 162 606 0 AS:i:104 ms:i:86 np:i:93 fs:i:0 st:i:0 da:i:3 do:i:42 cg:Z:27M2D12M1D44M4I1M1I3M2I21M3I4M2I11M4D10M4I34M1I11M cs:Z::1*tcaK:1*tccK:1*gtaI*tacN:1*agcK:2*tcgA*gagL*ctcC*acgS*gttK*gatL*tctP*attS*gtaE:1*aacE*aagQ*atgF:1*gtcK*aatD-gcaatc:1*caaA*aagE*gttL*gttE:3*aaaP*gaaS*tatL*tcgN-aaa:1*tccL*tctI*cagR*aacE*aggC*acaG:1*ttaS*ttgK*tcgE*gttD*gctQ*gatK*ttcM*tgtV*gatH*atcR*ttgI*atcH:2*attS*ggcS*gaaV*agaF*tatS*aacL:3*gacE*attV*tttS*tacE*tgtL*caaK*aatS*agaK*attR*actS*aggQ*acgF:1+RSKP*tcaK+Y*aacH*gttL:1+YA*gttA*gttA*aaaL*aacG*gacN*gagT*cctG*gcaK:1*gaaG*gtcM*tcaV:6*tcaD*caaT*ataL+NSA*aaaR:2*gacN+KT:1*aagR*gccG*ttaH:1*aaaL*tgcP*cgtK:1*ttcI*aatT-actgaaaccaga:1*aagL:2*caaS:1*tacF*aagN*ctaR*agtN+IEHP*gacY*tttL*tcaQ*aagT*gaaS*gcaS*attM*gaaK*aagE*tttL*ctgM*aatV:1*gtcT*aatK:1*gacS*gttG*gttP:8*aagR*aaaR:4*aaaS+L*gctT:2*aagF*ggtE*attV*atcS*gatE*gttL*ctgV:1 +CM143128.1 miniprot mRNA 2741878 2742432 86 + . ID=SS000088;Rank=4;Identity=0.2673;Positive=0.4604;Target=4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 20 214 +CM143128.1 miniprot CDS 2741878 2742432 86 + 0 Parent=SS000088;Rank=4;Identity=0.2673;Target=4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 20 214 +##PAF 4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 225 19 214 - CM143127.1 3497966 502273 502828 162 606 0 AS:i:104 ms:i:86 np:i:93 fs:i:0 st:i:0 da:i:3 do:i:42 cg:Z:27M2D12M1D44M4I1M1I3M2I21M3I4M2I11M4D10M4I34M1I11M cs:Z::1*tcaK:1*tccK:1*gtaI*tacN:1*agcK:2*tcgA*gagL*ctcC*acgS*gttK*gatL*tctP*attS*gtaE:1*aacE*aagQ*atgF:1*gtcK*aatD-gcaatc:1*caaA*aagE*gttL*gttE:3*aaaP*gaaS*tatL*tcgN-aaa:1*tccL*tctI*cagR*aacE*aggC*acaG:1*ttaS*ttgK*tcgE*gttD*gctQ*gatK*ttcM*tgtV*gatH*atcR*ttgI*atcH:2*attS*ggcS*gaaV*agaF*tatS*aacL:3*gacE*attV*tttS*tacE*tgtL*caaK*aatS*agaK*attR*actS*aggQ*acgF:1+RSKP*tcaK+Y*aacH*gttL:1+YA*gttA*gttA*aaaL*aacG*gacN*gagT*cctG*gcaK:1*gaaG*gtcM*tcaV:6*tcaD*caaT*ataL+NSA*aaaR:2*gacN+KT:1*aagR*gccG*ttaH:1*aaaL*tgcP*cgtK:1*ttcI*aatT-actgaaaccaga:1*aagL:2*caaS:1*tacF*aagN*ctaR*agtN+IEHP*gacY*tttL*tcaQ*aagT*gaaS*gcaS*attM*gaaK*aagE*tttL*ctgM*aatV:1*gtcT*aatK:1*gacS*gttG*gttP:8*aagR*aaaR:4*aaaS+L*gctT:2*aagF*ggtE*attV*atcS*gatE*gttL*ctgV:1 +CM143127.1 miniprot mRNA 502274 502828 86 - . ID=SS000089;Rank=5;Identity=0.2673;Positive=0.4604;Target=4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 20 214 +CM143127.1 miniprot CDS 502274 502828 86 - 0 Parent=SS000089;Rank=5;Identity=0.2673;Target=4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 20 214 +##PAF 4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 225 19 214 + CM143126.1 1831595 1288182 1288737 162 606 0 AS:i:104 ms:i:86 np:i:93 fs:i:0 st:i:0 da:i:3 do:i:42 cg:Z:27M2D12M1D44M4I1M1I3M2I21M3I4M2I11M4D10M4I34M1I11M cs:Z::1*tcaK:1*tccK:1*gtaI*tacN:1*agcK:2*tcgA*gagL*ctcC*acgS*gttK*gatL*tctP*attS*gtaE:1*aacE*aagQ*atgF:1*gtcK*aatD-gcaatc:1*caaA*aagE*gttL*gttE:3*aaaP*gaaS*tatL*tcgN-aaa:1*tccL*tctI*cagR*aacE*aggC*acaG:1*ttaS*ttgK*tcgE*gttD*gctQ*gatK*ttcM*tgtV*gatH*atcR*ttgI*atcH:2*attS*ggcS*gaaV*agaF*tatS*aacL:3*gacE*attV*tttS*tacE*tgtL*caaK*aatS*agaK*attR*actS*aggQ*acgF:1+RSKP*tcaK+Y*aacH*gttL:1+YA*gttA*gttA*aaaL*aacG*gacN*gagT*cctG*gcaK:1*gaaG*gtcM*tcaV:6*tcaD*caaT*ataL+NSA*aaaR:2*gacN+KT:1*aagR*gccG*ttaH:1*aaaL*tgcP*cgtK:1*ttcI*aatT-actgaaaccaga:1*aagL:2*caaS:1*tacF*aagN*ctaR*agtN+IEHP*gacY*tttL*tcaQ*aagT*gaaS*gcaS*attM*gaaK*aagE*tttL*ctgM*aatV:1*gtcT*aatK:1*gacS*gttG*gttP:8*aagR*aaaR:4*aaaS+L*gctT:2*aagF*ggtE*attV*atcS*gatE*gttL*ctgV:1 +CM143126.1 miniprot mRNA 1288183 1288737 86 + . ID=SS000090;Rank=6;Identity=0.2673;Positive=0.4604;Target=4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 20 214 +CM143126.1 miniprot CDS 1288183 1288737 86 + 0 Parent=SS000090;Rank=6;Identity=0.2673;Target=4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT 20 214 +##PAF 1173061_clib918_MATdc_A|gene_index=0|name=sla2|role=flanking_conserved 1064 208 1064 + CM143127.1 3497966 497868 500448 1260 2628 0 AS:i:1974 ms:i:1974 np:i:595 fs:i:0 st:i:0 da:i:-1 do:i:18 cg:Z:58M5I35M3I5M3I272M2I24M3I204M20D242M cs:Z::1*gctM*cgcH*agaA:2*agtN*tccD:1*gagD:6*caaS:2*gatY:6*tttL:3*gcgY:2*accS:2*cacK:4*ttgV:1*aacT:2*aagT:1*acaS*accQ*actD:2*gatN:1*ctcY*attG*gatE+NPEEG:1*aacA*acgP*ggtA*attL*cgtP*agaK*ccaR:1*accI*aagS*gcgE*ccgV:1*gcgS*aagL*agtA*ccaT*acgG:1*agtT*ccgT*ccaA:1*ccgS*ccaT*ccaT*aagD*gaaL*ataT*gcaP*aacE:1*ttaV*atcV+DFW*aatS*caaT:1*actQ:1+QQQ*gttL*gaaQ*ttcQ*tggQ*aaaQ*gctL:2*gacQ*aatQ*gtgY:1*gctE:2*gaaR:3*agaA*gaaQ:1*aatE:1*caaE:1*ttaQ*gcgQ:2*gaaM*gaaL*caaH*gctL*aatQ:2*gctQ*gcaQ:2*cagE:3*gaaM*ttgQ*cagA*caaE:2*cagR*atgL:2*caaE*caaA*atgL:1*caaR*caaD*tatQ*catY*acaQ*caaR*gcgQ:1*caaD:2*gtaA:6*ctaI:1*gctN:1*aagR*aacG:2*gatE*caaR:3*ttgM:1*caaE:3*caaR:3*gttG:2*cagG:1*gcgL*atgQ*aatQ*gccV*aatI*caaA*gctN*gctT*actN*caaL:1*attS*gcaQ*ttgS:2*gaaD*agtM*cttI*aatR:1*gtcL:3*ttgV:1*ttgS*ttcL:4*gagD*agcV*ataL:12*aatD*ttaK:1*caaK*aaaE*ttcL:1*aagL:1*caaK*caaV:9*gatE:2*gacE*aggK*attL:1*aaaR:1*ttgI:4*gttI:6*aaaR:6*ttgY*gagD*attL:2*ttaS:2*tctN*aagQ*gacK*tctD*ttgV:5*gccR*gaaQ*gttL*aatR*actL*ttgT*aagE:3*gatA*gtgD*acaA:2*aacS*cagK*tcgG*tctA*aatD:1*aacS*tccL*attL*ttcI*aacS*gcaK:1*cgaN*aaaR:1*atgL*gaaA*gaaD:2*accE*aaaA:2*gaaA*agaK*gaaQ:1*caaV*atcL*tcaD*gagN*atgY*tcaA*ccaN*gagR:1+FD*aatD*gctS*gagD:1*cagK*gaaL*acaK:1*cgtA:3*gagD:1*atcL:4*cagE:1*atgV:1*gatS+MEA:3*cagE*ttaM*gccS*gagL*tctN*aaaH*aggN:1*agcA*gaaD*gaaQ:1*atcL*gatE:4*acaE:2*caaK:2*atcL*atgS:2*gttN*gctS:4*attV:1*caaE:1*ggtS*gtgA*aaaE:1*atcV*gaaQ*gatE:4*cttF*gatE:1*tcgP:2*ggcA:5*tcaT:1*tcaE:3*accS:1*attV:3*ggcS*gaaT*acaS*agtA*caaT*gaaD:3*gctS:5*gctI:3*agcN:3*gctS*gagG:4*attA*tcaT*gaaI*ttcL*actS*ctgS*tgtV:1*acaP:2*gagL*ttgN:1*gttA:2*atcL*attT*aagR*tttL*tgcA*aagR*acaD*gagD*aatT*ttgV*gaaA*aacD*tcgN*ctaI*ttaI:1*tctY:3*gttA*ggtA*gagV*acaA*tgcV*attE*gaaD:1*ttgF*gaaS*gatG*ttaV*ttgQ:1*aagN*aatK:1*caaA*agcQ:2*gaaD:1*caaD:1*tcaT:4*gaaN*ggtF*gtcN*gttI*gaaD*atcV*catQ*gaaT*agaH:1*gaaQ*gaaS:1*actS*acaQ*ttgV*attS:1*actK*attL*gcaT*tctP*acgR*agcA:1*ggcT*ggcH*ggcL*ggcN:1*ggcS:1-ggcggtagcagcagcaacagcaacaacaagttcattgagatcgaaaaacaaacagaagag*gagD:1*gaaG*agcD:3*aacR:2*aacA*gctR:3*gttA:1*aagE*caaS:1*accN*ttaA*cacK:1*acgN*tcgE:2*accS*agcR*aaaP*aacK*ttaD*cagP*gacK*ttgF:1*cctV*attF:2*gaaK*gtcI*aatH*aagE:5*tccA:2*atcV:1*aaaT:2*tcgA*atgA:2*tctK:2*atcS:1*actC:1*catQ:4*aatQ:3*tcaA:3*gccT*caaA:4*aatH:12*gctS:2*tctA*gctS:2*ttaV:2*caaE:4*aatV:3*aagN*aatH:1*cacP:1*gaaQ:12*attA:5*gcaS:4*acgS*cagY*ttcM:5*aatR:2*gatG:3*aagA:1*tctT*attS:2*aagR:3*agcN:3*gaaD*ttgI*attL*aatS:1*tctK*acaQ:1*ttaK*gttE*aatE*gatN:1*attV:1*ttcY:3*agtT*atcP*attH*gatV*aatL*agaK*aaaT*gaaT:2*aaaE:2*gcaV:2*atcL:4*gccS:1*ggtN*gctS:6*gatE:6*caaV:2*gatE:1*gatE*agcE +CM143127.1 miniprot mRNA 497869 500448 1974 + . ID=SS000091;Rank=1;Identity=0.4795;Positive=0.6792;Target=1173061_clib918_MATdc_A|gene_index=0|name=sla2|role=flanking_conserved 209 1064 +CM143127.1 miniprot CDS 497869 500448 1974 + 0 Parent=SS000091;Rank=1;Identity=0.4795;Target=1173061_clib918_MATdc_A|gene_index=0|name=sla2|role=flanking_conserved 209 1064 +##PAF 1173061_clib918_MATdc_A|gene_index=0|name=sla2|role=flanking_conserved 1064 202 1064 - CM143128.1 3172219 2744257 2746855 1263 2646 0 AS:i:1977 ms:i:1967 np:i:597 fs:i:0 st:i:0 da:i:-1 do:i:18 cg:Z:62M4I2M1I35M3I5M3I272M2I24M3I204M20D242M cs:Z::1*gtaT:1*cctM*acaL*ttaR:1*gctM*cgcH*agaA:2*agtN*tccD:1*gagD:6*caaS:2*gatY:6*tttL:3*gcgY:2*accS:2*cacK:4*ttgV:1*aacT:2*aagT:1*acgS*accQ*agtD:2*gatN:1*ctcY+GENP*attE*gatE+G:1*aacA*acgP*ggtA*attL*cgtP*agaK*ccaR:1*accI*aagS*gcgE*ccgV:1*gcgS*aagL*agtA*ccaT*acgG:1*agtT*ccgT*ccaA:1*ccgS*ccaT*ccaT*aagD*gaaL*ataT*gcaP*agcE:1*ttaV*atcV+DFW*aatS*caaT:1*actQ:1+QQQ*gttL*gaaQ*ttcQ*tggQ*aaaQ*gctL:2*gacQ*aatQ*gtgY:1*gctE:2*gaaR:3*agaA*gaaQ:1*aatE:1*caaE:1*ttaQ*gcgQ:2*gaaM*gaaL*caaH*gctL*aatQ:2*gctQ*gcaQ:2*cagE:3*gaaM*ttgQ*cagA*caaE:2*cagR*atgL:2*caaE*caaA*atgL:1*caaR*caaD*tatQ*catY*acaQ*caaR*gcgQ:1*caaD:2*gtaA:6*ctaI:1*gctN:1*aagR*aacG:2*gatE*caaR:3*ttgM:1*caaE:3*caaR:3*gttG:2*cagG:1*gcgL*atgQ*aatQ*gccV*aatI*caaA*gctN*gctT*actN*caaL:1*attS*gcaQ*ttgS:2*gaaD*agtM*cttI*aatR:1*gtcL:3*ttgV:1*ttgS*ttcL:4*gagD*agcV*ataL:12*aatD*ttaK:1*caaK*aaaE*ttcL:1*aagL:1*caaK*caaV:9*gatE:2*gacE*aggK*attL:1*aaaR:1*ttgI:4*gttI:6*aaaR:6*ttgY*gagD*attL:2*ttaS:2*tctN*aagQ*gacK*tctD*ttgV:5*gccR*gaaQ*gttL*aatR*actL*ttgT*aagE:3*gatA*gtgD*acaA:2*aacS*cagK*tcgG*tctA*aatD:1*aacS*tccL*attL*ttcI*aacS*gcaK:1*cgaN*aaaR:1*atgL*gaaA*gaaD:2*accE*aaaA:2*gaaA*agaK*gaaQ:1*caaV*atcL*tcaD*gagN*atgY*tcaA*ccaN*gagR:1+FD*aatD*gctS*gagD:1*cagK*gaaL*acaK:1*cgtA:3*gagD:1*atcL:4*cagE:1*atgV:1*gatS+MEA:3*cagE*ttaM*gccS*gagL*tctN*aaaH*aggN:1*agcA*gaaD*gaaQ:1*atcL*gatE:4*acaE:2*caaK:2*atcL*atgS:2*gttN*gctS:4*attV:1*caaE:1*ggtS*gtgA*aaaE:1*atcV*gaaQ*gacE:4*cttF*gatE:1*tcgP:2*ggcA:5*tcaT:1*tcaE:3*accS:1*attV:3*ggcS*gaaT*acaS*agtA*caaT*gaaD:3*gctS:5*gctI:3*agcN:3*gctS*gagG:4*attA*tcaT*gaaI*ttcL*actS*ctgS*tgtV:1*acaP:2*gagL*ttgN:1*gttA:2*atcL*attT*aagR*tttL*tgcA*aagR*acaD*gagD*aatT*ttgV*gaaA*aacD*tcgN*ctaI*ttaI:1*tctY:3*gttA*ggtA*gagV*acaA*tgcV*attE*gaaD:1*ttgF*gaaS*gatG*ttaV*ttgQ:1*aagN*aatK:1*gaaA*agcQ:2*gaaD:1*caaD:1*tcaT:4*gaaN*ggtF*gtcN*gttI*gaaD*atcV*catQ*gaaT*agaH:1*gaaQ*gaaS:1*actS*acaQ*ttgV*attS:1*actK*attL*gcaT*tctP*acgR*agcA:1*ggcT*ggcH*ggcL*ggcN:1*ggcS:1-ggcagtagcagcagcaacagcaacaacaagttcattgagatcgaaaaacaaacagaagag*gagD:1*gaaG*agcD:3*aacR:2*aacA*gctR:3*gttA:1*aagE*caaS:1*acaN*ttaA*cacK:1*acgN*tcgE:2*accS*agcR*aaaP*aacK*ttaD*cagP*gacK*ttgF:1*cctV*attF:2*gaaK*gtcI*aatH*aagE:5*tccA:2*atcV:1*aaaT:2*tcgA*atgA:2*tctK:2*atcS:1*actC:1*catQ:4*aatQ:3*tcaA:1*acaS:1*gccT*caaA:4*aatH:12*gctS:2*tctA*gctS:2*ttaV:2*caaE:4*aatV:3*aagN*aatH:1*cacP:1*gaaQ:12*attA:5*gcaS:4*acgS*cagY*ttcM:5*aatR:2*gatG:3*aagA:1*tctT*attS:2*aagR:3*agcN:3*gaaD*ttgI*attL*aatS:1*tctK*acaQ:1*ttaK*gttE*aatE*gatN:1*attV:1*ttcY:3*agtT*atcP*attH*gatV*aatL*agaK*aaaT*gaaT:2*aaaE:2*gcaV:2*atcL:4*gccS:1*ggtN*gctS:6*gatE:6*caaV:2*gatE:1*gatE*agcE +CM143128.1 miniprot mRNA 2744258 2746855 1967 - . ID=SS000092;Rank=2;Identity=0.4773;Positive=0.6769;Target=1173061_clib918_MATdc_A|gene_index=0|name=sla2|role=flanking_conserved 203 1064 +CM143128.1 miniprot CDS 2744258 2746855 1967 - 0 Parent=SS000092;Rank=2;Identity=0.4773;Target=1173061_clib918_MATdc_A|gene_index=0|name=sla2|role=flanking_conserved 203 1064 +##PAF 4952_clib122_MATyl_B|gene_index=3|name=sla2|role=flanking_conserved 1053 216 1053 - CM143128.1 3172219 2744242 2746825 1113 2613 0 AS:i:1672 ms:i:1667 np:i:547 fs:i:0 st:i:0 da:i:-1 do:i:3 cg:Z:56M1I40M1I5M4I265M2D22M1I17M10D175M22D36M1I196M2I15M cs:Z:*actS:1*agtG*tccN:5*cctS:4*tatF*gatY:3*caaD:2*tttR*gagD:2*gcgY:2*accS*agcT:1*cacK:2*acgR:1*ttgI*atcV*aacT:2*aagQ:1*acgG*accK*agtN:2*gatN:2*attE*gatE:1*aacD+G*acgP:1*attL*cgtP*agaQ*ccaR:1*accK*aagS*gcgV*ccgA*gcgE*gcgT*aagR:1*ccaV*acgS*gcaP*agtE:1*ccaA:1*ccgL:1*ccaV*aagA*gaaT*ataP*gcaT*agcP*cctS*ttaI*atcP*aatA*caaE*cctA*actQ*gggP*gttI:1+N:2*aaaS*gctQ*caaD+ALLA:1*gacQ*aatQ*gtgY*gaaD:6*gccR*agaQ*gaaQ*agaQ*aatA*gcgM*caaE*ctcE*ttaE*gcgR*caaI*caaR*gaaQ*gaaM:1*gctM*aatQ:2*gctQ*gcaQ:2*cagM:3*gaaQ*ttgQ*cagM*caaE*cagA:2*atgR:2*caaE:1*atgL*ctaM*caaA*caaD*tatQ*catM*acaA*caaR*gcgH:4*gtaM:6*ctaI:3*aagR*aacG:7*ttgM:1*caaE:3*caaG:3*gttA:2*cagA:1*gcgL*atgN*aatQ*gccL*aatQ:1*gctT:1*actH:1*cagS*attA*gcaQ*ttgA:2*gaaD*agtL*cttI*aatE:1*gtcL:1*gaaQ:1*ttgI*aacT*ttgM*ttcW*aagR*agcQ:3*agcT*ataL:2*ttgR:2*caaS*ttgM:1*caaE:1*catY:1*aatA:2*caaK:1*ttcL:1*aagA*ttgT:7*cagK:3*gatE:1*agaA*gacE*aggK*attL:1*aaaR:1*ttgM*aagR*gcgH:2*gttI:13*ttgY*gagD*attL:1*aagR*ttaA*agaK:1*tctG*aagN*gacK*tctE*ttgD*attV:1*aaaR:2*gccR:1*gttL*aatR*actM*ttgA*aagQ:3*gatA*gtgD*acaK*gaaD:1*aacS*cagT*tcgG*tctA*aatD:1*aacS*tccL*attL*ttcL*aacS*gcaK:1*cgaN*aaaR:1*atgL*gaaS:3*accN*aaaA:2*gaaM*agaK*gaaQ*tcgR*caaA*atcL*tcaD:1*atgR*tcaG*ccaD*gagD:1-aatgct*gagD:1*cagL*gaaR*acaR:1*cgtE:2*gatE*gagI:1*atcY:1*attA:1*caaN*cagE*acaA*atgF*gatN*gatS+L:2*aaaH:1*ttaE*gccQ*gagQ*tctG*aaaN*aggN*gaaS*agcN*gaaG*gaaG*gctS*atcT*gatP-gaacaaattgatacagtgttacaagaacat*atcL*atgA*aagA:1*gttH*gctS:3*tctA*attL:1*caaE:2*gtgS*aaaQ:1*atcV*gaaQ:1*agtA:4*gatE:1*tcgP:2*ggcA:5*tcaT:1*tcaE:3*accS*attV:4*ggcS:1*acaS*agtA*caaS*gaaA:3*gctS:4*atcL:2*ggaE*ccaT*agcD:7*tctK:1*attV*tcaN*gaaI*ttcY*actS*ctgT*tgtA*attV*acaE*gatN:1*gagL*ttgS:1*gttS:2*atcL*attT*aagR*tttL*tgcA:1*acaD*gagD*aatA*ttgS*gaaA*aacD*tcgA:1*ttaV*tcaN*tctF:2*ttgE*gttS*ggtA:1*acaA*tgcT*attE*gaaR*tttN*ttgF*gaaI*gatG:3*aagE*aatI*ttaI:1*agcD*ttgF*agcP*gaaL*gaaD*caaD:1*tcaM*gacE*aaaR:2*gaaT*ggtL*gtcN*gttM*gaaN*atcV*catQ*gaaT*agaA:1*gaaQ*gaaH:2*acaK:1*attA:1*actR*attM:1*tctP*acgK*agcT*ggtN*ggcI*ggcN*ggcM*ggcS:1-ggcggtggcagtagcagcagcaacagcaacaacaagttcattgagatcgaaaaacaaacagaagag*gagD:1*gaaG*agcD:2*gacE*aacR:2*aacA*gctK:2*gagD*gttA:1*aagA*caaA:1*acaS*ttaA*cacK:1*acgG*tcgD:2*accK*agcF*aaaN*aacQ*ttaS*cagD*gacP:1+K:1*cctT*attT:2*gaaQ*gtcL*aatH*aagE:1*attA*ttgI*gcaQ:1*tccA*attQ:1*atcV*accI*aaaN:2*tcgA*atgA:2*tctR:2*atcT:1*actA:1*catN:4*aatQ:1*aaaR:1*tcaT:1*acaS:9*agaK:10*gctS:2*tctA*gctS:2*ttaI:2*caaE*actK:3*aatT:1*agtR*ggtR*aagT*aatS*acaG*cacL:8*gaaN:2*tctA:2*attA:5*gcaS:5*cagF*ttcM:5*aatK:2*gatE*gcaC:2*aagV:1*tctT*attS:2*aagR*agcN:2*agcK:4*ttgI*attL:2*tctK*acaF*caaG*ttaE*gttL*aatD*gatE*gatK*attV:1*ttcY*tccA*aagA:2*atcK*attH*gatE*aatF*agaK*aaaT*gaaT:2*aaaE:2*gcaV:2*atcL:4*gccD:1*ggtQ*gctG:6*gatQ*attM:2+VA:1*agtL*tatH:2*gatE*gatE*gatE*gatS*agcI*gatP*aatG*gatQ:1*gaaD +CM143128.1 miniprot mRNA 2744243 2746825 1667 - . ID=SS000093;Rank=1;Identity=0.4259;Positive=0.6280;Target=4952_clib122_MATyl_B|gene_index=3|name=sla2|role=flanking_conserved 217 1053 +CM143128.1 miniprot CDS 2744243 2746825 1667 - 0 Parent=SS000093;Rank=1;Identity=0.4259;Target=4952_clib122_MATyl_B|gene_index=3|name=sla2|role=flanking_conserved 217 1053 +##PAF 4952_clib122_MATyl_B|gene_index=3|name=sla2|role=flanking_conserved 1053 216 1053 + CM143127.1 3497966 497880 500463 1113 2613 0 AS:i:1670 ms:i:1665 np:i:546 fs:i:0 st:i:0 da:i:-1 do:i:3 cg:Z:56M1I40M1I5M4I265M2D22M1I17M10D175M22D36M1I196M2I15M cs:Z:*actS:1*agtG*tccN:5*cctS:4*tatF*gatY:3*caaD:2*tttR*gagD:2*gcgY:2*accS*agcT:1*cacK:2*acgR:1*ttgI*atcV*aacT:2*aagQ:1*acaG*accK*actN:2*gatN:2*attE*gatE:1*aacD+G*acgP:1*attL*cgtP*agaQ*ccaR:1*accK*aagS*gcgV*ccgA*gcgE*gcgT*aagR:1*ccaV*acgS*gcaP*agtE:1*ccaA:1*ccgL:1*ccaV*aagA*gaaT*ataP*gcaT*aacP*cctS*ttaI*atcP*aatA*caaE*cccA*actQ*gggP*gttI:1+N:2*aaaS*gctQ*caaD+ALLA:1*gacQ*aatQ*gtgY*gaaD:6*gccR*agaQ*gaaQ*agaQ*aatA*gcgM*caaE*ctcE*ttaE*gcgR*caaI*caaR*gaaQ*gaaM:1*gctM*aatQ:2*gctQ*gcaQ:2*cagM:3*gaaQ*ttgQ*cagM*caaE*cagA:2*atgR:2*caaE:1*atgL*ctaM*caaA*caaD*tatQ*catM*acaA*caaR*gcgH:4*gtaM:6*ctaI:3*aagR*aacG:7*ttgM:1*caaE:3*caaG:3*gttA:2*cagA:1*gcgL*atgN*aatQ*gccL*aatQ:1*gctT:1*actH:1*cagS*attA*gcaQ*ttgA:2*gaaD*agtL*cttI*aatE:1*gtcL:1*gaaQ:1*ttgI*aacT*ttgM*ttcW*aagR*agcQ:3*agcT*ataL:2*ttgR:2*caaS*ttgM:1*caaE:1*catY:1*aatA:2*caaK:1*ttcL:1*aagA*ttgT:7*cagK:3*gatE:1*agaA*gacE*aggK*attL:1*aaaR:1*ttgM*aagR*gcgH:2*gttI:13*ttgY*gagD*attL:1*aagR*ttaA*agaK:1*tctG*aagN*gacK*tctE*ttgD*attV:1*aaaR:2*gccR:1*gttL*aatR*actM*ttgA*aagQ:3*gatA*gtgD*acaK*gaaD:1*aacS*cagT*tcgG*tctA*aatD:1*aacS*tccL*attL*ttcL*aacS*gcaK:1*cgaN*aaaR:1*atgL*gaaS:3*accN*aaaA:2*gaaM*agaK*gaaQ*tcgR*caaA*atcL*tcaD:1*atgR*tcaG*ccaD*gagD:1-aatgct*gagD:1*cagL*gaaR*acaR:1*cgtE:2*gatE*gagI:1*atcY:1*attA:1*caaN*cagE*acaA*atgF*gatN*gatS+L:2*aaaH:1*ttaE*gccQ*gagQ*tctG*aaaN*aggN*gaaS*agcN*gaaG*gaaG*gctS*atcT*gatP-gaacaaattgatacagtgttacaagaacat*atcL*atgA*aagA:1*gttH*gctS:3*tctA*attL:1*caaE:2*gtgS*aaaQ:1*atcV*gaaQ:1*agtA:4*gatE:1*tcgP:2*ggcA:5*tcaT:1*tcaE:3*accS*attV:4*ggcS:1*acaS*agtA*caaS*gaaA:3*gctS:4*atcL:2*ggaE*ccaT*agcD:7*tctK:1*attV*tcaN*gaaI*ttcY*actS*ctgT*tgtA*attV*acaE*gatN:1*gagL*ttgS:1*gttS:2*atcL*attT*aagR*tttL*tgcA:1*acaD*gagD*aatA*ttgS*gaaA*aacD*tcgA:1*ttaV*tcaN*tctF:2*ttgE*gttS*ggtA:1*acaA*tgcT*attE*gaaR*tttN*ttgF*gaaI*gatG:3*aagE*aatI*ttaI*caaE*agcD*ttgF*agcP*gaaL*gaaD*caaD:1*tcaM*gacE*aaaR:2*gaaT*ggtL*gtcN*gttM*gaaN*atcV*catQ*gaaT*agaA:1*gaaQ*gaaH:2*acaK:1*attA:1*actR*attM:1*tctP*acgK*agcT*ggtN*ggcI*ggcN*ggcM*ggcS:1-ggcggtggcggtagcagcagcaacagcaacaacaagttcattgagatcgaaaaacaaacagaagag*gagD:1*gaaG*agcD:2*gacE*aacR:2*aacA*gctK:2*gagD*gttA:1*aagA*caaA:1*accS*ttaA*cacK:1*acgG*tcgD:2*accK*agcF*aaaN*aacQ*ttaS*cagD*gacP:1+K:1*cctT*attT:2*gaaQ*gtcL*aatH*aagE:1*attA*ttgI*gcaQ:1*tccA*attQ:1*atcV*accI*aaaN:2*tcgA*atgA:2*tctR:2*atcT:1*actA:1*catN:4*aatQ:1*aaaR:1*tcaT:11*agaK:10*gctS:2*tctA*gctS:2*ttaI:2*caaE*actK:3*aatT:1*agtR*ggtR*aagT*aatS*acaG*cacL:8*gaaN:2*tctA:2*attA:5*gcaS:5*cagF*ttcM:5*aatK:2*gatE*gcaC:2*aagV:1*tctT*attS:2*aagR*agcN:2*agcK:4*ttgI*attL:2*tctK*acaF*caaG*ttaE*gttL*aatD*gatE*gatK*attV:1*ttcY*tccA*aagA:2*atcK*attH*gatE*aatF*agaK*aaaT*gaaT:2*aaaE:2*gcaV:2*atcL:4*gccD:1*ggtQ*gctG:6*gatQ*attM:2+VA:1*agtL*tatH:2*gatE*gatE*gatE*gatS*agcI*gatP*aatG*gatQ:1*gaaD +CM143127.1 miniprot mRNA 497881 500463 1665 + . ID=SS000094;Rank=2;Identity=0.4259;Positive=0.6269;Target=4952_clib122_MATyl_B|gene_index=3|name=sla2|role=flanking_conserved 217 1053 +CM143127.1 miniprot CDS 497881 500463 1665 + 0 Parent=SS000094;Rank=2;Identity=0.4259;Target=4952_clib122_MATyl_B|gene_index=3|name=sla2|role=flanking_conserved 217 1053 +##PAF 4952_w29_MATyl_A|gene_index=0|name=sla2|role=flanking_conserved 1054 216 1054 - CM143128.1 3172219 2744242 2746825 1110 2616 0 AS:i:1660 ms:i:1655 np:i:545 fs:i:0 st:i:0 da:i:-1 do:i:3 cg:Z:56M1I40M1I5M4I265M2D22M1I17M10D175M22D35M2I197M2I15M cs:Z:*actS:1*agtG*tccN:5*cctS:4*tatF*gatY:3*caaD:2*tttR*gagD:2*gcgY:2*accS*agcT:1*cacK:2*acgR:1*ttgI*atcV*aacT:2*aagQ:1*acgG*accK*agtN:2*gatN:2*attE*gatE:1*aacD+G*acgP:1*attL*cgtP*agaQ*ccaR:1*accK*aagS*gcgV*ccgA*gcgE*gcgT*aagR:1*ccaV*acgS*gcaP*agtE:1*ccaA:1*ccgL:1*ccaV*aagA*gaaT*ataP*gcaT*agcP*cctS*ttaI*atcP*aatA*caaE*cctA*actQ*gggP*gttI:1+N:2*aaaS*gctQ*caaD+ALLA:1*gacQ*aatQ*gtgY*gaaD:6*gccR*agaQ*gaaQ*agaQ*aatA*gcgM*caaE*ctcE*ttaE*gcgR*caaI*caaR*gaaQ*gaaM:1*gctM*aatQ:2*gctQ*gcaQ:2*cagM:3*gaaQ*ttgQ*cagM*caaE*cagA:2*atgR:2*caaE:1*atgL*ctaM*caaA*caaD*tatQ*catM*acaA*caaR*gcgH:4*gtaM:6*ctaI:3*aagR*aacG:7*ttgM:1*caaE:3*caaG:3*gttA:2*cagA:1*gcgL*atgN*aatQ*gccL*aatQ:1*gctT:1*actH:1*cagS*attA*gcaQ*ttgA:2*gaaD*agtL*cttI*aatE:1*gtcL:1*gaaQ:1*ttgI*aacT*ttgM*ttcW*aagR*agcQ:3*agcT*ataL:2*ttgR:2*caaS*ttgM:1*caaE:1*catY:1*aatA:2*caaK:1*ttcL:1*aagA*ttgT:7*cagK:3*gatE:1*agaA*gacE*aggK*attM:1*aaaR:1*ttgM*aagR*gcgH:2*gttI:13*ttgY*gagD*attL:1*aagR*ttaA*agaK:1*tctG*aagN*gacK*tctE*ttgD*attV:1*aaaR:2*gccR:1*gttL*aatR*actM*ttgA*aagQ:3*gatA*gtgD*acaK*gaaD:1*aacS*cagT*tcgG*tctA*aatD:1*aacS*tccL*attL*ttcL*aacS*gcaK:1*cgaN*aaaR:1*atgL*gaaS:3*accN*aaaA:2*gaaM*agaK*gaaQ*tcgR*caaA*atcL*tcaD:1*atgR*tcaG*ccaD*gagD:1-aatgct*gagD:1*cagL*gaaR*acaR:1*cgtE:2*gatE*gagI:1*atcY:1*attA:1*caaN*cagE*acaA*atgF*gatN*gatS+L:2*aaaH:1*ttaE*gccQ*gagQ*tctG*aaaN*aggN*gaaS*agcN*gaaG*gaaG*gctS*atcT*gatP-gaacaaattgatacagtgttacaagaacat*atcL*atgA*aagA:1*gttH*gctS:3*tctA*attL:1*caaE:2*gtgS*aaaQ:1*atcV*gaaQ:1*agtA:4*gatE:1*tcgP:2*ggcA:5*tcaT:1*tcaE:3*accS*attV:4*ggcS:1*acaS*agtA*caaS*gaaA:3*gctS:4*atcL:2*ggaE*ccaT*agcD:7*tctK:1*attV*tcaN*gaaI*ttcY*actS*ctgT*tgtA*attV*acaE*gatN:1*gagL*ttgS:1*gttS:2*atcL*attT*aagR*tttL*tgcA:1*acaD*gagD*aatA*ttgS*gaaA*aacD*tcgA:1*ttaV*tcaN*tctF:2*ttgE*gttS*ggtA:1*acaA*tgcT*attE*gaaR*tttN*ttgF*gaaI*gatG:3*aagE*aatI*ttaI:1*agcD*ttgF*agcP*gaaL*gaaD*caaD:1*tcaM*gacE*aaaR:2*gaaT*ggtL*gtcN*gttM*gaaN*atcV*catQ*gaaT*agaA:1*gaaQ*gaaH:2*acaK:1*attA:1*actR*attM:1*tctP*acgK*agcT*ggtN*ggcI*ggcN*ggcM*ggcS:1-ggcggtggcagtagcagcagcaacagcaacaacaagttcattgagatcgaaaaacaaacagaagag*gagD:1*gaaG*agcD:2*gacE*aacR:2*aacA*gctK:2*gagD*gttA:1*aagA*caaA:1*acaA*ttaS*cacA*ttgK*acgL*tcgG*ttgD:1*accL*agcK*aaaF:1*ttaQ*cagS:1+PL*ttgK:1*cctT*attT:2*gaaQ*gtcL*aatH*aagE:1*attA*ttgI*gcaQ:1*tccA*attQ:1*atcV*accI*aaaN:2*tcgA*atgA:2*tctR:2*atcT:1*actA:1*catN:4*aatQ:1*aaaR:1*tcaT:1*acaS:9*agaK:10*gctS:2*tctA*gctS:2*ttaI:2*caaE*actK:3*aatT:1*agtR*ggtR*aagT*aatS*acaG*cacL:8*gaaN:2*tctA:2*attA:5*gcaS:5*cagF*ttcM:5*aatK:2*gatE*gcaC:2*aagV:1*tctT*attS:2*aagR*agcN:2*agcK:4*ttgI*attL:2*tctK*acaF*caaG*ttaE*gttL*aatD*gatE*gatK*attV:1*ttcY*tccA*aagA:2*atcK*attH*gatE*aatF*agaK*aaaT*gaaT:2*aaaE:2*gcaV:2*atcL:4*gccD:1*ggtQ*gctG:6*gatQ*attM:2+VA:1*agtL*tatH:2*gatE*gatE*gatE*gatS*agcI*gatP*aatG*gatQ:1*gaaD +CM143128.1 miniprot mRNA 2744243 2746825 1655 - . ID=SS000095;Rank=1;Identity=0.4243;Positive=0.6250;Target=4952_w29_MATyl_A|gene_index=0|name=sla2|role=flanking_conserved 217 1054 +CM143128.1 miniprot CDS 2744243 2746825 1655 - 0 Parent=SS000095;Rank=1;Identity=0.4243;Target=4952_w29_MATyl_A|gene_index=0|name=sla2|role=flanking_conserved 217 1054 +##PAF 4952_w29_MATyl_A|gene_index=0|name=sla2|role=flanking_conserved 1054 216 1054 + CM143127.1 3497966 497880 500463 1110 2616 0 AS:i:1658 ms:i:1653 np:i:544 fs:i:0 st:i:0 da:i:-1 do:i:3 cg:Z:56M1I40M1I5M4I265M2D22M1I17M10D175M22D35M2I197M2I15M cs:Z:*actS:1*agtG*tccN:5*cctS:4*tatF*gatY:3*caaD:2*tttR*gagD:2*gcgY:2*accS*agcT:1*cacK:2*acgR:1*ttgI*atcV*aacT:2*aagQ:1*acaG*accK*actN:2*gatN:2*attE*gatE:1*aacD+G*acgP:1*attL*cgtP*agaQ*ccaR:1*accK*aagS*gcgV*ccgA*gcgE*gcgT*aagR:1*ccaV*acgS*gcaP*agtE:1*ccaA:1*ccgL:1*ccaV*aagA*gaaT*ataP*gcaT*aacP*cctS*ttaI*atcP*aatA*caaE*cccA*actQ*gggP*gttI:1+N:2*aaaS*gctQ*caaD+ALLA:1*gacQ*aatQ*gtgY*gaaD:6*gccR*agaQ*gaaQ*agaQ*aatA*gcgM*caaE*ctcE*ttaE*gcgR*caaI*caaR*gaaQ*gaaM:1*gctM*aatQ:2*gctQ*gcaQ:2*cagM:3*gaaQ*ttgQ*cagM*caaE*cagA:2*atgR:2*caaE:1*atgL*ctaM*caaA*caaD*tatQ*catM*acaA*caaR*gcgH:4*gtaM:6*ctaI:3*aagR*aacG:7*ttgM:1*caaE:3*caaG:3*gttA:2*cagA:1*gcgL*atgN*aatQ*gccL*aatQ:1*gctT:1*actH:1*cagS*attA*gcaQ*ttgA:2*gaaD*agtL*cttI*aatE:1*gtcL:1*gaaQ:1*ttgI*aacT*ttgM*ttcW*aagR*agcQ:3*agcT*ataL:2*ttgR:2*caaS*ttgM:1*caaE:1*catY:1*aatA:2*caaK:1*ttcL:1*aagA*ttgT:7*cagK:3*gatE:1*agaA*gacE*aggK*attM:1*aaaR:1*ttgM*aagR*gcgH:2*gttI:13*ttgY*gagD*attL:1*aagR*ttaA*agaK:1*tctG*aagN*gacK*tctE*ttgD*attV:1*aaaR:2*gccR:1*gttL*aatR*actM*ttgA*aagQ:3*gatA*gtgD*acaK*gaaD:1*aacS*cagT*tcgG*tctA*aatD:1*aacS*tccL*attL*ttcL*aacS*gcaK:1*cgaN*aaaR:1*atgL*gaaS:3*accN*aaaA:2*gaaM*agaK*gaaQ*tcgR*caaA*atcL*tcaD:1*atgR*tcaG*ccaD*gagD:1-aatgct*gagD:1*cagL*gaaR*acaR:1*cgtE:2*gatE*gagI:1*atcY:1*attA:1*caaN*cagE*acaA*atgF*gatN*gatS+L:2*aaaH:1*ttaE*gccQ*gagQ*tctG*aaaN*aggN*gaaS*agcN*gaaG*gaaG*gctS*atcT*gatP-gaacaaattgatacagtgttacaagaacat*atcL*atgA*aagA:1*gttH*gctS:3*tctA*attL:1*caaE:2*gtgS*aaaQ:1*atcV*gaaQ:1*agtA:4*gatE:1*tcgP:2*ggcA:5*tcaT:1*tcaE:3*accS*attV:4*ggcS:1*acaS*agtA*caaS*gaaA:3*gctS:4*atcL:2*ggaE*ccaT*agcD:7*tctK:1*attV*tcaN*gaaI*ttcY*actS*ctgT*tgtA*attV*acaE*gatN:1*gagL*ttgS:1*gttS:2*atcL*attT*aagR*tttL*tgcA:1*acaD*gagD*aatA*ttgS*gaaA*aacD*tcgA:1*ttaV*tcaN*tctF:2*ttgE*gttS*ggtA:1*acaA*tgcT*attE*gaaR*tttN*ttgF*gaaI*gatG:3*aagE*aatI*ttaI*caaE*agcD*ttgF*agcP*gaaL*gaaD*caaD:1*tcaM*gacE*aaaR:2*gaaT*ggtL*gtcN*gttM*gaaN*atcV*catQ*gaaT*agaA:1*gaaQ*gaaH:2*acaK:1*attA:1*actR*attM:1*tctP*acgK*agcT*ggtN*ggcI*ggcN*ggcM*ggcS:1-ggcggtggcggtagcagcagcaacagcaacaacaagttcattgagatcgaaaaacaaacagaagag*gagD:1*gaaG*agcD:2*gacE*aacR:2*aacA*gctK:2*gagD*gttA:1*aagA*caaA:1*accA*ttaS*cacA*ttgK*acgL*tcgG*ttgD:1*accL*agcK*aaaF:1*ttaQ*cagS:1+PL*ttgK:1*cctT*attT:2*gaaQ*gtcL*aatH*aagE:1*attA*ttgI*gcaQ:1*tccA*attQ:1*atcV*accI*aaaN:2*tcgA*atgA:2*tctR:2*atcT:1*actA:1*catN:4*aatQ:1*aaaR:1*tcaT:11*agaK:10*gctS:2*tctA*gctS:2*ttaI:2*caaE*actK:3*aatT:1*agtR*ggtR*aagT*aatS*acaG*cacL:8*gaaN:2*tctA:2*attA:5*gcaS:5*cagF*ttcM:5*aatK:2*gatE*gcaC:2*aagV:1*tctT*attS:2*aagR*agcN:2*agcK:4*ttgI*attL:2*tctK*acaF*caaG*ttaE*gttL*aatD*gatE*gatK*attV:1*ttcY*tccA*aagA:2*atcK*attH*gatE*aatF*agaK*aaaT*gaaT:2*aaaE:2*gcaV:2*atcL:4*gccD:1*ggtQ*gctG:6*gatQ*attM:2+VA:1*agtL*tatH:2*gatE*gatE*gatE*gatS*agcI*gatP*aatG*gatQ:1*gaaD +CM143127.1 miniprot mRNA 497881 500463 1653 + . ID=SS000096;Rank=2;Identity=0.4243;Positive=0.6239;Target=4952_w29_MATyl_A|gene_index=0|name=sla2|role=flanking_conserved 217 1054 +CM143127.1 miniprot CDS 497881 500463 1653 + 0 Parent=SS000096;Rank=2;Identity=0.4243;Target=4952_w29_MATyl_A|gene_index=0|name=sla2|role=flanking_conserved 217 1054 diff --git a/results/2026-10-29_ss_records/data/stringtie.gtf b/results/2026-10-29_ss_records/data/stringtie.gtf new file mode 100644 index 00000000..043f2429 --- /dev/null +++ b/results/2026-10-29_ss_records/data/stringtie.gtf @@ -0,0 +1,7291 @@ +# stringtie all.bam -p 8 -o stringtie.gtf -l SS +# StringTie version 3.0.3 +CM143126.1 StringTie transcript 14465 15522 1000 . . gene_id "SS.1"; transcript_id "SS.1.1"; cov "13.607750"; FPKM "0.665480"; TPM "1.423027"; +CM143126.1 StringTie exon 14465 15522 1000 . . gene_id "SS.1"; transcript_id "SS.1.1"; exon_number "1"; cov "13.607751"; +CM143126.1 StringTie transcript 17138 17918 1000 . . gene_id "SS.2"; transcript_id "SS.2.1"; cov "28.411012"; FPKM "1.389426"; TPM "2.971075"; +CM143126.1 StringTie exon 17138 17918 1000 . . gene_id "SS.2"; transcript_id "SS.2.1"; exon_number "1"; cov "28.411011"; +CM143126.1 StringTie transcript 2134 2476 1000 . . gene_id "SS.3"; transcript_id "SS.3.1"; cov "341.635887"; FPKM "16.707532"; TPM "35.726497"; +CM143126.1 StringTie exon 2134 2476 1000 . . gene_id "SS.3"; transcript_id "SS.3.1"; exon_number "1"; cov "341.635895"; +CM143126.1 StringTie transcript 3184 6792 1000 . . gene_id "SS.4"; transcript_id "SS.4.1"; cov "51.957368"; FPKM "2.540949"; TPM "5.433430"; +CM143126.1 StringTie exon 3184 6792 1000 . . gene_id "SS.4"; transcript_id "SS.4.1"; exon_number "1"; cov "51.957367"; +CM143126.1 StringTie transcript 7034 9910 1000 . . gene_id "SS.5"; transcript_id "SS.5.1"; cov "13.845683"; FPKM "0.677116"; TPM "1.447909"; +CM143126.1 StringTie exon 7034 9910 1000 . . gene_id "SS.5"; transcript_id "SS.5.1"; exon_number "1"; cov "13.845683"; +CM143126.1 StringTie transcript 10994 12244 1000 . . gene_id "SS.6"; transcript_id "SS.6.1"; cov "19.924161"; FPKM "0.974381"; TPM "2.083565"; +CM143126.1 StringTie exon 10994 12244 1000 . . gene_id "SS.6"; transcript_id "SS.6.1"; exon_number "1"; cov "19.924160"; +CM143126.1 StringTie transcript 12538 13409 1000 . . gene_id "SS.7"; transcript_id "SS.7.1"; cov "23.853211"; FPKM "1.166529"; TPM "2.494444"; +CM143126.1 StringTie exon 12538 13409 1000 . . gene_id "SS.7"; transcript_id "SS.7.1"; exon_number "1"; cov "23.853210"; +CM143126.1 StringTie transcript 22327 28454 1000 . . gene_id "SS.8"; transcript_id "SS.8.1"; cov "1310.793734"; FPKM "64.103711"; TPM "137.075962"; +CM143126.1 StringTie exon 22327 28454 1000 . . gene_id "SS.8"; transcript_id "SS.8.1"; exon_number "1"; cov "1310.793701"; +CM143126.1 StringTie transcript 30315 31268 1000 . . gene_id "SS.9"; transcript_id "SS.9.1"; cov "2710.131027"; FPKM "132.537601"; TPM "283.411347"; +CM143126.1 StringTie exon 30315 31268 1000 . . gene_id "SS.9"; transcript_id "SS.9.1"; exon_number "1"; cov "2710.131104"; +CM143126.1 StringTie transcript 34968 41302 1000 . . gene_id "SS.10"; transcript_id "SS.10.1"; cov "409.476559"; FPKM "20.025246"; TPM "42.820920"; +CM143126.1 StringTie exon 34968 41302 1000 . . gene_id "SS.10"; transcript_id "SS.10.1"; exon_number "1"; cov "409.476562"; +CM143126.1 StringTie transcript 42341 47769 1000 . . gene_id "SS.11"; transcript_id "SS.11.1"; cov "419.666053"; FPKM "20.523558"; TPM "43.886484"; +CM143126.1 StringTie exon 42341 47769 1000 . . gene_id "SS.11"; transcript_id "SS.11.1"; exon_number "1"; cov "419.666046"; +CM143126.1 StringTie transcript 48048 51127 1000 . . gene_id "SS.12"; transcript_id "SS.12.1"; cov "636.266558"; FPKM "31.116298"; TPM "66.537433"; +CM143126.1 StringTie exon 48048 51127 1000 . . gene_id "SS.12"; transcript_id "SS.12.1"; exon_number "1"; cov "636.266541"; +CM143126.1 StringTie transcript 51376 53784 1000 . . gene_id "SS.13"; transcript_id "SS.13.1"; cov "259.317559"; FPKM "12.681795"; TPM "27.118076"; +CM143126.1 StringTie exon 51376 53784 1000 . . gene_id "SS.13"; transcript_id "SS.13.1"; exon_number "1"; cov "259.317566"; +CM143126.1 StringTie transcript 54090 58331 1000 . . gene_id "SS.14"; transcript_id "SS.14.1"; cov "308.247525"; FPKM "15.074691"; TPM "32.234916"; +CM143126.1 StringTie exon 54090 58331 1000 . . gene_id "SS.14"; transcript_id "SS.14.1"; exon_number "1"; cov "308.247528"; +CM143126.1 StringTie transcript 58547 60002 1000 . . gene_id "SS.15"; transcript_id "SS.15.1"; cov "1164.733516"; FPKM "56.960710"; TPM "121.801748"; +CM143126.1 StringTie exon 58547 60002 1000 . . gene_id "SS.15"; transcript_id "SS.15.1"; exon_number "1"; cov "1164.733521"; +CM143126.1 StringTie transcript 60562 63001 1000 . . gene_id "SS.16"; transcript_id "SS.16.1"; cov "150.557787"; FPKM "7.362953"; TPM "15.744547"; +CM143126.1 StringTie exon 60562 63001 1000 . . gene_id "SS.16"; transcript_id "SS.16.1"; exon_number "1"; cov "150.557785"; +CM143126.1 StringTie transcript 64800 66647 1000 + . gene_id "SS.17"; transcript_id "SS.17.1"; cov "16869.570349"; FPKM "824.997893"; TPM "1764.131555"; +CM143126.1 StringTie exon 64800 64907 1000 + . gene_id "SS.17"; transcript_id "SS.17.1"; exon_number "1"; cov "1078.083374"; +CM143126.1 StringTie exon 65367 65460 1000 + . gene_id "SS.17"; transcript_id "SS.17.1"; exon_number "2"; cov "13231.510742"; +CM143126.1 StringTie exon 65791 66647 1000 + . gene_id "SS.17"; transcript_id "SS.17.1"; exon_number "3"; cov "19258.669922"; +CM143126.1 StringTie transcript 66860 70894 1000 . . gene_id "SS.18"; transcript_id "SS.18.1"; cov "130.459480"; FPKM "6.380056"; TPM "13.642771"; +CM143126.1 StringTie exon 66860 70894 1000 . . gene_id "SS.18"; transcript_id "SS.18.1"; exon_number "1"; cov "130.459473"; +CM143126.1 StringTie transcript 71285 73492 1000 . . gene_id "SS.19"; transcript_id "SS.19.1"; cov "456.331522"; FPKM "22.316665"; TPM "47.720767"; +CM143126.1 StringTie exon 71285 73492 1000 . . gene_id "SS.19"; transcript_id "SS.19.1"; exon_number "1"; cov "456.331512"; +CM143126.1 StringTie transcript 73718 75503 1000 . . gene_id "SS.20"; transcript_id "SS.20.1"; cov "6650.666853"; FPKM "325.247533"; TPM "695.492002"; +CM143126.1 StringTie exon 73718 75503 1000 . . gene_id "SS.20"; transcript_id "SS.20.1"; exon_number "1"; cov "6650.666992"; +CM143126.1 StringTie transcript 78936 79469 1000 . . gene_id "SS.21"; transcript_id "SS.21.1"; cov "1686.031835"; FPKM "82.454543"; TPM "176.316403"; +CM143126.1 StringTie exon 78936 79469 1000 . . gene_id "SS.21"; transcript_id "SS.21.1"; exon_number "1"; cov "1686.031860"; +CM143126.1 StringTie transcript 80055 88790 1000 . . gene_id "SS.22"; transcript_id "SS.22.1"; cov "264.930288"; FPKM "12.956283"; TPM "27.705026"; +CM143126.1 StringTie exon 80055 88790 1000 . . gene_id "SS.22"; transcript_id "SS.22.1"; exon_number "1"; cov "264.930298"; +CM143126.1 StringTie transcript 89038 89811 1000 . . gene_id "SS.23"; transcript_id "SS.23.1"; cov "183.161499"; FPKM "8.957421"; TPM "19.154073"; +CM143126.1 StringTie exon 89038 89811 1000 . . gene_id "SS.23"; transcript_id "SS.23.1"; exon_number "1"; cov "183.161499"; +CM143126.1 StringTie transcript 90123 95290 1000 . . gene_id "SS.24"; transcript_id "SS.24.1"; cov "387.684985"; FPKM "18.959540"; TPM "40.542071"; +CM143126.1 StringTie exon 90123 95290 1000 . . gene_id "SS.24"; transcript_id "SS.24.1"; exon_number "1"; cov "387.684998"; +CM143126.1 StringTie transcript 95588 98773 1000 . . gene_id "SS.25"; transcript_id "SS.25.1"; cov "391.012241"; FPKM "19.122258"; TPM "40.890018"; +CM143126.1 StringTie exon 95588 98773 1000 . . gene_id "SS.25"; transcript_id "SS.25.1"; exon_number "1"; cov "391.012238"; +CM143126.1 StringTie transcript 99089 101354 1000 . . gene_id "SS.26"; transcript_id "SS.26.1"; cov "246.796558"; FPKM "12.069462"; TPM "25.808695"; +CM143126.1 StringTie exon 99089 101354 1000 . . gene_id "SS.26"; transcript_id "SS.26.1"; exon_number "1"; cov "246.796555"; +CM143126.1 StringTie transcript 101581 104363 1000 . . gene_id "SS.27"; transcript_id "SS.27.1"; cov "799.397413"; FPKM "39.094130"; TPM "83.596806"; +CM143126.1 StringTie exon 101581 104363 1000 . . gene_id "SS.27"; transcript_id "SS.27.1"; exon_number "1"; cov "799.397400"; +CM143126.1 StringTie transcript 110133 114009 1000 + . gene_id "SS.28"; transcript_id "SS.28.1"; cov "757.219095"; FPKM "37.031421"; TPM "79.186018"; +CM143126.1 StringTie exon 110133 112093 1000 + . gene_id "SS.28"; transcript_id "SS.28.1"; exon_number "1"; cov "1118.765381"; +CM143126.1 StringTie exon 112169 114009 1000 + . gene_id "SS.28"; transcript_id "SS.28.1"; exon_number "2"; cov "372.106476"; +CM143126.1 StringTie transcript 114342 120689 1000 . . gene_id "SS.29"; transcript_id "SS.29.1"; cov "153.058601"; FPKM "7.485254"; TPM "16.006069"; +CM143126.1 StringTie exon 114342 120689 1000 . . gene_id "SS.29"; transcript_id "SS.29.1"; exon_number "1"; cov "153.058594"; +CM143126.1 StringTie transcript 121090 134487 1000 . . gene_id "SS.30"; transcript_id "SS.30.1"; cov "460.575832"; FPKM "22.524230"; TPM "48.164615"; +CM143126.1 StringTie exon 121090 134487 1000 . . gene_id "SS.30"; transcript_id "SS.30.1"; exon_number "1"; cov "460.575836"; +CM143126.1 StringTie transcript 134782 137873 1000 . . gene_id "SS.31"; transcript_id "SS.31.1"; cov "1948.213131"; FPKM "95.276388"; TPM "203.733953"; +CM143126.1 StringTie exon 134782 137873 1000 . . gene_id "SS.31"; transcript_id "SS.31.1"; exon_number "1"; cov "1948.213135"; +CM143126.1 StringTie transcript 138588 142736 1000 . . gene_id "SS.32"; transcript_id "SS.32.1"; cov "1281.826946"; FPKM "62.687105"; TPM "134.046767"; +CM143126.1 StringTie exon 138588 142736 1000 . . gene_id "SS.32"; transcript_id "SS.32.1"; exon_number "1"; cov "1281.826904"; +CM143126.1 StringTie transcript 147373 149630 1000 + . gene_id "SS.33"; transcript_id "SS.33.1"; cov "3139.688878"; FPKM "153.544913"; TPM "328.332264"; +CM143126.1 StringTie exon 147373 147538 1000 + . gene_id "SS.33"; transcript_id "SS.33.1"; exon_number "1"; cov "526.409668"; +CM143126.1 StringTie exon 147666 149630 1000 + . gene_id "SS.33"; transcript_id "SS.33.1"; exon_number "2"; cov "3360.454346"; +CM143126.1 StringTie transcript 150582 152922 1000 . . gene_id "SS.34"; transcript_id "SS.34.1"; cov "2015.455361"; FPKM "98.564835"; TPM "210.765795"; +CM143126.1 StringTie exon 150582 152922 1000 . . gene_id "SS.34"; transcript_id "SS.34.1"; exon_number "1"; cov "2015.455322"; +CM143126.1 StringTie transcript 153388 155352 1000 . . gene_id "SS.35"; transcript_id "SS.35.1"; cov "737.068193"; FPKM "36.045951"; TPM "77.078742"; +CM143126.1 StringTie exon 153388 155352 1000 . . gene_id "SS.35"; transcript_id "SS.35.1"; exon_number "1"; cov "737.068176"; +CM143126.1 StringTie transcript 155582 158797 1000 . . gene_id "SS.36"; transcript_id "SS.36.1"; cov "281.580846"; FPKM "13.770570"; TPM "29.446254"; +CM143126.1 StringTie exon 155582 158797 1000 . . gene_id "SS.36"; transcript_id "SS.36.1"; exon_number "1"; cov "281.580841"; +CM143126.1 StringTie transcript 159452 160345 1000 . . gene_id "SS.37"; transcript_id "SS.37.1"; cov "21086.534676"; FPKM "1031.226422"; TPM "2205.119658"; +CM143126.1 StringTie exon 159452 160345 1000 . . gene_id "SS.37"; transcript_id "SS.37.1"; exon_number "1"; cov "21086.535156"; +CM143126.1 StringTie transcript 165505 171940 1000 . . gene_id "SS.38"; transcript_id "SS.38.1"; cov "273.052206"; FPKM "13.353481"; TPM "28.554374"; +CM143126.1 StringTie exon 165505 171940 1000 . . gene_id "SS.38"; transcript_id "SS.38.1"; exon_number "1"; cov "273.052216"; +CM143126.1 StringTie transcript 172137 175223 1000 . . gene_id "SS.39"; transcript_id "SS.39.1"; cov "186.448656"; FPKM "9.118178"; TPM "19.497827"; +CM143126.1 StringTie exon 172137 175223 1000 . . gene_id "SS.39"; transcript_id "SS.39.1"; exon_number "1"; cov "186.448654"; +CM143126.1 StringTie transcript 175427 190497 1000 . . gene_id "SS.40"; transcript_id "SS.40.1"; cov "451.940283"; FPKM "22.101913"; TPM "47.261554"; +CM143126.1 StringTie exon 175427 190497 1000 . . gene_id "SS.40"; transcript_id "SS.40.1"; exon_number "1"; cov "451.940277"; +CM143126.1 StringTie transcript 190784 193481 1000 . . gene_id "SS.41"; transcript_id "SS.41.1"; cov "1614.842105"; FPKM "78.973045"; TPM "168.871753"; +CM143126.1 StringTie exon 190784 193481 1000 . . gene_id "SS.41"; transcript_id "SS.41.1"; exon_number "1"; cov "1614.842163"; +CM143126.1 StringTie transcript 194327 195106 1000 . . gene_id "SS.42"; transcript_id "SS.42.1"; cov "1074.655128"; FPKM "52.555471"; TPM "112.381820"; +CM143126.1 StringTie exon 194327 195106 1000 . . gene_id "SS.42"; transcript_id "SS.42.1"; exon_number "1"; cov "1074.655151"; +CM143126.1 StringTie transcript 195405 199836 1000 . . gene_id "SS.43"; transcript_id "SS.43.1"; cov "1223.464576"; FPKM "59.832923"; TPM "127.943535"; +CM143126.1 StringTie exon 195405 199836 1000 . . gene_id "SS.43"; transcript_id "SS.43.1"; exon_number "1"; cov "1223.464600"; +CM143126.1 StringTie transcript 200104 200751 1000 . . gene_id "SS.44"; transcript_id "SS.44.1"; cov "495.530864"; FPKM "24.233689"; TPM "51.820030"; +CM143126.1 StringTie exon 200104 200751 1000 . . gene_id "SS.44"; transcript_id "SS.44.1"; exon_number "1"; cov "495.530853"; +CM143126.1 StringTie transcript 201253 208299 1000 . . gene_id "SS.45"; transcript_id "SS.45.1"; cov "223.751969"; FPKM "10.942478"; TPM "23.398812"; +CM143126.1 StringTie exon 201253 208299 1000 . . gene_id "SS.45"; transcript_id "SS.45.1"; exon_number "1"; cov "223.751968"; +CM143126.1 StringTie transcript 201253 208299 1000 - . gene_id "SS.46"; transcript_id "SS.46.1"; cov "3.478673"; FPKM "0.170123"; TPM "0.363781"; +CM143126.1 StringTie exon 201253 207474 1000 - . gene_id "SS.46"; transcript_id "SS.46.1"; exon_number "1"; cov "2.945512"; +CM143126.1 StringTie exon 207505 207534 1000 - . gene_id "SS.46"; transcript_id "SS.46.1"; exon_number "2"; cov "11.853943"; +CM143126.1 StringTie exon 207595 208299 1000 - . gene_id "SS.46"; transcript_id "SS.46.1"; exon_number "3"; cov "7.827711"; +CM143126.1 StringTie transcript 210975 211703 1000 . . gene_id "SS.47"; transcript_id "SS.47.1"; cov "4412.124829"; FPKM "215.772756"; TPM "461.396969"; +CM143126.1 StringTie exon 210975 211703 1000 . . gene_id "SS.47"; transcript_id "SS.47.1"; exon_number "1"; cov "4412.125000"; +CM143126.1 StringTie transcript 215188 219089 1000 . . gene_id "SS.48"; transcript_id "SS.48.1"; cov "1165.940543"; FPKM "57.019739"; TPM "121.927972"; +CM143126.1 StringTie exon 215188 219089 1000 . . gene_id "SS.48"; transcript_id "SS.48.1"; exon_number "1"; cov "1165.940552"; +CM143126.1 StringTie transcript 219409 223470 1000 . . gene_id "SS.49"; transcript_id "SS.49.1"; cov "307.513540"; FPKM "15.038796"; TPM "32.158160"; +CM143126.1 StringTie exon 219409 223470 1000 . . gene_id "SS.49"; transcript_id "SS.49.1"; exon_number "1"; cov "307.513550"; +CM143126.1 StringTie transcript 223727 226844 1000 . . gene_id "SS.50"; transcript_id "SS.50.1"; cov "689.133740"; FPKM "33.701741"; TPM "72.066007"; +CM143126.1 StringTie exon 223727 226844 1000 . . gene_id "SS.50"; transcript_id "SS.50.1"; exon_number "1"; cov "689.133728"; +CM143126.1 StringTie transcript 226944 241606 1000 . . gene_id "SS.51"; transcript_id "SS.51.1"; cov "273.195935"; FPKM "13.360510"; TPM "28.569404"; +CM143126.1 StringTie exon 226944 241606 1000 . . gene_id "SS.51"; transcript_id "SS.51.1"; exon_number "1"; cov "273.195923"; +CM143126.1 StringTie transcript 242540 244842 1000 . . gene_id "SS.52"; transcript_id "SS.52.1"; cov "809.941815"; FPKM "39.609799"; TPM "84.699485"; +CM143126.1 StringTie exon 242540 244842 1000 . . gene_id "SS.52"; transcript_id "SS.52.1"; exon_number "1"; cov "809.941833"; +CM143126.1 StringTie transcript 245974 249307 1000 . . gene_id "SS.53"; transcript_id "SS.53.1"; cov "325.739352"; FPKM "15.930120"; TPM "34.064120"; +CM143126.1 StringTie exon 245974 249307 1000 . . gene_id "SS.53"; transcript_id "SS.53.1"; exon_number "1"; cov "325.739349"; +CM143126.1 StringTie transcript 249550 250319 1000 . . gene_id "SS.54"; transcript_id "SS.54.1"; cov "1190.476623"; FPKM "58.219663"; TPM "124.493827"; +CM143126.1 StringTie exon 249550 250319 1000 . . gene_id "SS.54"; transcript_id "SS.54.1"; exon_number "1"; cov "1190.476562"; +CM143126.1 StringTie transcript 250419 257032 1000 . . gene_id "SS.55"; transcript_id "SS.55.1"; cov "303.013305"; FPKM "14.818714"; TPM "31.687549"; +CM143126.1 StringTie exon 250419 257032 1000 . . gene_id "SS.55"; transcript_id "SS.55.1"; exon_number "1"; cov "303.013306"; +CM143126.1 StringTie transcript 257315 259031 1000 . . gene_id "SS.56"; transcript_id "SS.56.1"; cov "3966.722190"; FPKM "193.990563"; TPM "414.819088"; +CM143126.1 StringTie exon 257315 259031 1000 . . gene_id "SS.56"; transcript_id "SS.56.1"; exon_number "1"; cov "3966.722168"; +CM143126.1 StringTie transcript 260148 260788 1000 + . gene_id "SS.57"; transcript_id "SS.57.1"; cov "841.735125"; FPKM "41.164635"; TPM "88.024263"; +CM143126.1 StringTie exon 260148 260213 1000 + . gene_id "SS.57"; transcript_id "SS.57.1"; exon_number "1"; cov "484.969696"; +CM143126.1 StringTie exon 260334 260788 1000 + . gene_id "SS.57"; transcript_id "SS.57.1"; exon_number "2"; cov "893.485718"; +CM143126.1 StringTie transcript 261548 263054 1000 . . gene_id "SS.58"; transcript_id "SS.58.1"; cov "1304.933643"; FPKM "63.817127"; TPM "136.463145"; +CM143126.1 StringTie exon 261548 263054 1000 . . gene_id "SS.58"; transcript_id "SS.58.1"; exon_number "1"; cov "1304.933594"; +CM143126.1 StringTie transcript 265519 266626 1000 . . gene_id "SS.59"; transcript_id "SS.59.1"; cov "1129.834838"; FPKM "55.254007"; TPM "118.152226"; +CM143126.1 StringTie exon 265519 266626 1000 . . gene_id "SS.59"; transcript_id "SS.59.1"; exon_number "1"; cov "1129.834839"; +CM143126.1 StringTie transcript 266911 268498 1000 + . gene_id "SS.60"; transcript_id "SS.60.1"; cov "1511.571429"; FPKM "73.922644"; TPM "158.072245"; +CM143126.1 StringTie exon 266911 266962 1000 + . gene_id "SS.60"; transcript_id "SS.60.1"; exon_number "1"; cov "132.230774"; +CM143126.1 StringTie exon 267067 268498 1000 + . gene_id "SS.60"; transcript_id "SS.60.1"; exon_number "2"; cov "1561.659180"; +CM143126.1 StringTie transcript 273901 275095 1000 . . gene_id "SS.61"; transcript_id "SS.61.1"; cov "3026.529707"; FPKM "148.010920"; TPM "316.498669"; +CM143126.1 StringTie exon 273901 275095 1000 . . gene_id "SS.61"; transcript_id "SS.61.1"; exon_number "1"; cov "3026.529785"; +CM143126.1 StringTie transcript 275351 279389 1000 . . gene_id "SS.62"; transcript_id "SS.62.1"; cov "681.907898"; FPKM "33.348364"; TPM "71.310366"; +CM143126.1 StringTie exon 275351 279389 1000 . . gene_id "SS.62"; transcript_id "SS.62.1"; exon_number "1"; cov "681.907898"; +CM143126.1 StringTie transcript 279590 281993 1000 . . gene_id "SS.63"; transcript_id "SS.63.1"; cov "372.857321"; FPKM "18.234401"; TPM "38.991471"; +CM143126.1 StringTie exon 279590 281993 1000 . . gene_id "SS.63"; transcript_id "SS.63.1"; exon_number "1"; cov "372.857330"; +CM143126.1 StringTie transcript 285955 287803 1000 . . gene_id "SS.64"; transcript_id "SS.64.1"; cov "5679.096809"; FPKM "277.733386"; TPM "593.890282"; +CM143126.1 StringTie exon 285955 287803 1000 . . gene_id "SS.64"; transcript_id "SS.64.1"; exon_number "1"; cov "5679.096680"; +CM143126.1 StringTie transcript 296540 298063 1000 . . gene_id "SS.65"; transcript_id "SS.65.1"; cov "20571.766404"; FPKM "1006.051938"; TPM "2151.287881"; +CM143126.1 StringTie exon 296540 298063 1000 . . gene_id "SS.65"; transcript_id "SS.65.1"; exon_number "1"; cov "20571.765625"; +CM143126.1 StringTie transcript 300053 305225 1000 . . gene_id "SS.66"; transcript_id "SS.66.1"; cov "499.634255"; FPKM "24.434363"; TPM "52.249141"; +CM143126.1 StringTie exon 300053 305225 1000 . . gene_id "SS.66"; transcript_id "SS.66.1"; exon_number "1"; cov "499.634247"; +CM143126.1 StringTie transcript 306288 308221 1000 . . gene_id "SS.67"; transcript_id "SS.67.1"; cov "4196.144261"; FPKM "205.210334"; TPM "438.810850"; +CM143126.1 StringTie exon 306288 308221 1000 . . gene_id "SS.67"; transcript_id "SS.67.1"; exon_number "1"; cov "4196.144043"; +CM143126.1 StringTie transcript 324576 325384 1000 . . gene_id "SS.68"; transcript_id "SS.68.1"; cov "22.451174"; FPKM "1.097963"; TPM "2.347827"; +CM143126.1 StringTie exon 324576 325384 1000 . . gene_id "SS.68"; transcript_id "SS.68.1"; exon_number "1"; cov "22.451174"; +CM143126.1 StringTie transcript 308850 311026 1000 . . gene_id "SS.69"; transcript_id "SS.69.1"; cov "1159.642627"; FPKM "56.711742"; TPM "121.269369"; +CM143126.1 StringTie exon 308850 311026 1000 . . gene_id "SS.69"; transcript_id "SS.69.1"; exon_number "1"; cov "1159.642578"; +CM143126.1 StringTie transcript 311262 313661 1000 . . gene_id "SS.70"; transcript_id "SS.70.1"; cov "115.171250"; FPKM "5.632392"; TPM "12.044008"; +CM143126.1 StringTie exon 311262 313661 1000 . . gene_id "SS.70"; transcript_id "SS.70.1"; exon_number "1"; cov "115.171249"; +CM143126.1 StringTie transcript 314086 323253 1000 . . gene_id "SS.71"; transcript_id "SS.71.1"; cov "379.415330"; FPKM "18.555117"; TPM "39.677273"; +CM143126.1 StringTie exon 314086 323253 1000 . . gene_id "SS.71"; transcript_id "SS.71.1"; exon_number "1"; cov "379.415344"; +CM143126.1 StringTie transcript 314086 323253 1000 + . gene_id "SS.72"; transcript_id "SS.72.1"; cov "51.274514"; FPKM "2.507554"; TPM "5.362021"; +CM143126.1 StringTie exon 314086 321856 1000 + . gene_id "SS.72"; transcript_id "SS.72.1"; exon_number "1"; cov "59.572609"; +CM143126.1 StringTie exon 321917 323253 1000 + . gene_id "SS.72"; transcript_id "SS.72.1"; exon_number "2"; cov "3.043770"; +CM143126.1 StringTie transcript 325695 326300 1000 . . gene_id "SS.73"; transcript_id "SS.73.1"; cov "2195.087459"; FPKM "107.349653"; TPM "229.550781"; +CM143126.1 StringTie exon 325695 326300 1000 . . gene_id "SS.73"; transcript_id "SS.73.1"; exon_number "1"; cov "2195.087402"; +CM143126.1 StringTie transcript 328503 329145 1000 . . gene_id "SS.74"; transcript_id "SS.74.1"; cov "650.354588"; FPKM "31.805266"; TPM "68.010686"; +CM143126.1 StringTie exon 328503 329145 1000 . . gene_id "SS.74"; transcript_id "SS.74.1"; exon_number "1"; cov "650.354614"; +CM143126.1 StringTie transcript 329515 331123 1000 . . gene_id "SS.75"; transcript_id "SS.75.1"; cov "715.007458"; FPKM "34.967082"; TPM "74.771745"; +CM143126.1 StringTie exon 329515 331123 1000 . . gene_id "SS.75"; transcript_id "SS.75.1"; exon_number "1"; cov "715.007446"; +CM143126.1 StringTie transcript 331529 333138 1000 . . gene_id "SS.76"; transcript_id "SS.76.1"; cov "398.573913"; FPKM "19.492058"; TPM "41.680778"; +CM143126.1 StringTie exon 331529 333138 1000 . . gene_id "SS.76"; transcript_id "SS.76.1"; exon_number "1"; cov "398.573914"; +CM143126.1 StringTie transcript 333404 334572 1000 . . gene_id "SS.77"; transcript_id "SS.77.1"; cov "962.068435"; FPKM "47.049475"; TPM "100.608092"; +CM143126.1 StringTie exon 333404 334572 1000 . . gene_id "SS.77"; transcript_id "SS.77.1"; exon_number "1"; cov "962.068420"; +CM143126.1 StringTie transcript 334862 338330 1000 . . gene_id "SS.78"; transcript_id "SS.78.1"; cov "2396.255693"; FPKM "117.187685"; TPM "250.587904"; +CM143126.1 StringTie exon 334862 338330 1000 . . gene_id "SS.78"; transcript_id "SS.78.1"; exon_number "1"; cov "2396.255615"; +CM143126.1 StringTie transcript 338707 341577 1000 . . gene_id "SS.79"; transcript_id "SS.79.1"; cov "696.692093"; FPKM "34.071378"; TPM "72.856420"; +CM143126.1 StringTie exon 338707 341577 1000 . . gene_id "SS.79"; transcript_id "SS.79.1"; exon_number "1"; cov "696.692078"; +CM143126.1 StringTie transcript 342684 343866 1000 . . gene_id "SS.80"; transcript_id "SS.80.1"; cov "60239.932375"; FPKM "2946.003737"; TPM "6299.577486"; +CM143126.1 StringTie exon 342684 343866 1000 . . gene_id "SS.80"; transcript_id "SS.80.1"; exon_number "1"; cov "60239.933594"; +CM143126.1 StringTie transcript 344157 344658 1000 . . gene_id "SS.81"; transcript_id "SS.81.1"; cov "4.924303"; FPKM "0.240821"; TPM "0.514958"; +CM143126.1 StringTie exon 344157 344658 1000 . . gene_id "SS.81"; transcript_id "SS.81.1"; exon_number "1"; cov "4.924303"; +CM143126.1 StringTie transcript 344897 345799 1000 . . gene_id "SS.82"; transcript_id "SS.82.1"; cov "2421.280177"; FPKM "118.411495"; TPM "253.204834"; +CM143126.1 StringTie exon 344897 345799 1000 . . gene_id "SS.82"; transcript_id "SS.82.1"; exon_number "1"; cov "2421.280273"; +CM143126.1 StringTie transcript 358383 358810 1000 . . gene_id "SS.83"; transcript_id "SS.83.1"; cov "13.203271"; FPKM "0.645699"; TPM "1.380729"; +CM143126.1 StringTie exon 358383 358810 1000 . . gene_id "SS.83"; transcript_id "SS.83.1"; exon_number "1"; cov "13.203271"; +CM143126.1 StringTie transcript 348495 356777 1000 - . gene_id "SS.84"; transcript_id "SS.84.1"; cov "706.527031"; FPKM "34.552351"; TPM "73.884907"; +CM143126.1 StringTie exon 348495 354929 1000 - . gene_id "SS.84"; transcript_id "SS.84.1"; exon_number "1"; cov "634.576233"; +CM143126.1 StringTie exon 355008 356524 1000 - . gene_id "SS.84"; transcript_id "SS.84.1"; exon_number "2"; cov "1019.803223"; +CM143126.1 StringTie exon 356661 356777 1000 - . gene_id "SS.84"; transcript_id "SS.84.1"; exon_number "3"; cov "601.941101"; +CM143126.1 StringTie transcript 355567 356777 1000 - . gene_id "SS.84"; transcript_id "SS.84.2"; cov "1056.828270"; FPKM "51.683657"; TPM "110.517581"; +CM143126.1 StringTie exon 355567 356524 1000 - . gene_id "SS.84"; transcript_id "SS.84.2"; exon_number "1"; cov "1131.931641"; +CM143126.1 StringTie exon 356661 356777 1000 - . gene_id "SS.84"; transcript_id "SS.84.2"; exon_number "2"; cov "441.879395"; +CM143126.1 StringTie transcript 359388 362496 1000 - . gene_id "SS.85"; transcript_id "SS.85.1"; cov "759.070780"; FPKM "37.121977"; TPM "79.379657"; +CM143126.1 StringTie exon 359388 361892 1000 - . gene_id "SS.85"; transcript_id "SS.85.1"; exon_number "1"; cov "794.333740"; +CM143126.1 StringTie exon 362360 362496 1000 - . gene_id "SS.85"; transcript_id "SS.85.1"; exon_number "2"; cov "114.299271"; +CM143126.1 StringTie transcript 363008 367412 1000 . . gene_id "SS.86"; transcript_id "SS.86.1"; cov "142.680363"; FPKM "6.977712"; TPM "14.920767"; +CM143126.1 StringTie exon 363008 367412 1000 . . gene_id "SS.86"; transcript_id "SS.86.1"; exon_number "1"; cov "142.680359"; +CM143126.1 StringTie transcript 411964 412540 1000 . . gene_id "SS.87"; transcript_id "SS.87.1"; cov "5.457539"; FPKM "0.266898"; TPM "0.570721"; +CM143126.1 StringTie exon 411964 412540 1000 . . gene_id "SS.87"; transcript_id "SS.87.1"; exon_number "1"; cov "5.457539"; +CM143126.1 StringTie transcript 414272 414928 1000 . . gene_id "SS.88"; transcript_id "SS.88.1"; cov "1362.165906"; FPKM "66.616042"; TPM "142.448196"; +CM143126.1 StringTie exon 414272 414928 1000 . . gene_id "SS.88"; transcript_id "SS.88.1"; exon_number "1"; cov "1362.165894"; +CM143126.1 StringTie transcript 367813 368504 1000 . . gene_id "SS.89"; transcript_id "SS.89.1"; cov "18.562139"; FPKM "0.907772"; TPM "1.941132"; +CM143126.1 StringTie exon 367813 368504 1000 . . gene_id "SS.89"; transcript_id "SS.89.1"; exon_number "1"; cov "18.562140"; +CM143126.1 StringTie transcript 371825 373612 1000 . . gene_id "SS.90"; transcript_id "SS.90.1"; cov "3450.984340"; FPKM "168.768662"; TPM "360.885917"; +CM143126.1 StringTie exon 371825 373612 1000 . . gene_id "SS.90"; transcript_id "SS.90.1"; exon_number "1"; cov "3450.984375"; +CM143126.1 StringTie transcript 373841 375547 1000 . . gene_id "SS.91"; transcript_id "SS.91.1"; cov "4508.816052"; FPKM "220.501392"; TPM "471.508433"; +CM143126.1 StringTie exon 373841 375547 1000 . . gene_id "SS.91"; transcript_id "SS.91.1"; exon_number "1"; cov "4508.815918"; +CM143126.1 StringTie transcript 376053 377603 1000 . . gene_id "SS.92"; transcript_id "SS.92.1"; cov "10727.784010"; FPKM "524.636907"; TPM "1121.855619"; +CM143126.1 StringTie exon 376053 377603 1000 . . gene_id "SS.92"; transcript_id "SS.92.1"; exon_number "1"; cov "10727.784180"; +CM143126.1 StringTie transcript 388630 392077 1000 . . gene_id "SS.93"; transcript_id "SS.93.1"; cov "1198.929814"; FPKM "58.633062"; TPM "125.377818"; +CM143126.1 StringTie exon 388630 392077 1000 . . gene_id "SS.93"; transcript_id "SS.93.1"; exon_number "1"; cov "1198.929810"; +CM143126.1 StringTie transcript 392495 395695 1000 + . gene_id "SS.94"; transcript_id "SS.94.1"; cov "74.641544"; FPKM "3.650307"; TPM "7.805623"; +CM143126.1 StringTie exon 392495 392637 1000 + . gene_id "SS.94"; transcript_id "SS.94.1"; exon_number "1"; cov "115.272728"; +CM143126.1 StringTie exon 392711 395695 1000 + . gene_id "SS.94"; transcript_id "SS.94.1"; exon_number "2"; cov "72.695061"; +CM143126.1 StringTie transcript 392724 395695 1000 . . gene_id "SS.95"; transcript_id "SS.95.1"; cov "317.080501"; FPKM "15.506663"; TPM "33.158623"; +CM143126.1 StringTie exon 392724 395695 1000 . . gene_id "SS.95"; transcript_id "SS.95.1"; exon_number "1"; cov "317.080505"; +CM143126.1 StringTie transcript 395916 397171 1000 - . gene_id "SS.96"; transcript_id "SS.96.1"; cov "14331.187739"; FPKM "700.859562"; TPM "1498.680760"; +CM143126.1 StringTie exon 395916 396620 1000 - . gene_id "SS.96"; transcript_id "SS.96.1"; exon_number "1"; cov "15828.545898"; +CM143126.1 StringTie exon 397094 397171 1000 - . gene_id "SS.96"; transcript_id "SS.96.1"; exon_number "2"; cov "797.371765"; +CM143126.1 StringTie transcript 397763 400789 1000 . . gene_id "SS.97"; transcript_id "SS.97.1"; cov "486.326726"; FPKM "23.783565"; TPM "50.857509"; +CM143126.1 StringTie exon 397763 400789 1000 . . gene_id "SS.97"; transcript_id "SS.97.1"; exon_number "1"; cov "486.326721"; +CM143126.1 StringTie transcript 401046 402873 1000 . . gene_id "SS.98"; transcript_id "SS.98.1"; cov "965.836980"; FPKM "47.233774"; TPM "101.002187"; +CM143126.1 StringTie exon 401046 402873 1000 . . gene_id "SS.98"; transcript_id "SS.98.1"; exon_number "1"; cov "965.836975"; +CM143126.1 StringTie transcript 403366 405404 1000 . . gene_id "SS.99"; transcript_id "SS.99.1"; cov "1509.387445"; FPKM "73.815837"; TPM "157.843855"; +CM143126.1 StringTie exon 403366 405404 1000 . . gene_id "SS.99"; transcript_id "SS.99.1"; exon_number "1"; cov "1509.387451"; +CM143126.1 StringTie transcript 406354 408142 1000 . . gene_id "SS.100"; transcript_id "SS.100.1"; cov "530.010620"; FPKM "25.919904"; TPM "55.425742"; +CM143126.1 StringTie exon 406354 408142 1000 . . gene_id "SS.100"; transcript_id "SS.100.1"; exon_number "1"; cov "530.010620"; +CM143126.1 StringTie transcript 408383 411679 1000 - . gene_id "SS.101"; transcript_id "SS.101.1"; cov "275.815308"; FPKM "13.488610"; TPM "28.843324"; +CM143126.1 StringTie exon 408383 410254 1000 - . gene_id "SS.101"; transcript_id "SS.101.1"; exon_number "1"; cov "263.545410"; +CM143126.1 StringTie exon 410325 411679 1000 - . gene_id "SS.101"; transcript_id "SS.101.1"; exon_number "2"; cov "292.766785"; +CM143126.1 StringTie transcript 419645 420875 1000 . . gene_id "SS.102"; transcript_id "SS.102.1"; cov "8618.783916"; FPKM "421.497313"; TPM "901.307405"; +CM143126.1 StringTie exon 419645 420875 1000 . . gene_id "SS.102"; transcript_id "SS.102.1"; exon_number "1"; cov "8618.784180"; +CM143126.1 StringTie transcript 422247 424188 1000 . . gene_id "SS.103"; transcript_id "SS.103.1"; cov "1399.367662"; FPKM "68.435375"; TPM "146.338561"; +CM143126.1 StringTie exon 422247 424188 1000 . . gene_id "SS.103"; transcript_id "SS.103.1"; exon_number "1"; cov "1399.367676"; +CM143126.1 StringTie transcript 424762 428048 1000 . . gene_id "SS.104"; transcript_id "SS.104.1"; cov "1957.683602"; FPKM "95.739537"; TPM "204.724326"; +CM143126.1 StringTie exon 424762 428048 1000 . . gene_id "SS.104"; transcript_id "SS.104.1"; exon_number "1"; cov "1957.683594"; +CM143126.1 StringTie transcript 428460 429342 1000 - . gene_id "SS.105"; transcript_id "SS.105.1"; cov "2282.578947"; FPKM "111.628381"; TPM "238.700184"; +CM143126.1 StringTie exon 428460 429170 1000 - . gene_id "SS.105"; transcript_id "SS.105.1"; exon_number "1"; cov "2471.490967"; +CM143126.1 StringTie exon 429275 429342 1000 - . gene_id "SS.105"; transcript_id "SS.105.1"; exon_number "2"; cov "307.338226"; +CM143126.1 StringTie transcript 431521 433029 1000 . . gene_id "SS.106"; transcript_id "SS.106.1"; cov "3915.736249"; FPKM "191.497121"; TPM "409.487244"; +CM143126.1 StringTie exon 431521 433029 1000 . . gene_id "SS.106"; transcript_id "SS.106.1"; exon_number "1"; cov "3915.736328"; +CM143126.1 StringTie transcript 441314 441702 1000 . . gene_id "SS.107"; transcript_id "SS.107.1"; cov "5.074550"; FPKM "0.248168"; TPM "0.530670"; +CM143126.1 StringTie exon 441314 441702 1000 . . gene_id "SS.107"; transcript_id "SS.107.1"; exon_number "1"; cov "5.074550"; +CM143126.1 StringTie transcript 436137 438533 1000 . . gene_id "SS.108"; transcript_id "SS.108.1"; cov "49.661243"; FPKM "2.428658"; TPM "5.193313"; +CM143126.1 StringTie exon 436137 438533 1000 . . gene_id "SS.108"; transcript_id "SS.108.1"; exon_number "1"; cov "49.661243"; +CM143126.1 StringTie transcript 438838 441095 1000 . . gene_id "SS.109"; transcript_id "SS.109.1"; cov "18.184677"; FPKM "0.889313"; TPM "1.901659"; +CM143126.1 StringTie exon 438838 441095 1000 . . gene_id "SS.109"; transcript_id "SS.109.1"; exon_number "1"; cov "18.184677"; +CM143126.1 StringTie transcript 443832 451932 1000 . . gene_id "SS.110"; transcript_id "SS.110.1"; cov "888.928034"; FPKM "43.472581"; TPM "92.959451"; +CM143126.1 StringTie exon 443832 451932 1000 . . gene_id "SS.110"; transcript_id "SS.110.1"; exon_number "1"; cov "888.928040"; +CM143126.1 StringTie transcript 452280 453874 1000 . . gene_id "SS.111"; transcript_id "SS.111.1"; cov "549.289655"; FPKM "26.862736"; TPM "57.441843"; +CM143126.1 StringTie exon 452280 453874 1000 . . gene_id "SS.111"; transcript_id "SS.111.1"; exon_number "1"; cov "549.289673"; +CM143126.1 StringTie transcript 454179 456089 1000 + . gene_id "SS.112"; transcript_id "SS.112.1"; cov "768.563804"; FPKM "37.586228"; TPM "80.372388"; +CM143126.1 StringTie exon 454179 454425 1000 + . gene_id "SS.112"; transcript_id "SS.112.1"; exon_number "1"; cov "566.356262"; +CM143126.1 StringTie exon 454707 456089 1000 + . gene_id "SS.112"; transcript_id "SS.112.1"; exon_number "2"; cov "804.677490"; +CM143126.1 StringTie transcript 457183 458018 1000 - . gene_id "SS.113"; transcript_id "SS.113.1"; cov "1205.266754"; FPKM "58.942967"; TPM "126.040502"; +CM143126.1 StringTie exon 457183 457847 1000 - . gene_id "SS.113"; transcript_id "SS.113.1"; exon_number "1"; cov "1314.839111"; +CM143126.1 StringTie exon 457923 458018 1000 - . gene_id "SS.113"; transcript_id "SS.113.1"; exon_number "2"; cov "446.250000"; +CM143126.1 StringTie transcript 458646 460866 1000 - . gene_id "SS.114"; transcript_id "SS.114.1"; cov "3340.612287"; FPKM "163.370972"; TPM "349.343784"; +CM143126.1 StringTie exon 458646 460002 1000 - . gene_id "SS.114"; transcript_id "SS.114.1"; exon_number "1"; cov "3950.696289"; +CM143126.1 StringTie exon 460287 460866 1000 - . gene_id "SS.114"; transcript_id "SS.114.1"; exon_number "2"; cov "1913.225830"; +CM143126.1 StringTie transcript 461426 463041 1000 . . gene_id "SS.115"; transcript_id "SS.115.1"; cov "274.289604"; FPKM "13.413996"; TPM "28.683774"; +CM143126.1 StringTie exon 461426 463041 1000 . . gene_id "SS.115"; transcript_id "SS.115.1"; exon_number "1"; cov "274.289612"; +CM143126.1 StringTie transcript 463261 468232 1000 . . gene_id "SS.116"; transcript_id "SS.116.1"; cov "2022.684232"; FPKM "98.918360"; TPM "211.521752"; +CM143126.1 StringTie exon 463261 468232 1000 . . gene_id "SS.116"; transcript_id "SS.116.1"; exon_number "1"; cov "2022.684204"; +CM143126.1 StringTie transcript 468619 470529 1000 . . gene_id "SS.117"; transcript_id "SS.117.1"; cov "520.057038"; FPKM "25.433129"; TPM "54.384849"; +CM143126.1 StringTie exon 468619 470529 1000 . . gene_id "SS.117"; transcript_id "SS.117.1"; exon_number "1"; cov "520.057068"; +CM143126.1 StringTie transcript 470905 476948 1000 . . gene_id "SS.118"; transcript_id "SS.118.1"; cov "716.659001"; FPKM "35.047850"; TPM "74.944455"; +CM143126.1 StringTie exon 470905 476948 1000 . . gene_id "SS.118"; transcript_id "SS.118.1"; exon_number "1"; cov "716.658997"; +CM143126.1 StringTie transcript 477175 485326 1000 . . gene_id "SS.119"; transcript_id "SS.119.1"; cov "452.185844"; FPKM "22.113922"; TPM "47.287234"; +CM143126.1 StringTie exon 477175 485326 1000 . . gene_id "SS.119"; transcript_id "SS.119.1"; exon_number "1"; cov "452.185852"; +CM143126.1 StringTie transcript 488027 490895 1000 . . gene_id "SS.120"; transcript_id "SS.120.1"; cov "2228.285465"; FPKM "108.973185"; TPM "233.022455"; +CM143126.1 StringTie exon 488027 490895 1000 . . gene_id "SS.120"; transcript_id "SS.120.1"; exon_number "1"; cov "2228.285400"; +CM143126.1 StringTie transcript 491273 492055 1000 . . gene_id "SS.121"; transcript_id "SS.121.1"; cov "16098.241379"; FPKM "787.276436"; TPM "1683.470000"; +CM143126.1 StringTie exon 491273 492055 1000 . . gene_id "SS.121"; transcript_id "SS.121.1"; exon_number "1"; cov "16098.241211"; +CM143126.1 StringTie transcript 498558 502151 1000 . . gene_id "SS.122"; transcript_id "SS.122.1"; cov "2355.563161"; FPKM "115.197637"; TPM "246.332492"; +CM143126.1 StringTie exon 498558 502151 1000 . . gene_id "SS.122"; transcript_id "SS.122.1"; exon_number "1"; cov "2355.563232"; +CM143126.1 StringTie transcript 504443 507216 1000 + . gene_id "SS.123"; transcript_id "SS.123.1"; cov "673.028690"; FPKM "32.914131"; TPM "70.381825"; +CM143126.1 StringTie exon 504443 504539 1000 + . gene_id "SS.123"; transcript_id "SS.123.1"; exon_number "1"; cov "98.185570"; +CM143126.1 StringTie exon 504665 507216 1000 + . gene_id "SS.123"; transcript_id "SS.123.1"; exon_number "2"; cov "694.878113"; +CM143126.1 StringTie transcript 512246 515239 1000 . . gene_id "SS.124"; transcript_id "SS.124.1"; cov "558.134603"; FPKM "27.295293"; TPM "58.366802"; +CM143126.1 StringTie exon 512246 515239 1000 . . gene_id "SS.124"; transcript_id "SS.124.1"; exon_number "1"; cov "558.134583"; +CM143126.1 StringTie transcript 515551 517092 1000 . . gene_id "SS.125"; transcript_id "SS.125.1"; cov "2416.051881"; FPKM "118.155808"; TPM "252.658086"; +CM143126.1 StringTie exon 515551 517092 1000 . . gene_id "SS.125"; transcript_id "SS.125.1"; exon_number "1"; cov "2416.052002"; +CM143126.1 StringTie transcript 517800 518828 1000 . . gene_id "SS.126"; transcript_id "SS.126.1"; cov "5641.516035"; FPKM "275.895518"; TPM "589.960280"; +CM143126.1 StringTie exon 517800 518828 1000 . . gene_id "SS.126"; transcript_id "SS.126.1"; exon_number "1"; cov "5641.516113"; +CM143126.1 StringTie transcript 519064 520866 1000 . . gene_id "SS.127"; transcript_id "SS.127.1"; cov "908.618968"; FPKM "44.435556"; TPM "95.018626"; +CM143126.1 StringTie exon 519064 520866 1000 . . gene_id "SS.127"; transcript_id "SS.127.1"; exon_number "1"; cov "908.618958"; +CM143126.1 StringTie transcript 521337 529498 1000 . . gene_id "SS.128"; transcript_id "SS.128.1"; cov "391.953198"; FPKM "19.168275"; TPM "40.988418"; +CM143126.1 StringTie exon 521337 529498 1000 . . gene_id "SS.128"; transcript_id "SS.128.1"; exon_number "1"; cov "391.953186"; +CM143126.1 StringTie transcript 529715 531540 1000 . . gene_id "SS.129"; transcript_id "SS.129.1"; cov "330.443045"; FPKM "16.160152"; TPM "34.556008"; +CM143126.1 StringTie exon 529715 531540 1000 . . gene_id "SS.129"; transcript_id "SS.129.1"; exon_number "1"; cov "330.443054"; +CM143126.1 StringTie transcript 531812 533407 1000 . . gene_id "SS.130"; transcript_id "SS.130.1"; cov "336.840852"; FPKM "16.473033"; TPM "35.225057"; +CM143126.1 StringTie exon 531812 533407 1000 . . gene_id "SS.130"; transcript_id "SS.130.1"; exon_number "1"; cov "336.840851"; +CM143126.1 StringTie transcript 533665 539706 1000 . . gene_id "SS.131"; transcript_id "SS.131.1"; cov "81.684542"; FPKM "3.994742"; TPM "8.542143"; +CM143126.1 StringTie exon 533665 539706 1000 . . gene_id "SS.131"; transcript_id "SS.131.1"; exon_number "1"; cov "81.684540"; +CM143126.1 StringTie transcript 540012 541261 1000 . . gene_id "SS.132"; transcript_id "SS.132.1"; cov "562.314400"; FPKM "27.499704"; TPM "58.803903"; +CM143126.1 StringTie exon 540012 541261 1000 . . gene_id "SS.132"; transcript_id "SS.132.1"; exon_number "1"; cov "562.314392"; +CM143126.1 StringTie transcript 541570 543860 1000 . . gene_id "SS.133"; transcript_id "SS.133.1"; cov "2084.370144"; FPKM "101.935078"; TPM "217.972543"; +CM143126.1 StringTie exon 541570 543860 1000 . . gene_id "SS.133"; transcript_id "SS.133.1"; exon_number "1"; cov "2084.370117"; +CM143126.1 StringTie transcript 544211 545246 1000 . . gene_id "SS.134"; transcript_id "SS.134.1"; cov "9.678571"; FPKM "0.473326"; TPM "1.012134"; +CM143126.1 StringTie exon 544211 545246 1000 . . gene_id "SS.134"; transcript_id "SS.134.1"; exon_number "1"; cov "9.678572"; +CM143126.1 StringTie transcript 546251 565206 1000 . . gene_id "SS.135"; transcript_id "SS.135.1"; cov "1317.813041"; FPKM "64.446987"; TPM "137.810005"; +CM143126.1 StringTie exon 546251 565206 1000 . . gene_id "SS.135"; transcript_id "SS.135.1"; exon_number "1"; cov "1317.812988"; +CM143126.1 StringTie transcript 565647 567644 1000 . . gene_id "SS.136"; transcript_id "SS.136.1"; cov "1006.363864"; FPKM "49.215721"; TPM "105.240277"; +CM143126.1 StringTie exon 565647 567644 1000 . . gene_id "SS.136"; transcript_id "SS.136.1"; exon_number "1"; cov "1006.363892"; +CM143126.1 StringTie transcript 567969 569091 1000 . . gene_id "SS.137"; transcript_id "SS.137.1"; cov "3315.749777"; FPKM "162.155083"; TPM "346.743793"; +CM143126.1 StringTie exon 567969 569091 1000 . . gene_id "SS.137"; transcript_id "SS.137.1"; exon_number "1"; cov "3315.749756"; +CM143126.1 StringTie transcript 569448 570966 1000 . . gene_id "SS.138"; transcript_id "SS.138.1"; cov "1137.952600"; FPKM "55.651002"; TPM "119.001139"; +CM143126.1 StringTie exon 569448 570966 1000 . . gene_id "SS.138"; transcript_id "SS.138.1"; exon_number "1"; cov "1137.952637"; +CM143126.1 StringTie transcript 571778 573545 1000 . . gene_id "SS.139"; transcript_id "SS.139.1"; cov "218.766403"; FPKM "10.698661"; TPM "22.877448"; +CM143126.1 StringTie exon 571778 573545 1000 . . gene_id "SS.139"; transcript_id "SS.139.1"; exon_number "1"; cov "218.766403"; +CM143126.1 StringTie transcript 574728 577282 1000 - . gene_id "SS.140"; transcript_id "SS.140.1"; cov "1823.795100"; FPKM "89.191786"; TPM "190.722966"; +CM143126.1 StringTie exon 574728 576462 1000 - . gene_id "SS.140"; transcript_id "SS.140.1"; exon_number "1"; cov "1904.852783"; +CM143126.1 StringTie exon 576863 576898 1000 - . gene_id "SS.140"; transcript_id "SS.140.1"; exon_number "2"; cov "1105.972168"; +CM143126.1 StringTie exon 577197 577282 1000 - . gene_id "SS.140"; transcript_id "SS.140.1"; exon_number "3"; cov "488.988373"; +CM143126.1 StringTie transcript 578588 582320 1000 . . gene_id "SS.141"; transcript_id "SS.141.1"; cov "702.714171"; FPKM "34.365885"; TPM "73.486178"; +CM143126.1 StringTie exon 578588 582320 1000 . . gene_id "SS.141"; transcript_id "SS.141.1"; exon_number "1"; cov "702.714172"; +CM143126.1 StringTie transcript 582571 589643 1000 . . gene_id "SS.142"; transcript_id "SS.142.1"; cov "96.864723"; FPKM "4.737121"; TPM "10.129607"; +CM143126.1 StringTie exon 582571 589643 1000 . . gene_id "SS.142"; transcript_id "SS.142.1"; exon_number "1"; cov "96.864723"; +CM143126.1 StringTie transcript 590107 598169 1000 . . gene_id "SS.143"; transcript_id "SS.143.1"; cov "371.141759"; FPKM "18.150502"; TPM "38.812067"; +CM143126.1 StringTie exon 590107 598169 1000 . . gene_id "SS.143"; transcript_id "SS.143.1"; exon_number "1"; cov "371.141754"; +CM143126.1 StringTie transcript 598427 616914 1000 . . gene_id "SS.144"; transcript_id "SS.144.1"; cov "278.498756"; FPKM "13.619842"; TPM "29.123945"; +CM143126.1 StringTie exon 598427 616914 1000 . . gene_id "SS.144"; transcript_id "SS.144.1"; exon_number "1"; cov "278.498749"; +CM143126.1 StringTie transcript 617520 618875 1000 . . gene_id "SS.145"; transcript_id "SS.145.1"; cov "735.428466"; FPKM "35.965761"; TPM "76.907268"; +CM143126.1 StringTie exon 617520 618875 1000 . . gene_id "SS.145"; transcript_id "SS.145.1"; exon_number "1"; cov "735.428467"; +CM143126.1 StringTie transcript 619200 621186 1000 . . gene_id "SS.146"; transcript_id "SS.146.1"; cov "259.621540"; FPKM "12.696661"; TPM "27.149865"; +CM143126.1 StringTie exon 619200 621186 1000 . . gene_id "SS.146"; transcript_id "SS.146.1"; exon_number "1"; cov "259.621552"; +CM143126.1 StringTie transcript 622824 624651 1000 - . gene_id "SS.147"; transcript_id "SS.147.1"; cov "1088.588270"; FPKM "53.236864"; TPM "113.838875"; +CM143126.1 StringTie exon 622824 624376 1000 - . gene_id "SS.147"; transcript_id "SS.147.1"; exon_number "1"; cov "1139.511230"; +CM143126.1 StringTie exon 624500 624651 1000 - . gene_id "SS.147"; transcript_id "SS.147.1"; exon_number "2"; cov "568.302612"; +CM143126.1 StringTie transcript 625333 626533 1000 . . gene_id "SS.148"; transcript_id "SS.148.1"; cov "1871.111574"; FPKM "91.505775"; TPM "195.671075"; +CM143126.1 StringTie exon 625333 626533 1000 . . gene_id "SS.148"; transcript_id "SS.148.1"; exon_number "1"; cov "1871.111572"; +CM143126.1 StringTie transcript 626903 632710 1000 . . gene_id "SS.149"; transcript_id "SS.149.1"; cov "229.416494"; FPKM "11.219499"; TPM "23.991179"; +CM143126.1 StringTie exon 626903 632710 1000 . . gene_id "SS.149"; transcript_id "SS.149.1"; exon_number "1"; cov "229.416489"; +CM143126.1 StringTie transcript 633063 635111 1000 . . gene_id "SS.150"; transcript_id "SS.150.1"; cov "4550.009761"; FPKM "222.515950"; TPM "475.816255"; +CM143126.1 StringTie exon 633063 635111 1000 . . gene_id "SS.150"; transcript_id "SS.150.1"; exon_number "1"; cov "4550.009766"; +CM143126.1 StringTie transcript 636897 639789 1000 - . gene_id "SS.151"; transcript_id "SS.151.1"; cov "1676.411285"; FPKM "81.984055"; TPM "175.310336"; +CM143126.1 StringTie exon 636897 639473 1000 - . gene_id "SS.151"; transcript_id "SS.151.1"; exon_number "1"; cov "1780.282837"; +CM143126.1 StringTie exon 639549 639789 1000 - . gene_id "SS.151"; transcript_id "SS.151.1"; exon_number "2"; cov "565.717834"; +CM143126.1 StringTie transcript 643850 648868 1000 . . gene_id "SS.152"; transcript_id "SS.152.1"; cov "1436.226838"; FPKM "70.237955"; TPM "150.193101"; +CM143126.1 StringTie exon 643850 648868 1000 . . gene_id "SS.152"; transcript_id "SS.152.1"; exon_number "1"; cov "1436.226807"; +CM143126.1 StringTie transcript 665333 670572 1000 . . gene_id "SS.153"; transcript_id "SS.153.1"; cov "236.599618"; FPKM "11.570786"; TPM "24.742352"; +CM143126.1 StringTie exon 665333 670572 1000 . . gene_id "SS.153"; transcript_id "SS.153.1"; exon_number "1"; cov "236.599625"; +CM143126.1 StringTie transcript 671181 674786 1000 . . gene_id "SS.154"; transcript_id "SS.154.1"; cov "543.410150"; FPKM "26.575201"; TPM "56.826995"; +CM143126.1 StringTie exon 671181 674786 1000 . . gene_id "SS.154"; transcript_id "SS.154.1"; exon_number "1"; cov "543.410156"; +CM143126.1 StringTie transcript 681276 684644 1000 . . gene_id "SS.155"; transcript_id "SS.155.1"; cov "1596.923716"; FPKM "78.096755"; TPM "166.997941"; +CM143126.1 StringTie exon 681276 684644 1000 . . gene_id "SS.155"; transcript_id "SS.155.1"; exon_number "1"; cov "1596.923706"; +CM143126.1 StringTie transcript 684924 685723 1000 . . gene_id "SS.156"; transcript_id "SS.156.1"; cov "4.971250"; FPKM "0.243116"; TPM "0.519867"; +CM143126.1 StringTie exon 684924 685723 1000 . . gene_id "SS.156"; transcript_id "SS.156.1"; exon_number "1"; cov "4.971250"; +CM143126.1 StringTie transcript 686007 689086 1000 . . gene_id "SS.157"; transcript_id "SS.157.1"; cov "724.126623"; FPKM "35.413050"; TPM "75.725380"; +CM143126.1 StringTie exon 686007 689086 1000 . . gene_id "SS.157"; transcript_id "SS.157.1"; exon_number "1"; cov "724.126648"; +CM143126.1 StringTie transcript 689417 690203 1000 . . gene_id "SS.158"; transcript_id "SS.158.1"; cov "2995.739517"; FPKM "146.505141"; TPM "313.278792"; +CM143126.1 StringTie exon 689417 690203 1000 . . gene_id "SS.158"; transcript_id "SS.158.1"; exon_number "1"; cov "2995.739502"; +CM143126.1 StringTie transcript 690704 692336 1000 . . gene_id "SS.159"; transcript_id "SS.159.1"; cov "288.401715"; FPKM "14.104141"; TPM "30.159545"; +CM143126.1 StringTie exon 690704 692336 1000 . . gene_id "SS.159"; transcript_id "SS.159.1"; exon_number "1"; cov "288.401703"; +CM143126.1 StringTie transcript 694007 696322 1000 . . gene_id "SS.160"; transcript_id "SS.160.1"; cov "1451.367444"; FPKM "70.978398"; TPM "151.776427"; +CM143126.1 StringTie exon 694007 696322 1000 . . gene_id "SS.160"; transcript_id "SS.160.1"; exon_number "1"; cov "1451.367432"; +CM143126.1 StringTie transcript 697236 698327 1000 . . gene_id "SS.161"; transcript_id "SS.161.1"; cov "1523.035714"; FPKM "74.483299"; TPM "159.271120"; +CM143126.1 StringTie exon 697236 698327 1000 . . gene_id "SS.161"; transcript_id "SS.161.1"; exon_number "1"; cov "1523.035767"; +CM143126.1 StringTie transcript 698785 700813 1000 . . gene_id "SS.162"; transcript_id "SS.162.1"; cov "885.007886"; FPKM "43.280868"; TPM "92.549502"; +CM143126.1 StringTie exon 698785 700813 1000 . . gene_id "SS.162"; transcript_id "SS.162.1"; exon_number "1"; cov "885.007874"; +CM143126.1 StringTie transcript 703020 707609 1000 . . gene_id "SS.163"; transcript_id "SS.163.1"; cov "418.785839"; FPKM "20.480512"; TPM "43.794436"; +CM143126.1 StringTie exon 703020 707609 1000 . . gene_id "SS.163"; transcript_id "SS.163.1"; exon_number "1"; cov "418.785828"; +CM143126.1 StringTie transcript 708484 710313 1000 . . gene_id "SS.164"; transcript_id "SS.164.1"; cov "1138.808197"; FPKM "55.692845"; TPM "119.090613"; +CM143126.1 StringTie exon 708484 710313 1000 . . gene_id "SS.164"; transcript_id "SS.164.1"; exon_number "1"; cov "1138.808228"; +CM143126.1 StringTie transcript 711051 712296 1000 . . gene_id "SS.165"; transcript_id "SS.165.1"; cov "24872.956661"; FPKM "1216.399494"; TPM "2601.083893"; +CM143126.1 StringTie exon 711051 712296 1000 . . gene_id "SS.165"; transcript_id "SS.165.1"; exon_number "1"; cov "24872.957031"; +CM143126.1 StringTie transcript 743574 747138 1000 . . gene_id "SS.166"; transcript_id "SS.166.1"; cov "165.371108"; FPKM "8.087391"; TPM "17.293647"; +CM143126.1 StringTie exon 743574 747138 1000 . . gene_id "SS.166"; transcript_id "SS.166.1"; exon_number "1"; cov "165.371109"; +CM143126.1 StringTie transcript 715035 716060 1000 . . gene_id "SS.167"; transcript_id "SS.167.1"; cov "763.111111"; FPKM "37.319567"; TPM "79.802174"; +CM143126.1 StringTie exon 715035 716060 1000 . . gene_id "SS.167"; transcript_id "SS.167.1"; exon_number "1"; cov "763.111084"; +CM143126.1 StringTie transcript 717778 718473 1000 . . gene_id "SS.168"; transcript_id "SS.168.1"; cov "6305.152299"; FPKM "308.350317"; TPM "659.359895"; +CM143126.1 StringTie exon 717778 718473 1000 . . gene_id "SS.168"; transcript_id "SS.168.1"; exon_number "1"; cov "6305.152344"; +CM143126.1 StringTie transcript 727968 731638 1000 . . gene_id "SS.169"; transcript_id "SS.169.1"; cov "3906.995642"; FPKM "191.069666"; TPM "408.573197"; +CM143126.1 StringTie exon 727968 731638 1000 . . gene_id "SS.169"; transcript_id "SS.169.1"; exon_number "1"; cov "3906.995605"; +CM143126.1 StringTie transcript 732021 743166 1000 . . gene_id "SS.170"; transcript_id "SS.170.1"; cov "220.210928"; FPKM "10.769305"; TPM "23.028509"; +CM143126.1 StringTie exon 732021 743166 1000 . . gene_id "SS.170"; transcript_id "SS.170.1"; exon_number "1"; cov "220.210922"; +CM143126.1 StringTie transcript 747732 749759 1000 . . gene_id "SS.171"; transcript_id "SS.171.1"; cov "153.190335"; FPKM "7.491697"; TPM "16.019845"; +CM143126.1 StringTie exon 747732 749759 1000 . . gene_id "SS.171"; transcript_id "SS.171.1"; exon_number "1"; cov "153.190338"; +CM143126.1 StringTie transcript 750196 752853 1000 . . gene_id "SS.172"; transcript_id "SS.172.1"; cov "2397.916102"; FPKM "117.268887"; TPM "250.761541"; +CM143126.1 StringTie exon 750196 752853 1000 . . gene_id "SS.172"; transcript_id "SS.172.1"; exon_number "1"; cov "2397.916016"; +CM143126.1 StringTie transcript 753567 754883 1000 . . gene_id "SS.173"; transcript_id "SS.173.1"; cov "3334.508732"; FPKM "163.072480"; TPM "348.705507"; +CM143126.1 StringTie exon 753567 754883 1000 . . gene_id "SS.173"; transcript_id "SS.173.1"; exon_number "1"; cov "3334.508789"; +CM143126.1 StringTie transcript 755366 756349 1000 . . gene_id "SS.174"; transcript_id "SS.174.1"; cov "2159.066057"; FPKM "105.588045"; TPM "225.783851"; +CM143126.1 StringTie exon 755366 756349 1000 . . gene_id "SS.174"; transcript_id "SS.174.1"; exon_number "1"; cov "2159.066162"; +CM143126.1 StringTie transcript 756569 759563 1000 . . gene_id "SS.175"; transcript_id "SS.175.1"; cov "148.983973"; FPKM "7.285987"; TPM "15.579966"; +CM143126.1 StringTie exon 756569 759563 1000 . . gene_id "SS.175"; transcript_id "SS.175.1"; exon_number "1"; cov "148.983978"; +CM143126.1 StringTie transcript 759969 762201 1000 . . gene_id "SS.176"; transcript_id "SS.176.1"; cov "269.351097"; FPKM "13.172481"; TPM "28.167331"; +CM143126.1 StringTie exon 759969 762201 1000 . . gene_id "SS.176"; transcript_id "SS.176.1"; exon_number "1"; cov "269.351105"; +CM143126.1 StringTie transcript 762601 763526 1000 . . gene_id "SS.177"; transcript_id "SS.177.1"; cov "4356.263499"; FPKM "213.040886"; TPM "455.555283"; +CM143126.1 StringTie exon 762601 763526 1000 . . gene_id "SS.177"; transcript_id "SS.177.1"; exon_number "1"; cov "4356.263672"; +CM143126.1 StringTie transcript 765268 769412 1000 . . gene_id "SS.178"; transcript_id "SS.178.1"; cov "1272.977322"; FPKM "62.254319"; TPM "133.121319"; +CM143126.1 StringTie exon 765268 769412 1000 . . gene_id "SS.178"; transcript_id "SS.178.1"; exon_number "1"; cov "1272.977295"; +CM143126.1 StringTie transcript 770015 778870 1000 . . gene_id "SS.179"; transcript_id "SS.179.1"; cov "379.766599"; FPKM "18.572295"; TPM "39.714007"; +CM143126.1 StringTie exon 770015 778870 1000 . . gene_id "SS.179"; transcript_id "SS.179.1"; exon_number "1"; cov "379.766602"; +CM143126.1 StringTie transcript 779192 779816 1000 . . gene_id "SS.180"; transcript_id "SS.180.1"; cov "1110.227200"; FPKM "54.295105"; TPM "116.101762"; +CM143126.1 StringTie exon 779192 779816 1000 . . gene_id "SS.180"; transcript_id "SS.180.1"; exon_number "1"; cov "1110.227173"; +CM143126.1 StringTie transcript 780181 782823 1000 . . gene_id "SS.181"; transcript_id "SS.181.1"; cov "197.243663"; FPKM "9.646103"; TPM "20.626712"; +CM143126.1 StringTie exon 780181 782823 1000 . . gene_id "SS.181"; transcript_id "SS.181.1"; exon_number "1"; cov "197.243668"; +CM143126.1 StringTie transcript 784107 787163 1000 . . gene_id "SS.182"; transcript_id "SS.182.1"; cov "341.982908"; FPKM "16.724503"; TPM "35.762786"; +CM143126.1 StringTie exon 784107 787163 1000 . . gene_id "SS.182"; transcript_id "SS.182.1"; exon_number "1"; cov "341.982910"; +CM143126.1 StringTie transcript 787551 790458 1000 . . gene_id "SS.183"; transcript_id "SS.183.1"; cov "20.777510"; FPKM "1.016114"; TPM "2.172803"; +CM143126.1 StringTie exon 787551 790458 1000 . . gene_id "SS.183"; transcript_id "SS.183.1"; exon_number "1"; cov "20.777510"; +CM143126.1 StringTie transcript 790763 793842 1000 + . gene_id "SS.184"; transcript_id "SS.184.1"; cov "1192.710580"; FPKM "58.328914"; TPM "124.727443"; +CM143126.1 StringTie exon 790763 790854 1000 + . gene_id "SS.184"; transcript_id "SS.184.1"; exon_number "1"; cov "742.978271"; +CM143126.1 StringTie exon 791005 793842 1000 + . gene_id "SS.184"; transcript_id "SS.184.1"; exon_number "2"; cov "1207.289673"; +CM143126.1 StringTie transcript 794492 795102 1000 . . gene_id "SS.185"; transcript_id "SS.185.1"; cov "5536.636661"; FPKM "270.766444"; TPM "578.992543"; +CM143126.1 StringTie exon 794492 795102 1000 . . gene_id "SS.185"; transcript_id "SS.185.1"; exon_number "1"; cov "5536.636719"; +CM143126.1 StringTie transcript 797250 798226 1000 . . gene_id "SS.186"; transcript_id "SS.186.1"; cov "3424.037871"; FPKM "167.450858"; TPM "358.067996"; +CM143126.1 StringTie exon 797250 798226 1000 . . gene_id "SS.186"; transcript_id "SS.186.1"; exon_number "1"; cov "3424.037842"; +CM143126.1 StringTie transcript 798583 799348 1000 . . gene_id "SS.187"; transcript_id "SS.187.1"; cov "16.045692"; FPKM "0.784707"; TPM "1.677975"; +CM143126.1 StringTie exon 798583 799348 1000 . . gene_id "SS.187"; transcript_id "SS.187.1"; exon_number "1"; cov "16.045692"; +CM143126.1 StringTie transcript 800041 804635 1000 . . gene_id "SS.188"; transcript_id "SS.188.1"; cov "1111.833079"; FPKM "54.373640"; TPM "116.269696"; +CM143126.1 StringTie exon 800041 804635 1000 . . gene_id "SS.188"; transcript_id "SS.188.1"; exon_number "1"; cov "1111.833130"; +CM143126.1 StringTie transcript 805975 807860 1000 . . gene_id "SS.189"; transcript_id "SS.189.1"; cov "759.274125"; FPKM "37.131921"; TPM "79.400922"; +CM143126.1 StringTie exon 805975 807860 1000 . . gene_id "SS.189"; transcript_id "SS.189.1"; exon_number "1"; cov "759.274109"; +CM143126.1 StringTie transcript 821112 822681 1000 . . gene_id "SS.190"; transcript_id "SS.190.1"; cov "1990.739490"; FPKM "97.356118"; TPM "208.181138"; +CM143126.1 StringTie exon 821112 822681 1000 . . gene_id "SS.190"; transcript_id "SS.190.1"; exon_number "1"; cov "1990.739502"; +CM143126.1 StringTie transcript 824738 825852 1000 . . gene_id "SS.191"; transcript_id "SS.191.1"; cov "8972.814350"; FPKM "438.810994"; TPM "938.330058"; +CM143126.1 StringTie exon 824738 825852 1000 . . gene_id "SS.191"; transcript_id "SS.191.1"; exon_number "1"; cov "8972.814453"; +CM143126.1 StringTie transcript 826636 832572 1000 . . gene_id "SS.192"; transcript_id "SS.192.1"; cov "260.636854"; FPKM "12.746315"; TPM "27.256041"; +CM143126.1 StringTie exon 826636 832572 1000 . . gene_id "SS.192"; transcript_id "SS.192.1"; exon_number "1"; cov "260.636841"; +CM143126.1 StringTie transcript 833053 834921 1000 . . gene_id "SS.193"; transcript_id "SS.193.1"; cov "69.044944"; FPKM "3.376608"; TPM "7.220360"; +CM143126.1 StringTie exon 833053 834921 1000 . . gene_id "SS.193"; transcript_id "SS.193.1"; exon_number "1"; cov "69.044945"; +CM143126.1 StringTie transcript 835247 836156 1000 - . gene_id "SS.194"; transcript_id "SS.194.1"; cov "31.546746"; FPKM "1.542778"; TPM "3.298994"; +CM143126.1 StringTie exon 835247 835603 1000 - . gene_id "SS.194"; transcript_id "SS.194.1"; exon_number "1"; cov "49.302521"; +CM143126.1 StringTie exon 835669 836156 1000 - . gene_id "SS.194"; transcript_id "SS.194.1"; exon_number "2"; cov "18.557377"; +CM143126.1 StringTie transcript 836375 844325 1000 . . gene_id "SS.195"; transcript_id "SS.195.1"; cov "361.459942"; FPKM "17.677018"; TPM "37.799593"; +CM143126.1 StringTie exon 836375 844325 1000 . . gene_id "SS.195"; transcript_id "SS.195.1"; exon_number "1"; cov "361.459930"; +CM143126.1 StringTie transcript 844631 846709 1000 . . gene_id "SS.196"; transcript_id "SS.196.1"; cov "5437.592593"; FPKM "265.922744"; TPM "568.635032"; +CM143126.1 StringTie exon 844631 846709 1000 . . gene_id "SS.196"; transcript_id "SS.196.1"; exon_number "1"; cov "5437.592773"; +CM143126.1 StringTie transcript 847612 848682 1000 . . gene_id "SS.197"; transcript_id "SS.197.1"; cov "3796.949580"; FPKM "185.687918"; TPM "397.065155"; +CM143126.1 StringTie exon 847612 848682 1000 . . gene_id "SS.197"; transcript_id "SS.197.1"; exon_number "1"; cov "3796.949463"; +CM143126.1 StringTie transcript 849020 850157 1000 . . gene_id "SS.198"; transcript_id "SS.198.1"; cov "4279.144112"; FPKM "209.269401"; TPM "447.490541"; +CM143126.1 StringTie exon 849020 850157 1000 . . gene_id "SS.198"; transcript_id "SS.198.1"; exon_number "1"; cov "4279.144043"; +CM143126.1 StringTie transcript 850870 851422 1000 . . gene_id "SS.199"; transcript_id "SS.199.1"; cov "26642.871609"; FPKM "1302.956299"; TPM "2786.172353"; +CM143126.1 StringTie exon 850870 851422 1000 . . gene_id "SS.199"; transcript_id "SS.199.1"; exon_number "1"; cov "26642.871094"; +CM143126.1 StringTie transcript 857915 858859 1000 . . gene_id "SS.200"; transcript_id "SS.200.1"; cov "4978.264550"; FPKM "243.459536"; TPM "520.600904"; +CM143126.1 StringTie exon 857915 858859 1000 . . gene_id "SS.200"; transcript_id "SS.200.1"; exon_number "1"; cov "4978.264648"; +CM143126.1 StringTie transcript 859382 860466 1000 + . gene_id "SS.201"; transcript_id "SS.201.1"; cov "8835.295309"; FPKM "432.085694"; TPM "923.949035"; +CM143126.1 StringTie exon 859382 859593 1000 + . gene_id "SS.201"; transcript_id "SS.201.1"; exon_number "1"; cov "5775.868164"; +CM143126.1 StringTie exon 860210 860466 1000 + . gene_id "SS.201"; transcript_id "SS.201.1"; exon_number "2"; cov "11359.025391"; +CM143126.1 StringTie transcript 868294 869250 1000 . . gene_id "SS.202"; transcript_id "SS.202.1"; cov "6094.168234"; FPKM "298.032247"; TPM "637.296283"; +CM143126.1 StringTie exon 868294 869250 1000 . . gene_id "SS.202"; transcript_id "SS.202.1"; exon_number "1"; cov "6094.168457"; +CM143126.1 StringTie transcript 870803 876478 1000 . . gene_id "SS.203"; transcript_id "SS.203.1"; cov "975.786822"; FPKM "47.720366"; TPM "102.042689"; +CM143126.1 StringTie exon 870803 876478 1000 . . gene_id "SS.203"; transcript_id "SS.203.1"; exon_number "1"; cov "975.786804"; +CM143126.1 StringTie transcript 877408 877773 1000 . . gene_id "SS.204"; transcript_id "SS.204.1"; cov "7.352459"; FPKM "0.359568"; TPM "0.768882"; +CM143126.1 StringTie exon 877408 877773 1000 . . gene_id "SS.204"; transcript_id "SS.204.1"; exon_number "1"; cov "7.352459"; +CM143126.1 StringTie transcript 879118 882270 1000 . . gene_id "SS.205"; transcript_id "SS.205.1"; cov "1019.003172"; FPKM "49.833840"; TPM "106.562029"; +CM143126.1 StringTie exon 879118 882270 1000 . . gene_id "SS.205"; transcript_id "SS.205.1"; exon_number "1"; cov "1019.003174"; +CM143126.1 StringTie transcript 882558 885012 1000 - . gene_id "SS.206"; transcript_id "SS.206.1"; cov "3782.885648"; FPKM "185.000129"; TPM "395.594423"; +CM143126.1 StringTie exon 882558 883089 1000 - . gene_id "SS.206"; transcript_id "SS.206.1"; exon_number "1"; cov "4158.980469"; +CM143126.1 StringTie exon 883940 883969 1000 - . gene_id "SS.206"; transcript_id "SS.206.1"; exon_number "2"; cov "5718.866699"; +CM143126.1 StringTie exon 884718 885012 1000 - . gene_id "SS.206"; transcript_id "SS.206.1"; exon_number "3"; cov "2907.760986"; +CM143126.1 StringTie transcript 885455 886287 1000 + . gene_id "SS.207"; transcript_id "SS.207.1"; cov "66.057333"; FPKM "3.230501"; TPM "6.907931"; +CM143126.1 StringTie exon 885455 885758 1000 + . gene_id "SS.207"; transcript_id "SS.207.1"; exon_number "1"; cov "66.490135"; +CM143126.1 StringTie exon 885842 886287 1000 + . gene_id "SS.207"; transcript_id "SS.207.1"; exon_number "2"; cov "65.762329"; +CM143126.1 StringTie transcript 887523 888747 1000 - . gene_id "SS.208"; transcript_id "SS.208.1"; cov "8754.126571"; FPKM "428.116178"; TPM "915.460833"; +CM143126.1 StringTie exon 887523 887968 1000 - . gene_id "SS.208"; transcript_id "SS.208.1"; exon_number "1"; cov "10829.461914"; +CM143126.1 StringTie exon 888637 888747 1000 - . gene_id "SS.208"; transcript_id "SS.208.1"; exon_number "2"; cov "415.391907"; +CM143126.1 StringTie transcript 889271 891188 1000 . . gene_id "SS.209"; transcript_id "SS.209.1"; cov "460.702815"; FPKM "22.530441"; TPM "48.177894"; +CM143126.1 StringTie exon 889271 891188 1000 . . gene_id "SS.209"; transcript_id "SS.209.1"; exon_number "1"; cov "460.702820"; +CM143126.1 StringTie transcript 891393 892429 1000 . . gene_id "SS.210"; transcript_id "SS.210.1"; cov "390.530376"; FPKM "19.098693"; TPM "40.839627"; +CM143126.1 StringTie exon 891393 892429 1000 . . gene_id "SS.210"; transcript_id "SS.210.1"; exon_number "1"; cov "390.530365"; +CM143126.1 StringTie transcript 895322 898335 1000 + . gene_id "SS.211"; transcript_id "SS.211.1"; cov "68.279821"; FPKM "3.339190"; TPM "7.140347"; +CM143126.1 StringTie exon 895322 895793 1000 + . gene_id "SS.211"; transcript_id "SS.211.1"; exon_number "1"; cov "11.186631"; +CM143126.1 StringTie exon 895907 898335 1000 + . gene_id "SS.211"; transcript_id "SS.211.1"; exon_number "2"; cov "79.374092"; +CM143126.1 StringTie transcript 895588 898335 1000 + . gene_id "SS.211"; transcript_id "SS.211.2"; cov "582.365820"; FPKM "28.480309"; TPM "60.900776"; +CM143126.1 StringTie exon 895588 895820 1000 + . gene_id "SS.211"; transcript_id "SS.211.2"; exon_number "1"; cov "126.459496"; +CM143126.1 StringTie exon 895907 898335 1000 + . gene_id "SS.211"; transcript_id "SS.211.2"; exon_number "2"; cov "626.098267"; +CM143126.1 StringTie transcript 895588 898335 1000 + . gene_id "SS.211"; transcript_id "SS.211.3"; cov "75.223668"; FPKM "3.678776"; TPM "7.866498"; +CM143126.1 StringTie exon 895588 895820 1000 + . gene_id "SS.211"; transcript_id "SS.211.3"; exon_number "1"; cov "14.621666"; +CM143126.1 StringTie exon 896430 898335 1000 + . gene_id "SS.211"; transcript_id "SS.211.3"; exon_number "2"; cov "82.631996"; +CM143126.1 StringTie transcript 905731 906477 1000 . . gene_id "SS.212"; transcript_id "SS.212.1"; cov "22.409639"; FPKM "1.095932"; TPM "2.343483"; +CM143126.1 StringTie exon 905731 906477 1000 . . gene_id "SS.212"; transcript_id "SS.212.1"; exon_number "1"; cov "22.409639"; +CM143126.1 StringTie transcript 901681 903082 1000 . . gene_id "SS.213"; transcript_id "SS.213.1"; cov "1731.512839"; FPKM "84.678769"; TPM "181.072569"; +CM143126.1 StringTie exon 901681 903082 1000 . . gene_id "SS.213"; transcript_id "SS.213.1"; exon_number "1"; cov "1731.512817"; +CM143126.1 StringTie transcript 903798 905333 1000 - . gene_id "SS.214"; transcript_id "SS.214.1"; cov "2644.541377"; FPKM "129.329972"; TPM "276.552324"; +CM143126.1 StringTie exon 903798 904873 1000 - . gene_id "SS.214"; transcript_id "SS.214.1"; exon_number "1"; cov "2959.967529"; +CM143126.1 StringTie exon 905117 905333 1000 - . gene_id "SS.214"; transcript_id "SS.214.1"; exon_number "2"; cov "1080.493042"; +CM143126.1 StringTie transcript 922068 923418 1000 . . gene_id "SS.215"; transcript_id "SS.215.1"; cov "18.581032"; FPKM "0.908696"; TPM "1.943107"; +CM143126.1 StringTie exon 922068 923418 1000 . . gene_id "SS.215"; transcript_id "SS.215.1"; exon_number "1"; cov "18.581032"; +CM143126.1 StringTie transcript 924160 928059 1000 . . gene_id "SS.216"; transcript_id "SS.216.1"; cov "77.142179"; FPKM "3.772600"; TPM "8.067126"; +CM143126.1 StringTie exon 924160 928059 1000 . . gene_id "SS.216"; transcript_id "SS.216.1"; exon_number "1"; cov "77.142181"; +CM143126.1 StringTie transcript 929014 930445 1000 . . gene_id "SS.217"; transcript_id "SS.217.1"; cov "40.037709"; FPKM "1.958024"; TPM "4.186934"; +CM143126.1 StringTie exon 929014 930445 1000 . . gene_id "SS.217"; transcript_id "SS.217.1"; exon_number "1"; cov "40.037708"; +CM143126.1 StringTie transcript 907017 913529 1000 . . gene_id "SS.218"; transcript_id "SS.218.1"; cov "66.556286"; FPKM "3.254902"; TPM "6.960109"; +CM143126.1 StringTie exon 907017 913529 1000 . . gene_id "SS.218"; transcript_id "SS.218.1"; exon_number "1"; cov "66.556290"; +CM143126.1 StringTie transcript 907017 916527 1000 - . gene_id "SS.219"; transcript_id "SS.219.1"; cov "19.227964"; FPKM "0.940334"; TPM "2.010760"; +CM143126.1 StringTie exon 907017 911534 1000 - . gene_id "SS.219"; transcript_id "SS.219.1"; exon_number "1"; cov "18.404951"; +CM143126.1 StringTie exon 914286 916527 1000 - . gene_id "SS.219"; transcript_id "SS.219.1"; exon_number "2"; cov "20.886471"; +CM143126.1 StringTie transcript 916744 921329 1000 - . gene_id "SS.220"; transcript_id "SS.220.1"; cov "3640.726828"; FPKM "178.047923"; TPM "380.728196"; +CM143126.1 StringTie exon 916744 920782 1000 - . gene_id "SS.220"; transcript_id "SS.220.1"; exon_number "1"; cov "3639.561768"; +CM143126.1 StringTie exon 921280 921329 1000 - . gene_id "SS.220"; transcript_id "SS.220.1"; exon_number "2"; cov "3734.840088"; +CM143126.1 StringTie transcript 932288 934048 1000 . . gene_id "SS.221"; transcript_id "SS.221.1"; cov "128.028863"; FPKM "6.261187"; TPM "13.388590"; +CM143126.1 StringTie exon 932288 934048 1000 . . gene_id "SS.221"; transcript_id "SS.221.1"; exon_number "1"; cov "128.028870"; +CM143126.1 StringTie transcript 939562 941231 1000 . . gene_id "SS.222"; transcript_id "SS.222.1"; cov "803.300000"; FPKM "39.284984"; TPM "84.004918"; +CM143126.1 StringTie exon 939562 941231 1000 . . gene_id "SS.222"; transcript_id "SS.222.1"; exon_number "1"; cov "803.299988"; +CM143126.1 StringTie transcript 941488 943334 1000 . . gene_id "SS.223"; transcript_id "SS.223.1"; cov "860.759136"; FPKM "42.094995"; TPM "90.013695"; +CM143126.1 StringTie exon 941488 943334 1000 . . gene_id "SS.223"; transcript_id "SS.223.1"; exon_number "1"; cov "860.759155"; +CM143126.1 StringTie transcript 943687 952081 1000 . . gene_id "SS.224"; transcript_id "SS.224.1"; cov "208.211316"; FPKM "10.182470"; TPM "21.773652"; +CM143126.1 StringTie exon 943687 952081 1000 . . gene_id "SS.224"; transcript_id "SS.224.1"; exon_number "1"; cov "208.211319"; +CM143126.1 StringTie transcript 953228 957105 1000 . . gene_id "SS.225"; transcript_id "SS.225.1"; cov "811.551057"; FPKM "39.688498"; TPM "84.867771"; +CM143126.1 StringTie exon 953228 957105 1000 . . gene_id "SS.225"; transcript_id "SS.225.1"; exon_number "1"; cov "811.551086"; +CM143126.1 StringTie transcript 959406 965315 1000 + . gene_id "SS.226"; transcript_id "SS.226.1"; cov "318.343943"; FPKM "15.568451"; TPM "33.290747"; +CM143126.1 StringTie exon 959406 959539 1000 + . gene_id "SS.226"; transcript_id "SS.226.1"; exon_number "1"; cov "54.947762"; +CM143126.1 StringTie exon 959606 965315 1000 + . gene_id "SS.226"; transcript_id "SS.226.1"; exon_number "2"; cov "324.525208"; +CM143126.1 StringTie transcript 965646 969184 1000 . . gene_id "SS.227"; transcript_id "SS.227.1"; cov "177.926815"; FPKM "8.701422"; TPM "18.606657"; +CM143126.1 StringTie exon 965646 969184 1000 . . gene_id "SS.227"; transcript_id "SS.227.1"; exon_number "1"; cov "177.926819"; +CM143126.1 StringTie transcript 969653 978560 1000 . . gene_id "SS.228"; transcript_id "SS.228.1"; cov "1345.584755"; FPKM "65.805149"; TPM "140.714225"; +CM143126.1 StringTie exon 969653 978560 1000 . . gene_id "SS.228"; transcript_id "SS.228.1"; exon_number "1"; cov "1345.584717"; +CM143126.1 StringTie transcript 978814 983015 1000 . . gene_id "SS.229"; transcript_id "SS.229.1"; cov "345.521894"; FPKM "16.897575"; TPM "36.132875"; +CM143126.1 StringTie exon 978814 983015 1000 . . gene_id "SS.229"; transcript_id "SS.229.1"; exon_number "1"; cov "345.521881"; +CM143126.1 StringTie transcript 983198 1003097 1000 . . gene_id "SS.230"; transcript_id "SS.230.1"; cov "654.898442"; FPKM "32.027480"; TPM "68.485858"; +CM143126.1 StringTie exon 983198 1003097 1000 . . gene_id "SS.230"; transcript_id "SS.230.1"; exon_number "1"; cov "654.898438"; +CM143126.1 StringTie transcript 1004364 1006304 1000 . . gene_id "SS.231"; transcript_id "SS.231.1"; cov "6699.790829"; FPKM "327.649917"; TPM "700.629131"; +CM143126.1 StringTie exon 1004364 1006304 1000 . . gene_id "SS.231"; transcript_id "SS.231.1"; exon_number "1"; cov "6699.791016"; +CM143126.1 StringTie transcript 1007092 1011501 1000 . . gene_id "SS.232"; transcript_id "SS.232.1"; cov "505.437868"; FPKM "24.718186"; TPM "52.856052"; +CM143126.1 StringTie exon 1007092 1011501 1000 . . gene_id "SS.232"; transcript_id "SS.232.1"; exon_number "1"; cov "505.437866"; +CM143126.1 StringTie transcript 1011842 1014214 1000 . . gene_id "SS.233"; transcript_id "SS.233.1"; cov "888.936789"; FPKM "43.473009"; TPM "92.960366"; +CM143126.1 StringTie exon 1011842 1014214 1000 . . gene_id "SS.233"; transcript_id "SS.233.1"; exon_number "1"; cov "888.936768"; +CM143126.1 StringTie transcript 1014533 1018117 1000 . . gene_id "SS.234"; transcript_id "SS.234.1"; cov "549.243794"; FPKM "26.860493"; TPM "57.437047"; +CM143126.1 StringTie exon 1014533 1018117 1000 . . gene_id "SS.234"; transcript_id "SS.234.1"; exon_number "1"; cov "549.243774"; +CM143126.1 StringTie transcript 1018331 1022208 1000 . . gene_id "SS.235"; transcript_id "SS.235.1"; cov "403.608561"; FPKM "19.738275"; TPM "42.207275"; +CM143126.1 StringTie exon 1018331 1022208 1000 . . gene_id "SS.235"; transcript_id "SS.235.1"; exon_number "1"; cov "403.608551"; +CM143126.1 StringTie transcript 1022439 1025012 1000 . . gene_id "SS.236"; transcript_id "SS.236.1"; cov "365.931235"; FPKM "17.895684"; TPM "38.267177"; +CM143126.1 StringTie exon 1022439 1025012 1000 . . gene_id "SS.236"; transcript_id "SS.236.1"; exon_number "1"; cov "365.931244"; +CM143126.1 StringTie transcript 1025363 1025986 1000 + . gene_id "SS.237"; transcript_id "SS.237.1"; cov "2778.411215"; FPKM "135.876810"; TPM "290.551733"; +CM143126.1 StringTie exon 1025363 1025427 1000 + . gene_id "SS.237"; transcript_id "SS.237.1"; exon_number "1"; cov "790.415405"; +CM143126.1 StringTie exon 1025517 1025986 1000 + . gene_id "SS.237"; transcript_id "SS.237.1"; exon_number "2"; cov "3053.346924"; +CM143126.1 StringTie transcript 1027633 1028779 1000 - . gene_id "SS.238"; transcript_id "SS.238.1"; cov "124.741517"; FPKM "6.100421"; TPM "13.044816"; +CM143126.1 StringTie exon 1027633 1028102 1000 - . gene_id "SS.238"; transcript_id "SS.238.1"; exon_number "1"; cov "245.442551"; +CM143126.1 StringTie exon 1028248 1028779 1000 - . gene_id "SS.238"; transcript_id "SS.238.1"; exon_number "2"; cov "18.107143"; +CM143126.1 StringTie transcript 1029300 1031377 1000 . . gene_id "SS.239"; transcript_id "SS.239.1"; cov "3565.771896"; FPKM "174.382290"; TPM "372.889800"; +CM143126.1 StringTie exon 1029300 1031377 1000 . . gene_id "SS.239"; transcript_id "SS.239.1"; exon_number "1"; cov "3565.771973"; +CM143126.1 StringTie transcript 1034872 1052007 1000 . . gene_id "SS.240"; transcript_id "SS.240.1"; cov "1331.334734"; FPKM "65.108259"; TPM "139.224033"; +CM143126.1 StringTie exon 1034872 1052007 1000 . . gene_id "SS.240"; transcript_id "SS.240.1"; exon_number "1"; cov "1331.334717"; +CM143126.1 StringTie transcript 1054677 1056481 1000 . . gene_id "SS.241"; transcript_id "SS.241.1"; cov "5273.781717"; FPKM "257.911655"; TPM "551.504546"; +CM143126.1 StringTie exon 1054677 1056481 1000 . . gene_id "SS.241"; transcript_id "SS.241.1"; exon_number "1"; cov "5273.781738"; +CM143126.1 StringTie transcript 1057405 1058487 1000 . . gene_id "SS.242"; transcript_id "SS.242.1"; cov "7257.832872"; FPKM "354.940683"; TPM "758.986253"; +CM143126.1 StringTie exon 1057405 1058487 1000 . . gene_id "SS.242"; transcript_id "SS.242.1"; exon_number "1"; cov "7257.833008"; +CM143126.1 StringTie transcript 1059248 1064487 1000 . . gene_id "SS.243"; transcript_id "SS.243.1"; cov "564.616794"; FPKM "27.612302"; TPM "59.044675"; +CM143126.1 StringTie exon 1059248 1064487 1000 . . gene_id "SS.243"; transcript_id "SS.243.1"; exon_number "1"; cov "564.616821"; +CM143126.1 StringTie transcript 1064765 1070294 1000 . . gene_id "SS.244"; transcript_id "SS.244.1"; cov "306.361483"; FPKM "14.982455"; TPM "32.037684"; +CM143126.1 StringTie exon 1064765 1070294 1000 . . gene_id "SS.244"; transcript_id "SS.244.1"; exon_number "1"; cov "306.361481"; +CM143126.1 StringTie transcript 1070543 1074758 1000 . . gene_id "SS.245"; transcript_id "SS.245.1"; cov "199.120731"; FPKM "9.737900"; TPM "20.823006"; +CM143126.1 StringTie exon 1070543 1074758 1000 . . gene_id "SS.245"; transcript_id "SS.245.1"; exon_number "1"; cov "199.120728"; +CM143126.1 StringTie transcript 1075085 1077099 1000 . . gene_id "SS.246"; transcript_id "SS.246.1"; cov "299.771712"; FPKM "14.660186"; TPM "31.348560"; +CM143126.1 StringTie exon 1075085 1077099 1000 . . gene_id "SS.246"; transcript_id "SS.246.1"; exon_number "1"; cov "299.771698"; +CM143126.1 StringTie transcript 1077314 1082064 1000 . . gene_id "SS.247"; transcript_id "SS.247.1"; cov "423.268575"; FPKM "20.699738"; TPM "44.263217"; +CM143126.1 StringTie exon 1077314 1082064 1000 . . gene_id "SS.247"; transcript_id "SS.247.1"; exon_number "1"; cov "423.268585"; +CM143126.1 StringTie transcript 1082317 1084066 1000 . . gene_id "SS.248"; transcript_id "SS.248.1"; cov "343.692000"; FPKM "16.808085"; TPM "35.941514"; +CM143126.1 StringTie exon 1082317 1084066 1000 . . gene_id "SS.248"; transcript_id "SS.248.1"; exon_number "1"; cov "343.691986"; +CM143126.1 StringTie transcript 1084330 1086328 1000 . . gene_id "SS.249"; transcript_id "SS.249.1"; cov "1475.740370"; FPKM "72.170344"; TPM "154.325220"; +CM143126.1 StringTie exon 1084330 1086328 1000 . . gene_id "SS.249"; transcript_id "SS.249.1"; exon_number "1"; cov "1475.740356"; +CM143126.1 StringTie transcript 1086633 1087293 1000 . . gene_id "SS.250"; transcript_id "SS.250.1"; cov "1895.151286"; FPKM "92.681425"; TPM "198.185023"; +CM143126.1 StringTie exon 1086633 1087293 1000 . . gene_id "SS.250"; transcript_id "SS.250.1"; exon_number "1"; cov "1895.151245"; +CM143126.1 StringTie transcript 1087729 1088917 1000 . . gene_id "SS.251"; transcript_id "SS.251.1"; cov "833.188394"; FPKM "40.746661"; TPM "87.130490"; +CM143126.1 StringTie exon 1087729 1088917 1000 . . gene_id "SS.251"; transcript_id "SS.251.1"; exon_number "1"; cov "833.188416"; +CM143126.1 StringTie transcript 1092478 1094716 1000 . . gene_id "SS.252"; transcript_id "SS.252.1"; cov "337.267977"; FPKM "16.493922"; TPM "35.269723"; +CM143126.1 StringTie exon 1092478 1094716 1000 . . gene_id "SS.252"; transcript_id "SS.252.1"; exon_number "1"; cov "337.267975"; +CM143126.1 StringTie transcript 1094958 1097765 1000 . . gene_id "SS.253"; transcript_id "SS.253.1"; cov "564.568732"; FPKM "27.609951"; TPM "59.039649"; +CM143126.1 StringTie exon 1094958 1097765 1000 . . gene_id "SS.253"; transcript_id "SS.253.1"; exon_number "1"; cov "564.568726"; +CM143126.1 StringTie transcript 1097975 1100473 1000 . . gene_id "SS.254"; transcript_id "SS.254.1"; cov "182.470588"; FPKM "8.923633"; TPM "19.081821"; +CM143126.1 StringTie exon 1097975 1100473 1000 . . gene_id "SS.254"; transcript_id "SS.254.1"; exon_number "1"; cov "182.470581"; +CM143126.1 StringTie transcript 1100710 1106179 1000 . . gene_id "SS.255"; transcript_id "SS.255.1"; cov "167.305850"; FPKM "8.182009"; TPM "17.495972"; +CM143126.1 StringTie exon 1100710 1106179 1000 . . gene_id "SS.255"; transcript_id "SS.255.1"; exon_number "1"; cov "167.305847"; +CM143126.1 StringTie transcript 1106789 1111025 1000 . . gene_id "SS.256"; transcript_id "SS.256.1"; cov "1043.533868"; FPKM "51.033501"; TPM "109.127321"; +CM143126.1 StringTie exon 1106789 1111025 1000 . . gene_id "SS.256"; transcript_id "SS.256.1"; exon_number "1"; cov "1043.533813"; +CM143126.1 StringTie transcript 1111454 1113455 1000 . . gene_id "SS.257"; transcript_id "SS.257.1"; cov "4147.760240"; FPKM "202.844138"; TPM "433.751102"; +CM143126.1 StringTie exon 1111454 1113455 1000 . . gene_id "SS.257"; transcript_id "SS.257.1"; exon_number "1"; cov "4147.760254"; +CM143126.1 StringTie transcript 1117245 1121420 1000 . . gene_id "SS.258"; transcript_id "SS.258.1"; cov "576.953065"; FPKM "28.215601"; TPM "60.334738"; +CM143126.1 StringTie exon 1117245 1121420 1000 . . gene_id "SS.258"; transcript_id "SS.258.1"; exon_number "1"; cov "576.953064"; +CM143126.1 StringTie transcript 1122011 1128169 1000 . . gene_id "SS.259"; transcript_id "SS.259.1"; cov "315.193538"; FPKM "15.414382"; TPM "32.961294"; +CM143126.1 StringTie exon 1122011 1128169 1000 . . gene_id "SS.259"; transcript_id "SS.259.1"; exon_number "1"; cov "315.193542"; +CM143126.1 StringTie transcript 1129713 1130659 1000 . . gene_id "SS.260"; transcript_id "SS.260.1"; cov "486.874340"; FPKM "23.810346"; TPM "50.914775"; +CM143126.1 StringTie exon 1129713 1130659 1000 . . gene_id "SS.260"; transcript_id "SS.260.1"; exon_number "1"; cov "486.874329"; +CM143126.1 StringTie transcript 1130988 1132909 1000 . . gene_id "SS.261"; transcript_id "SS.261.1"; cov "303.442248"; FPKM "14.839691"; TPM "31.732405"; +CM143126.1 StringTie exon 1130988 1132909 1000 . . gene_id "SS.261"; transcript_id "SS.261.1"; exon_number "1"; cov "303.442261"; +CM143126.1 StringTie transcript 1133387 1135691 1000 . . gene_id "SS.262"; transcript_id "SS.262.1"; cov "67.717137"; FPKM "3.311673"; TPM "7.081504"; +CM143126.1 StringTie exon 1133387 1135691 1000 . . gene_id "SS.262"; transcript_id "SS.262.1"; exon_number "1"; cov "67.717140"; +CM143126.1 StringTie transcript 1136224 1145244 1000 . . gene_id "SS.263"; transcript_id "SS.263.1"; cov "499.785722"; FPKM "24.441771"; TPM "52.264980"; +CM143126.1 StringTie exon 1136224 1145244 1000 . . gene_id "SS.263"; transcript_id "SS.263.1"; exon_number "1"; cov "499.785736"; +CM143126.1 StringTie transcript 1145722 1148113 1000 . . gene_id "SS.264"; transcript_id "SS.264.1"; cov "1262.640886"; FPKM "61.748820"; TPM "132.040389"; +CM143126.1 StringTie exon 1145722 1148113 1000 . . gene_id "SS.264"; transcript_id "SS.264.1"; exon_number "1"; cov "1262.640869"; +CM143126.1 StringTie transcript 1148343 1153398 1000 . . gene_id "SS.265"; transcript_id "SS.265.1"; cov "1037.076741"; FPKM "50.717719"; TPM "108.452069"; +CM143126.1 StringTie exon 1148343 1153398 1000 . . gene_id "SS.265"; transcript_id "SS.265.1"; exon_number "1"; cov "1037.076782"; +CM143126.1 StringTie transcript 1153823 1155798 1000 . . gene_id "SS.266"; transcript_id "SS.266.1"; cov "1240.202429"; FPKM "60.651479"; TPM "129.693892"; +CM143126.1 StringTie exon 1153823 1155798 1000 . . gene_id "SS.266"; transcript_id "SS.266.1"; exon_number "1"; cov "1240.202393"; +CM143126.1 StringTie transcript 1156000 1159431 1000 . . gene_id "SS.267"; transcript_id "SS.267.1"; cov "1586.446678"; FPKM "77.584381"; TPM "165.902307"; +CM143126.1 StringTie exon 1156000 1159431 1000 . . gene_id "SS.267"; transcript_id "SS.267.1"; exon_number "1"; cov "1586.446655"; +CM143126.1 StringTie transcript 1159901 1167816 1000 . . gene_id "SS.268"; transcript_id "SS.268.1"; cov "185.792951"; FPKM "9.086111"; TPM "19.429256"; +CM143126.1 StringTie exon 1159901 1167816 1000 . . gene_id "SS.268"; transcript_id "SS.268.1"; exon_number "1"; cov "185.792953"; +CM143126.1 StringTie transcript 1168601 1170379 1000 . . gene_id "SS.269"; transcript_id "SS.269.1"; cov "370.862844"; FPKM "18.136862"; TPM "38.782899"; +CM143126.1 StringTie exon 1168601 1170379 1000 . . gene_id "SS.269"; transcript_id "SS.269.1"; exon_number "1"; cov "370.862854"; +CM143126.1 StringTie transcript 1170665 1187859 1000 . . gene_id "SS.270"; transcript_id "SS.270.1"; cov "515.289096"; FPKM "25.199955"; TPM "53.886242"; +CM143126.1 StringTie exon 1170665 1187859 1000 . . gene_id "SS.270"; transcript_id "SS.270.1"; exon_number "1"; cov "515.289124"; +CM143126.1 StringTie transcript 1188287 1189186 1000 . . gene_id "SS.271"; transcript_id "SS.271.1"; cov "1157.046667"; FPKM "56.584788"; TPM "120.997897"; +CM143126.1 StringTie exon 1188287 1189186 1000 . . gene_id "SS.271"; transcript_id "SS.271.1"; exon_number "1"; cov "1157.046631"; +CM143126.1 StringTie transcript 1189544 1193957 1000 . . gene_id "SS.272"; transcript_id "SS.272.1"; cov "309.244223"; FPKM "15.123434"; TPM "32.339146"; +CM143126.1 StringTie exon 1189544 1193957 1000 . . gene_id "SS.272"; transcript_id "SS.272.1"; exon_number "1"; cov "309.244232"; +CM143126.1 StringTie transcript 1194700 1195872 1000 . . gene_id "SS.273"; transcript_id "SS.273.1"; cov "201.583120"; FPKM "9.858322"; TPM "21.080510"; +CM143126.1 StringTie exon 1194700 1195872 1000 . . gene_id "SS.273"; transcript_id "SS.273.1"; exon_number "1"; cov "201.583115"; +CM143126.1 StringTie transcript 1196181 1196385 1000 . . gene_id "SS.274"; transcript_id "SS.274.1"; cov "8.000000"; FPKM "0.391236"; TPM "0.836598"; +CM143126.1 StringTie exon 1196181 1196385 1000 . . gene_id "SS.274"; transcript_id "SS.274.1"; exon_number "1"; cov "8.000000"; +CM143126.1 StringTie transcript 1196678 1200980 1000 . . gene_id "SS.275"; transcript_id "SS.275.1"; cov "137.595631"; FPKM "6.729045"; TPM "14.389032"; +CM143126.1 StringTie exon 1196678 1200980 1000 . . gene_id "SS.275"; transcript_id "SS.275.1"; exon_number "1"; cov "137.595627"; +CM143126.1 StringTie transcript 1202816 1205546 1000 . . gene_id "SS.276"; transcript_id "SS.276.1"; cov "67.591953"; FPKM "3.305551"; TPM "7.068413"; +CM143126.1 StringTie exon 1202816 1205546 1000 . . gene_id "SS.276"; transcript_id "SS.276.1"; exon_number "1"; cov "67.591957"; +CM143126.1 StringTie transcript 1205790 1209263 1000 . . gene_id "SS.277"; transcript_id "SS.277.1"; cov "511.795049"; FPKM "25.029081"; TPM "53.520853"; +CM143126.1 StringTie exon 1205790 1209263 1000 . . gene_id "SS.277"; transcript_id "SS.277.1"; exon_number "1"; cov "511.795044"; +CM143126.1 StringTie transcript 1236793 1239359 1000 . . gene_id "SS.278"; transcript_id "SS.278.1"; cov "402.468251"; FPKM "19.682508"; TPM "42.088028"; +CM143126.1 StringTie exon 1236793 1239359 1000 . . gene_id "SS.278"; transcript_id "SS.278.1"; exon_number "1"; cov "402.468262"; +CM143126.1 StringTie transcript 1242196 1244639 1000 . . gene_id "SS.279"; transcript_id "SS.279.1"; cov "65.265139"; FPKM "3.191759"; TPM "6.825087"; +CM143126.1 StringTie exon 1242196 1244639 1000 . . gene_id "SS.279"; transcript_id "SS.279.1"; exon_number "1"; cov "65.265137"; +CM143126.1 StringTie transcript 1209554 1212341 1000 . . gene_id "SS.280"; transcript_id "SS.280.1"; cov "343.318149"; FPKM "16.789802"; TPM "35.902419"; +CM143126.1 StringTie exon 1209554 1212341 1000 . . gene_id "SS.280"; transcript_id "SS.280.1"; exon_number "1"; cov "343.318146"; +CM143126.1 StringTie transcript 1212659 1213487 1000 . . gene_id "SS.281"; transcript_id "SS.281.1"; cov "4984.734620"; FPKM "243.775951"; TPM "521.277511"; +CM143126.1 StringTie exon 1212659 1213487 1000 . . gene_id "SS.281"; transcript_id "SS.281.1"; exon_number "1"; cov "4984.734863"; +CM143126.1 StringTie transcript 1215093 1216545 1000 . . gene_id "SS.282"; transcript_id "SS.282.1"; cov "3001.752237"; FPKM "146.799190"; TPM "313.907570"; +CM143126.1 StringTie exon 1215093 1216545 1000 . . gene_id "SS.282"; transcript_id "SS.282.1"; exon_number "1"; cov "3001.752197"; +CM143126.1 StringTie transcript 1217036 1218805 1000 . . gene_id "SS.283"; transcript_id "SS.283.1"; cov "1849.022034"; FPKM "90.425497"; TPM "193.361067"; +CM143126.1 StringTie exon 1217036 1218805 1000 . . gene_id "SS.283"; transcript_id "SS.283.1"; exon_number "1"; cov "1849.022095"; +CM143126.1 StringTie transcript 1220734 1223248 1000 + . gene_id "SS.284"; transcript_id "SS.284.1"; cov "519.845267"; FPKM "25.422773"; TPM "54.362703"; +CM143126.1 StringTie exon 1220734 1220947 1000 + . gene_id "SS.284"; transcript_id "SS.284.1"; exon_number "1"; cov "386.724304"; +CM143126.1 StringTie exon 1221033 1223248 1000 + . gene_id "SS.284"; transcript_id "SS.284.1"; exon_number "2"; cov "532.700806"; +CM143126.1 StringTie transcript 1230574 1233436 1000 . . gene_id "SS.285"; transcript_id "SS.285.1"; cov "2594.482710"; FPKM "126.881878"; TPM "271.317450"; +CM143126.1 StringTie exon 1230574 1233436 1000 . . gene_id "SS.285"; transcript_id "SS.285.1"; exon_number "1"; cov "2594.482666"; +CM143126.1 StringTie transcript 1234275 1236281 1000 . . gene_id "SS.286"; transcript_id "SS.286.1"; cov "599.504484"; FPKM "29.318467"; TPM "62.693048"; +CM143126.1 StringTie exon 1234275 1236281 1000 . . gene_id "SS.286"; transcript_id "SS.286.1"; exon_number "1"; cov "599.504456"; +CM143126.1 StringTie transcript 1253535 1255121 1000 . . gene_id "SS.287"; transcript_id "SS.287.1"; cov "7440.738500"; FPKM "363.885591"; TPM "778.113568"; +CM143126.1 StringTie exon 1253535 1255121 1000 . . gene_id "SS.287"; transcript_id "SS.287.1"; exon_number "1"; cov "7440.738281"; +CM143126.1 StringTie transcript 1259200 1263317 1000 . . gene_id "SS.288"; transcript_id "SS.288.1"; cov "2194.896795"; FPKM "107.340329"; TPM "229.530843"; +CM143126.1 StringTie exon 1259200 1263317 1000 . . gene_id "SS.288"; transcript_id "SS.288.1"; exon_number "1"; cov "2194.896729"; +CM143126.1 StringTie transcript 1264087 1267646 1000 . . gene_id "SS.289"; transcript_id "SS.289.1"; cov "825.902809"; FPKM "40.390363"; TPM "86.368602"; +CM143126.1 StringTie exon 1264087 1267646 1000 . . gene_id "SS.289"; transcript_id "SS.289.1"; exon_number "1"; cov "825.902832"; +CM143126.1 StringTie transcript 1274583 1274978 1000 . . gene_id "SS.290"; transcript_id "SS.290.1"; cov "5.310606"; FPKM "0.259713"; TPM "0.555355"; +CM143126.1 StringTie exon 1274583 1274978 1000 . . gene_id "SS.290"; transcript_id "SS.290.1"; exon_number "1"; cov "5.310606"; +CM143126.1 StringTie transcript 1286325 1287586 1000 . . gene_id "SS.291"; transcript_id "SS.291.1"; cov "59.206431"; FPKM "2.895461"; TPM "6.191499"; +CM143126.1 StringTie exon 1286325 1287586 1000 . . gene_id "SS.291"; transcript_id "SS.291.1"; exon_number "1"; cov "59.206432"; +CM143126.1 StringTie transcript 1287804 1291798 1000 . . gene_id "SS.292"; transcript_id "SS.292.1"; cov "44.635928"; FPKM "2.182898"; TPM "4.667792"; +CM143126.1 StringTie exon 1287804 1291798 1000 . . gene_id "SS.292"; transcript_id "SS.292.1"; exon_number "1"; cov "44.635929"; +CM143126.1 StringTie transcript 1297677 1298691 1000 . . gene_id "SS.293"; transcript_id "SS.293.1"; cov "3574.217734"; FPKM "174.795329"; TPM "373.773022"; +CM143126.1 StringTie exon 1297677 1298691 1000 . . gene_id "SS.293"; transcript_id "SS.293.1"; exon_number "1"; cov "3574.217773"; +CM143126.1 StringTie transcript 1299026 1301715 1000 . . gene_id "SS.294"; transcript_id "SS.294.1"; cov "1011.142379"; FPKM "49.449412"; TPM "105.739989"; +CM143126.1 StringTie exon 1299026 1301715 1000 . . gene_id "SS.294"; transcript_id "SS.294.1"; exon_number "1"; cov "1011.142395"; +CM143126.1 StringTie transcript 1303403 1305028 1000 + . gene_id "SS.295"; transcript_id "SS.295.1"; cov "732.726502"; FPKM "35.833623"; TPM "76.624710"; +CM143126.1 StringTie exon 1303403 1303527 1000 + . gene_id "SS.295"; transcript_id "SS.295.1"; exon_number "1"; cov "376.615997"; +CM143126.1 StringTie exon 1303739 1305028 1000 + . gene_id "SS.295"; transcript_id "SS.295.1"; exon_number "2"; cov "767.233337"; +CM143126.1 StringTie transcript 1305266 1306411 1000 . . gene_id "SS.296"; transcript_id "SS.296.1"; cov "3671.749564"; FPKM "179.565074"; TPM "383.972391"; +CM143126.1 StringTie exon 1305266 1306411 1000 . . gene_id "SS.296"; transcript_id "SS.296.1"; exon_number "1"; cov "3671.749512"; +CM143126.1 StringTie transcript 1306992 1317587 1000 . . gene_id "SS.297"; transcript_id "SS.297.1"; cov "973.970838"; FPKM "47.631556"; TPM "101.852783"; +CM143126.1 StringTie exon 1306992 1317587 1000 . . gene_id "SS.297"; transcript_id "SS.297.1"; exon_number "1"; cov "973.970825"; +CM143126.1 StringTie transcript 1320513 1327547 1000 . . gene_id "SS.298"; transcript_id "SS.298.1"; cov "320.347122"; FPKM "15.666416"; TPM "33.500229"; +CM143126.1 StringTie exon 1320513 1327547 1000 . . gene_id "SS.298"; transcript_id "SS.298.1"; exon_number "1"; cov "320.347107"; +CM143126.1 StringTie transcript 1342320 1344028 1000 . . gene_id "SS.299"; transcript_id "SS.299.1"; cov "20996.046811"; FPKM "1026.801159"; TPM "2195.656910"; +CM143126.1 StringTie exon 1342320 1344028 1000 . . gene_id "SS.299"; transcript_id "SS.299.1"; exon_number "1"; cov "20996.046875"; +CM143126.1 StringTie transcript 1344836 1346170 1000 . . gene_id "SS.300"; transcript_id "SS.300.1"; cov "1386.149813"; FPKM "67.788963"; TPM "144.956307"; +CM143126.1 StringTie exon 1344836 1346170 1000 . . gene_id "SS.300"; transcript_id "SS.300.1"; exon_number "1"; cov "1386.149780"; +CM143126.1 StringTie transcript 1353569 1354542 1000 - . gene_id "SS.301"; transcript_id "SS.301.1"; cov "12916.336158"; FPKM "631.666954"; TPM "1350.722972"; +CM143126.1 StringTie exon 1353569 1353896 1000 - . gene_id "SS.301"; transcript_id "SS.301.1"; exon_number "1"; cov "13901.829102"; +CM143126.1 StringTie exon 1354517 1354542 1000 - . gene_id "SS.301"; transcript_id "SS.301.1"; exon_number "2"; cov "483.961548"; +CM143126.1 StringTie transcript 1355464 1361146 1000 + . gene_id "SS.302"; transcript_id "SS.302.1"; cov "608.786415"; FPKM "29.772395"; TPM "63.663704"; +CM143126.1 StringTie exon 1355464 1355641 1000 + . gene_id "SS.302"; transcript_id "SS.302.1"; exon_number "1"; cov "1070.269653"; +CM143126.1 StringTie exon 1355716 1361146 1000 + . gene_id "SS.302"; transcript_id "SS.302.1"; exon_number "2"; cov "593.661377"; +CM143126.1 StringTie transcript 1400568 1402154 1000 . . gene_id "SS.303"; transcript_id "SS.303.1"; cov "18.631380"; FPKM "0.911158"; TPM "1.948372"; +CM143126.1 StringTie exon 1400568 1402154 1000 . . gene_id "SS.303"; transcript_id "SS.303.1"; exon_number "1"; cov "18.631380"; +CM143126.1 StringTie transcript 1376010 1377880 1000 . . gene_id "SS.304"; transcript_id "SS.304.1"; cov "1418.845003"; FPKM "69.387905"; TPM "148.375400"; +CM143126.1 StringTie exon 1376010 1377880 1000 . . gene_id "SS.304"; transcript_id "SS.304.1"; exon_number "1"; cov "1418.844971"; +CM143126.1 StringTie transcript 1378224 1386477 1000 . . gene_id "SS.305"; transcript_id "SS.305.1"; cov "456.147201"; FPKM "22.307651"; TPM "47.701492"; +CM143126.1 StringTie exon 1378224 1386477 1000 . . gene_id "SS.305"; transcript_id "SS.305.1"; exon_number "1"; cov "456.147186"; +CM143126.1 StringTie transcript 1386842 1387647 1000 . . gene_id "SS.306"; transcript_id "SS.306.1"; cov "1197.990074"; FPKM "58.587105"; TPM "125.279545"; +CM143126.1 StringTie exon 1386842 1387647 1000 . . gene_id "SS.306"; transcript_id "SS.306.1"; exon_number "1"; cov "1197.990112"; +CM143126.1 StringTie transcript 1388731 1393542 1000 . . gene_id "SS.307"; transcript_id "SS.307.1"; cov "170.061097"; FPKM "8.316753"; TPM "17.784101"; +CM143126.1 StringTie exon 1388731 1393542 1000 . . gene_id "SS.307"; transcript_id "SS.307.1"; exon_number "1"; cov "170.061096"; +CM143126.1 StringTie transcript 1393836 1395299 1000 + . gene_id "SS.308"; transcript_id "SS.308.1"; cov "7750.103529"; FPKM "379.014933"; TPM "810.465347"; +CM143126.1 StringTie exon 1393836 1394009 1000 + . gene_id "SS.308"; transcript_id "SS.308.1"; exon_number "1"; cov "1893.718384"; +CM143126.1 StringTie exon 1394624 1395299 1000 + . gene_id "SS.308"; transcript_id "SS.308.1"; exon_number "2"; cov "9257.516602"; +CM143126.1 StringTie transcript 1397909 1399706 1000 . . gene_id "SS.309"; transcript_id "SS.309.1"; cov "481.006118"; FPKM "23.523363"; TPM "50.301107"; +CM143126.1 StringTie exon 1397909 1399706 1000 . . gene_id "SS.309"; transcript_id "SS.309.1"; exon_number "1"; cov "481.006104"; +CM143126.1 StringTie transcript 1402377 1411113 1000 . . gene_id "SS.310"; transcript_id "SS.310.1"; cov "58.336385"; FPKM "2.852912"; TPM "6.100514"; +CM143126.1 StringTie exon 1402377 1411113 1000 . . gene_id "SS.310"; transcript_id "SS.310.1"; exon_number "1"; cov "58.336384"; +CM143126.1 StringTie transcript 1411419 1415778 1000 . . gene_id "SS.311"; transcript_id "SS.311.1"; cov "580.202982"; FPKM "28.374536"; TPM "60.674597"; +CM143126.1 StringTie exon 1411419 1415778 1000 . . gene_id "SS.311"; transcript_id "SS.311.1"; exon_number "1"; cov "580.203003"; +CM143126.1 StringTie transcript 1417765 1418935 1000 . . gene_id "SS.312"; transcript_id "SS.312.1"; cov "13476.870196"; FPKM "659.079590"; TPM "1409.340693"; +CM143126.1 StringTie exon 1417765 1418935 1000 . . gene_id "SS.312"; transcript_id "SS.312.1"; exon_number "1"; cov "13476.870117"; +CM143126.1 StringTie transcript 1515406 1518648 1000 . . gene_id "SS.313"; transcript_id "SS.313.1"; cov "854.395005"; FPKM "41.783760"; TPM "89.348167"; +CM143126.1 StringTie exon 1515406 1518648 1000 . . gene_id "SS.313"; transcript_id "SS.313.1"; exon_number "1"; cov "854.395020"; +CM143126.1 StringTie transcript 1424328 1426745 1000 + . gene_id "SS.314"; transcript_id "SS.314.1"; cov "11300.833912"; FPKM "552.661625"; TPM "1181.782185"; +CM143126.1 StringTie exon 1424328 1424529 1000 + . gene_id "SS.314"; transcript_id "SS.314.1"; exon_number "1"; cov "1621.792114"; +CM143126.1 StringTie exon 1424800 1424813 1000 + . gene_id "SS.314"; transcript_id "SS.314.1"; exon_number "2"; cov "7411.928711"; +CM143126.1 StringTie exon 1425234 1426745 1000 + . gene_id "SS.314"; transcript_id "SS.314.1"; exon_number "3"; cov "12629.941406"; +CM143126.1 StringTie transcript 1434365 1439191 1000 . . gene_id "SS.315"; transcript_id "SS.315.1"; cov "983.371141"; FPKM "48.091273"; TPM "102.835818"; +CM143126.1 StringTie exon 1434365 1439191 1000 . . gene_id "SS.315"; transcript_id "SS.315.1"; exon_number "1"; cov "983.371155"; +CM143126.1 StringTie transcript 1434365 1439212 1000 - . gene_id "SS.316"; transcript_id "SS.316.1"; cov "123.517526"; FPKM "6.040563"; TPM "12.916818"; +CM143126.1 StringTie exon 1434365 1436761 1000 - . gene_id "SS.316"; transcript_id "SS.316.1"; exon_number "1"; cov "202.710266"; +CM143126.1 StringTie exon 1436856 1439082 1000 - . gene_id "SS.316"; transcript_id "SS.316.1"; exon_number "2"; cov "40.349422"; +CM143126.1 StringTie exon 1439169 1439212 1000 - . gene_id "SS.316"; transcript_id "SS.316.1"; exon_number "3"; cov "18.753359"; +CM143126.1 StringTie transcript 1439438 1442817 1000 . . gene_id "SS.317"; transcript_id "SS.317.1"; cov "217.463905"; FPKM "10.634963"; TPM "22.741239"; +CM143126.1 StringTie exon 1439438 1442817 1000 . . gene_id "SS.317"; transcript_id "SS.317.1"; exon_number "1"; cov "217.463898"; +CM143126.1 StringTie transcript 1443021 1444526 1000 + . gene_id "SS.318"; transcript_id "SS.318.1"; cov "322.403439"; FPKM "15.766979"; TPM "33.715268"; +CM143126.1 StringTie exon 1443021 1443171 1000 + . gene_id "SS.318"; transcript_id "SS.318.1"; exon_number "1"; cov "180.874176"; +CM143126.1 StringTie exon 1443266 1444526 1000 + . gene_id "SS.318"; transcript_id "SS.318.1"; exon_number "2"; cov "339.351044"; +CM143126.1 StringTie transcript 1444124 1444526 1000 . . gene_id "SS.319"; transcript_id "SS.319.1"; cov "376.360654"; FPKM "18.405729"; TPM "39.357831"; +CM143126.1 StringTie exon 1444124 1444526 1000 . . gene_id "SS.319"; transcript_id "SS.319.1"; exon_number "1"; cov "376.360657"; +CM143126.1 StringTie transcript 1444768 1446022 1000 . . gene_id "SS.320"; transcript_id "SS.320.1"; cov "1545.808765"; FPKM "75.597004"; TPM "161.652607"; +CM143126.1 StringTie exon 1444768 1446022 1000 . . gene_id "SS.320"; transcript_id "SS.320.1"; exon_number "1"; cov "1545.808716"; +CM143126.1 StringTie transcript 1446608 1448431 1000 . . gene_id "SS.321"; transcript_id "SS.321.1"; cov "3059.535636"; FPKM "149.625059"; TPM "319.950256"; +CM143126.1 StringTie exon 1446608 1448431 1000 . . gene_id "SS.321"; transcript_id "SS.321.1"; exon_number "1"; cov "3059.535645"; +CM143126.1 StringTie transcript 1448765 1451825 1000 . . gene_id "SS.322"; transcript_id "SS.322.1"; cov "857.164325"; FPKM "41.919192"; TPM "89.637768"; +CM143126.1 StringTie exon 1448765 1451825 1000 . . gene_id "SS.322"; transcript_id "SS.322.1"; exon_number "1"; cov "857.164307"; +CM143126.1 StringTie transcript 1452347 1456245 1000 . . gene_id "SS.323"; transcript_id "SS.323.1"; cov "1329.464991"; FPKM "65.016820"; TPM "139.028505"; +CM143126.1 StringTie exon 1452347 1456245 1000 . . gene_id "SS.323"; transcript_id "SS.323.1"; exon_number "1"; cov "1329.464966"; +CM143126.1 StringTie transcript 1456876 1460875 1000 . . gene_id "SS.324"; transcript_id "SS.324.1"; cov "362.592750"; FPKM "17.732417"; TPM "37.918056"; +CM143126.1 StringTie exon 1456876 1460875 1000 . . gene_id "SS.324"; transcript_id "SS.324.1"; exon_number "1"; cov "362.592743"; +CM143126.1 StringTie transcript 1461105 1471741 1000 . . gene_id "SS.325"; transcript_id "SS.325.1"; cov "526.221209"; FPKM "25.734585"; TPM "55.029466"; +CM143126.1 StringTie exon 1461105 1471741 1000 . . gene_id "SS.325"; transcript_id "SS.325.1"; exon_number "1"; cov "526.221191"; +CM143126.1 StringTie transcript 1490159 1492848 1000 . . gene_id "SS.326"; transcript_id "SS.326.1"; cov "1149.033457"; FPKM "56.192906"; TPM "120.159917"; +CM143126.1 StringTie exon 1490159 1492848 1000 . . gene_id "SS.326"; transcript_id "SS.326.1"; exon_number "1"; cov "1149.033447"; +CM143126.1 StringTie transcript 1493137 1494660 1000 . . gene_id "SS.327"; transcript_id "SS.327.1"; cov "469.301181"; FPKM "22.950939"; TPM "49.077066"; +CM143126.1 StringTie exon 1493137 1494660 1000 . . gene_id "SS.327"; transcript_id "SS.327.1"; exon_number "1"; cov "469.301178"; +CM143126.1 StringTie transcript 1501107 1501960 1000 + . gene_id "SS.328"; transcript_id "SS.328.1"; cov "448.506631"; FPKM "21.933992"; TPM "46.902481"; +CM143126.1 StringTie exon 1501107 1501256 1000 + . gene_id "SS.328"; transcript_id "SS.328.1"; exon_number "1"; cov "139.086533"; +CM143126.1 StringTie exon 1501387 1501409 1000 + . gene_id "SS.328"; transcript_id "SS.328.1"; exon_number "2"; cov "689.890320"; +CM143126.1 StringTie exon 1501490 1501960 1000 + . gene_id "SS.328"; transcript_id "SS.328.1"; exon_number "3"; cov "535.260742"; +CM143126.1 StringTie transcript 1501107 1501960 1000 + . gene_id "SS.328"; transcript_id "SS.328.2"; cov "102.359974"; FPKM "5.005863"; TPM "10.704271"; +CM143126.1 StringTie exon 1501107 1501256 1000 + . gene_id "SS.328"; transcript_id "SS.328.2"; exon_number "1"; cov "28.571381"; +CM143126.1 StringTie exon 1501387 1501960 1000 + . gene_id "SS.328"; transcript_id "SS.328.2"; exon_number "2"; cov "121.642708"; +CM143126.1 StringTie transcript 1501107 1514062 1000 + . gene_id "SS.328"; transcript_id "SS.328.3"; cov "68.005948"; FPKM "3.325797"; TPM "7.111707"; +CM143126.1 StringTie exon 1501107 1501256 1000 + . gene_id "SS.328"; transcript_id "SS.328.3"; exon_number "1"; cov "93.122086"; +CM143126.1 StringTie exon 1501490 1503111 1000 + . gene_id "SS.328"; transcript_id "SS.328.3"; exon_number "2"; cov "174.174530"; +CM143126.1 StringTie exon 1503190 1514062 1000 + . gene_id "SS.328"; transcript_id "SS.328.3"; exon_number "3"; cov "51.821560"; +CM143126.1 StringTie transcript 1502144 1509296 1000 . . gene_id "SS.329"; transcript_id "SS.329.1"; cov "480.128757"; FPKM "23.480457"; TPM "50.209358"; +CM143126.1 StringTie exon 1502144 1509296 1000 . . gene_id "SS.329"; transcript_id "SS.329.1"; exon_number "1"; cov "480.128754"; +CM143126.1 StringTie transcript 1509504 1510741 1000 . . gene_id "SS.330"; transcript_id "SS.330.1"; cov "489.406401"; FPKM "23.934175"; TPM "51.179565"; +CM143126.1 StringTie exon 1509504 1510741 1000 . . gene_id "SS.330"; transcript_id "SS.330.1"; exon_number "1"; cov "489.406403"; +CM143126.1 StringTie transcript 1510990 1514062 1000 . . gene_id "SS.331"; transcript_id "SS.331.1"; cov "416.364912"; FPKM "20.362118"; TPM "43.541268"; +CM143126.1 StringTie exon 1510990 1514062 1000 . . gene_id "SS.331"; transcript_id "SS.331.1"; exon_number "1"; cov "416.364899"; +CM143126.1 StringTie transcript 1514420 1514981 1000 . . gene_id "SS.332"; transcript_id "SS.332.1"; cov "25.624555"; FPKM "1.253156"; TPM "2.679682"; +CM143126.1 StringTie exon 1514420 1514981 1000 . . gene_id "SS.332"; transcript_id "SS.332.1"; exon_number "1"; cov "25.624556"; +CM143126.1 StringTie transcript 1519207 1520675 1000 . . gene_id "SS.333"; transcript_id "SS.333.1"; cov "3626.921035"; FPKM "177.372758"; TPM "379.284458"; +CM143126.1 StringTie exon 1519207 1520675 1000 . . gene_id "SS.333"; transcript_id "SS.333.1"; exon_number "1"; cov "3626.921143"; +CM143126.1 StringTie transcript 1520912 1524502 1000 . . gene_id "SS.334"; transcript_id "SS.334.1"; cov "476.866889"; FPKM "23.320936"; TPM "49.868249"; +CM143126.1 StringTie exon 1520912 1524502 1000 . . gene_id "SS.334"; transcript_id "SS.334.1"; exon_number "1"; cov "476.866882"; +CM143126.1 StringTie transcript 1524802 1528456 1000 - . gene_id "SS.335"; transcript_id "SS.335.1"; cov "305.720924"; FPKM "14.951129"; TPM "31.970697"; +CM143126.1 StringTie exon 1524802 1528246 1000 - . gene_id "SS.335"; transcript_id "SS.335.1"; exon_number "1"; cov "313.208710"; +CM143126.1 StringTie exon 1528308 1528456 1000 - . gene_id "SS.335"; transcript_id "SS.335.1"; exon_number "2"; cov "132.597321"; +CM143126.1 StringTie transcript 1529389 1530582 1000 . . gene_id "SS.336"; transcript_id "SS.336.1"; cov "1063.021776"; FPKM "51.986548"; TPM "111.165265"; +CM143126.1 StringTie exon 1529389 1530582 1000 . . gene_id "SS.336"; transcript_id "SS.336.1"; exon_number "1"; cov "1063.021729"; +CM143126.1 StringTie transcript 1532557 1534988 1000 . . gene_id "SS.337"; transcript_id "SS.337.1"; cov "4360.962582"; FPKM "213.270692"; TPM "456.046689"; +CM143126.1 StringTie exon 1532557 1534988 1000 . . gene_id "SS.337"; transcript_id "SS.337.1"; exon_number "1"; cov "4360.962402"; +CM143126.1 StringTie transcript 1536083 1536926 1000 . . gene_id "SS.338"; transcript_id "SS.338.1"; cov "427.049763"; FPKM "20.884655"; TPM "44.658634"; +CM143126.1 StringTie exon 1536083 1536926 1000 . . gene_id "SS.338"; transcript_id "SS.338.1"; exon_number "1"; cov "427.049774"; +CM143126.1 StringTie transcript 1537304 1539056 1000 - . gene_id "SS.339"; transcript_id "SS.339.1"; cov "4317.060302"; FPKM "211.123673"; TPM "451.455618"; +CM143126.1 StringTie exon 1537304 1537987 1000 - . gene_id "SS.339"; transcript_id "SS.339.1"; exon_number "1"; cov "4662.954590"; +CM143126.1 StringTie exon 1538945 1539056 1000 - . gene_id "SS.339"; transcript_id "SS.339.1"; exon_number "2"; cov "2204.634033"; +CM143126.1 StringTie transcript 1540479 1543922 1000 - . gene_id "SS.340"; transcript_id "SS.340.1"; cov "3521.219528"; FPKM "172.203478"; TPM "368.230746"; +CM143126.1 StringTie exon 1540479 1543276 1000 - . gene_id "SS.340"; transcript_id "SS.340.1"; exon_number "1"; cov "3450.598389"; +CM143126.1 StringTie exon 1543669 1543922 1000 - . gene_id "SS.340"; transcript_id "SS.340.1"; exon_number "2"; cov "4299.165527"; +CM143126.1 StringTie transcript 1544157 1547448 1000 . . gene_id "SS.341"; transcript_id "SS.341.1"; cov "1013.227521"; FPKM "49.551385"; TPM "105.958042"; +CM143126.1 StringTie exon 1544157 1547448 1000 . . gene_id "SS.341"; transcript_id "SS.341.1"; exon_number "1"; cov "1013.227539"; +CM143126.1 StringTie transcript 1551021 1552321 1000 . . gene_id "SS.342"; transcript_id "SS.342.1"; cov "2341.324366"; FPKM "114.501296"; TPM "244.843473"; +CM143126.1 StringTie exon 1551021 1552321 1000 . . gene_id "SS.342"; transcript_id "SS.342.1"; exon_number "1"; cov "2341.324463"; +CM143126.1 StringTie transcript 1552670 1554246 1000 . . gene_id "SS.343"; transcript_id "SS.343.1"; cov "687.927077"; FPKM "33.642729"; TPM "71.939821"; +CM143126.1 StringTie exon 1552670 1554246 1000 . . gene_id "SS.343"; transcript_id "SS.343.1"; exon_number "1"; cov "687.927063"; +CM143126.1 StringTie transcript 1554823 1558304 1000 . . gene_id "SS.344"; transcript_id "SS.344.1"; cov "1530.852814"; FPKM "74.865591"; TPM "160.088591"; +CM143126.1 StringTie exon 1554823 1558304 1000 . . gene_id "SS.344"; transcript_id "SS.344.1"; exon_number "1"; cov "1530.852783"; +CM143126.1 StringTie transcript 1554823 1558304 1000 - . gene_id "SS.345"; transcript_id "SS.345.1"; cov "829.909516"; FPKM "40.586309"; TPM "86.787602"; +CM143126.1 StringTie exon 1554823 1556372 1000 - . gene_id "SS.345"; transcript_id "SS.345.1"; exon_number "1"; cov "1138.865356"; +CM143126.1 StringTie exon 1557525 1558304 1000 - . gene_id "SS.345"; transcript_id "SS.345.1"; exon_number "2"; cov "215.958710"; +CM143126.1 StringTie transcript 1558531 1560368 1000 . . gene_id "SS.346"; transcript_id "SS.346.1"; cov "249.947769"; FPKM "12.223571"; TPM "26.138232"; +CM143126.1 StringTie exon 1558531 1560368 1000 . . gene_id "SS.346"; transcript_id "SS.346.1"; exon_number "1"; cov "249.947769"; +CM143126.1 StringTie transcript 1560650 1561669 1000 . . gene_id "SS.347"; transcript_id "SS.347.1"; cov "7600.765686"; FPKM "371.711641"; TPM "794.848376"; +CM143126.1 StringTie exon 1560650 1561669 1000 . . gene_id "SS.347"; transcript_id "SS.347.1"; exon_number "1"; cov "7600.765625"; +CM143126.1 StringTie transcript 1561927 1563106 1000 . . gene_id "SS.348"; transcript_id "SS.348.1"; cov "4417.001695"; FPKM "216.011257"; TPM "461.906967"; +CM143126.1 StringTie exon 1561927 1563106 1000 . . gene_id "SS.348"; transcript_id "SS.348.1"; exon_number "1"; cov "4417.001465"; +CM143126.1 StringTie transcript 1563481 1564180 1000 . . gene_id "SS.349"; transcript_id "SS.349.1"; cov "343.577143"; FPKM "16.802468"; TPM "35.929503"; +CM143126.1 StringTie exon 1563481 1564180 1000 . . gene_id "SS.349"; transcript_id "SS.349.1"; exon_number "1"; cov "343.577148"; +CM143126.1 StringTie transcript 1565117 1572323 1000 . . gene_id "SS.350"; transcript_id "SS.350.1"; cov "680.360483"; FPKM "33.272689"; TPM "71.148546"; +CM143126.1 StringTie exon 1565117 1572323 1000 . . gene_id "SS.350"; transcript_id "SS.350.1"; exon_number "1"; cov "680.360474"; +CM143126.1 StringTie transcript 1574940 1576277 1000 - . gene_id "SS.351"; transcript_id "SS.351.1"; cov "17970.371762"; FPKM "878.832035"; TPM "1879.247617"; +CM143126.1 StringTie exon 1574940 1575599 1000 - . gene_id "SS.351"; transcript_id "SS.351.1"; exon_number "1"; cov "20915.707031"; +CM143126.1 StringTie exon 1576166 1576277 1000 - . gene_id "SS.351"; transcript_id "SS.351.1"; exon_number "2"; cov "613.928589"; +CM143126.1 StringTie transcript 1579876 1583552 1000 . . gene_id "SS.352"; transcript_id "SS.352.1"; cov "3281.244493"; FPKM "160.467619"; TPM "343.135411"; +CM143126.1 StringTie exon 1579876 1583552 1000 . . gene_id "SS.352"; transcript_id "SS.352.1"; exon_number "1"; cov "3281.244385"; +CM143126.1 StringTie transcript 1584960 1591557 1000 . . gene_id "SS.353"; transcript_id "SS.353.1"; cov "473.352986"; FPKM "23.149091"; TPM "49.500783"; +CM143126.1 StringTie exon 1584960 1591557 1000 . . gene_id "SS.353"; transcript_id "SS.353.1"; exon_number "1"; cov "473.352997"; +CM143126.1 StringTie transcript 1591883 1599897 1000 - . gene_id "SS.354"; transcript_id "SS.354.1"; cov "691.947171"; FPKM "33.839330"; TPM "72.360221"; +CM143126.1 StringTie exon 1591883 1599296 1000 - . gene_id "SS.354"; transcript_id "SS.354.1"; exon_number "1"; cov "662.868164"; +CM143126.1 StringTie exon 1599359 1599709 1000 - . gene_id "SS.354"; transcript_id "SS.354.1"; exon_number "2"; cov "1361.940186"; +CM143126.1 StringTie exon 1599798 1599897 1000 - . gene_id "SS.354"; transcript_id "SS.354.1"; exon_number "3"; cov "496.190002"; +CM143126.1 StringTie transcript 1597253 1598935 1000 . . gene_id "SS.355"; transcript_id "SS.355.1"; cov "4452.380570"; FPKM "217.741443"; TPM "465.606705"; +CM143126.1 StringTie exon 1597253 1598935 1000 . . gene_id "SS.355"; transcript_id "SS.355.1"; exon_number "1"; cov "4452.380371"; +CM143126.1 StringTie transcript 1600219 1601897 1000 . . gene_id "SS.356"; transcript_id "SS.356.1"; cov "786.241215"; FPKM "38.450733"; TPM "82.221000"; +CM143126.1 StringTie exon 1600219 1601897 1000 . . gene_id "SS.356"; transcript_id "SS.356.1"; exon_number "1"; cov "786.241211"; +CM143126.1 StringTie transcript 1604443 1608773 1000 . . gene_id "SS.357"; transcript_id "SS.357.1"; cov "508.039021"; FPKM "24.845394"; TPM "53.128067"; +CM143126.1 StringTie exon 1604443 1608773 1000 . . gene_id "SS.357"; transcript_id "SS.357.1"; exon_number "1"; cov "508.039032"; +CM143126.1 StringTie transcript 1610219 1612924 1000 . . gene_id "SS.358"; transcript_id "SS.358.1"; cov "2363.551922"; FPKM "115.588324"; TPM "247.167915"; +CM143126.1 StringTie exon 1610219 1612924 1000 . . gene_id "SS.358"; transcript_id "SS.358.1"; exon_number "1"; cov "2363.552002"; +CM143126.1 StringTie transcript 1613200 1614500 1000 - . gene_id "SS.359"; transcript_id "SS.359.1"; cov "20674.680315"; FPKM "1011.084891"; TPM "2162.050081"; +CM143126.1 StringTie exon 1613200 1613680 1000 - . gene_id "SS.359"; transcript_id "SS.359.1"; exon_number "1"; cov "26437.759766"; +CM143126.1 StringTie exon 1614347 1614500 1000 - . gene_id "SS.359"; transcript_id "SS.359.1"; exon_number "2"; cov "2674.415527"; +CM143126.1 StringTie transcript 1615941 1616691 1000 - . gene_id "SS.360"; transcript_id "SS.360.1"; cov "2768.104907"; FPKM "135.372785"; TPM "289.473953"; +CM143126.1 StringTie exon 1615941 1616462 1000 - . gene_id "SS.360"; transcript_id "SS.360.1"; exon_number "1"; cov "3087.789307"; +CM143126.1 StringTie exon 1616623 1616691 1000 - . gene_id "SS.360"; transcript_id "SS.360.1"; exon_number "2"; cov "349.623199"; +CM143126.1 StringTie transcript 1622772 1623376 1000 + . gene_id "SS.361"; transcript_id "SS.361.1"; cov "1999.976842"; FPKM "97.807866"; TPM "209.147132"; +CM143126.1 StringTie exon 1622772 1622921 1000 + . gene_id "SS.361"; transcript_id "SS.361.1"; exon_number "1"; cov "1188.573364"; +CM143126.1 StringTie exon 1623052 1623376 1000 + . gene_id "SS.361"; transcript_id "SS.361.1"; exon_number "2"; cov "2374.470703"; +CM143126.1 StringTie transcript 1623826 1625181 1000 . . gene_id "SS.362"; transcript_id "SS.362.1"; cov "1828.940265"; FPKM "89.443408"; TPM "191.261020"; +CM143126.1 StringTie exon 1623826 1625181 1000 . . gene_id "SS.362"; transcript_id "SS.362.1"; exon_number "1"; cov "1828.940308"; +CM143126.1 StringTie transcript 1627408 1629531 1000 . . gene_id "SS.363"; transcript_id "SS.363.1"; cov "3106.477872"; FPKM "151.920745"; TPM "324.859230"; +CM143126.1 StringTie exon 1627408 1629531 1000 . . gene_id "SS.363"; transcript_id "SS.363.1"; exon_number "1"; cov "3106.477783"; +CM143126.1 StringTie transcript 1634964 1638292 1000 . . gene_id "SS.364"; transcript_id "SS.364.1"; cov "83.422649"; FPKM "4.079743"; TPM "8.723905"; +CM143126.1 StringTie exon 1634964 1638292 1000 . . gene_id "SS.364"; transcript_id "SS.364.1"; exon_number "1"; cov "83.422653"; +CM143126.1 StringTie transcript 1638819 1644156 1000 . . gene_id "SS.365"; transcript_id "SS.365.1"; cov "825.196703"; FPKM "40.355832"; TPM "86.294761"; +CM143126.1 StringTie exon 1638819 1644156 1000 . . gene_id "SS.365"; transcript_id "SS.365.1"; exon_number "1"; cov "825.196716"; +CM143126.1 StringTie transcript 1644482 1645807 1000 + . gene_id "SS.366"; transcript_id "SS.366.1"; cov "7666.391304"; FPKM "374.921029"; TPM "801.711160"; +CM143126.1 StringTie exon 1644482 1644575 1000 + . gene_id "SS.366"; transcript_id "SS.366.1"; exon_number "1"; cov "2203.643555"; +CM143126.1 StringTie exon 1645258 1645807 1000 + . gene_id "SS.366"; transcript_id "SS.366.1"; exon_number "2"; cov "8600.024414"; +CM143126.1 StringTie transcript 1647821 1653934 1000 . . gene_id "SS.367"; transcript_id "SS.367.1"; cov "639.350343"; FPKM "31.267108"; TPM "66.859919"; +CM143126.1 StringTie exon 1647821 1653934 1000 . . gene_id "SS.367"; transcript_id "SS.367.1"; exon_number "1"; cov "639.350342"; +CM143126.1 StringTie transcript 1654293 1661508 1000 . . gene_id "SS.368"; transcript_id "SS.368.1"; cov "324.861973"; FPKM "15.887212"; TPM "33.972368"; +CM143126.1 StringTie exon 1654293 1661508 1000 . . gene_id "SS.368"; transcript_id "SS.368.1"; exon_number "1"; cov "324.861969"; +CM143126.1 StringTie transcript 1662431 1663340 1000 . . gene_id "SS.369"; transcript_id "SS.369.1"; cov "1045.514286"; FPKM "51.130353"; TPM "109.334423"; +CM143126.1 StringTie exon 1662431 1663340 1000 . . gene_id "SS.369"; transcript_id "SS.369.1"; exon_number "1"; cov "1045.514282"; +CM143126.1 StringTie transcript 1663889 1672562 1000 . . gene_id "SS.370"; transcript_id "SS.370.1"; cov "453.110589"; FPKM "22.159147"; TPM "47.383939"; +CM143126.1 StringTie exon 1663889 1672562 1000 . . gene_id "SS.370"; transcript_id "SS.370.1"; exon_number "1"; cov "453.110596"; +CM143126.1 StringTie transcript 1706574 1706832 1000 . . gene_id "SS.371"; transcript_id "SS.371.1"; cov "7.000000"; FPKM "0.342331"; TPM "0.732023"; +CM143126.1 StringTie exon 1706574 1706832 1000 . . gene_id "SS.371"; transcript_id "SS.371.1"; exon_number "1"; cov "7.000000"; +CM143126.1 StringTie transcript 1676737 1678455 1000 . . gene_id "SS.372"; transcript_id "SS.372.1"; cov "3332.250145"; FPKM "162.962025"; TPM "348.469315"; +CM143126.1 StringTie exon 1676737 1678455 1000 . . gene_id "SS.372"; transcript_id "SS.372.1"; exon_number "1"; cov "3332.250244"; +CM143126.1 StringTie transcript 1678810 1683604 1000 . . gene_id "SS.373"; transcript_id "SS.373.1"; cov "434.304067"; FPKM "21.239423"; TPM "45.417251"; +CM143126.1 StringTie exon 1678810 1683604 1000 . . gene_id "SS.373"; transcript_id "SS.373.1"; exon_number "1"; cov "434.304077"; +CM143126.1 StringTie transcript 1683936 1687763 1000 . . gene_id "SS.374"; transcript_id "SS.374.1"; cov "524.550679"; FPKM "25.652888"; TPM "54.854770"; +CM143126.1 StringTie exon 1683936 1687763 1000 . . gene_id "SS.374"; transcript_id "SS.374.1"; exon_number "1"; cov "524.550659"; +CM143126.1 StringTie transcript 1688293 1689632 1000 . . gene_id "SS.375"; transcript_id "SS.375.1"; cov "2076.780597"; FPKM "101.563915"; TPM "217.178868"; +CM143126.1 StringTie exon 1688293 1689632 1000 . . gene_id "SS.375"; transcript_id "SS.375.1"; exon_number "1"; cov "2076.780518"; +CM143126.1 StringTie transcript 1690138 1693865 1000 - . gene_id "SS.376"; transcript_id "SS.376.1"; cov "34.682207"; FPKM "1.696116"; TPM "3.626884"; +CM143126.1 StringTie exon 1690138 1693334 1000 - . gene_id "SS.376"; transcript_id "SS.376.1"; exon_number "1"; cov "36.980919"; +CM143126.1 StringTie exon 1693438 1693865 1000 - . gene_id "SS.376"; transcript_id "SS.376.1"; exon_number "2"; cov "17.511683"; +CM143126.1 StringTie transcript 1696109 1706112 1000 . . gene_id "SS.377"; transcript_id "SS.377.1"; cov "301.421356"; FPKM "14.740861"; TPM "31.521071"; +CM143126.1 StringTie exon 1696109 1706112 1000 . . gene_id "SS.377"; transcript_id "SS.377.1"; exon_number "1"; cov "301.421356"; +CM143126.1 StringTie transcript 1739422 1740638 1000 . . gene_id "SS.378"; transcript_id "SS.378.1"; cov "6.560394"; FPKM "0.320833"; TPM "0.686052"; +CM143126.1 StringTie exon 1739422 1740638 1000 . . gene_id "SS.378"; transcript_id "SS.378.1"; exon_number "1"; cov "6.560394"; +CM143126.1 StringTie transcript 1740894 1742576 1000 . . gene_id "SS.379"; transcript_id "SS.379.1"; cov "8.364231"; FPKM "0.409049"; TPM "0.874688"; +CM143126.1 StringTie exon 1740894 1742576 1000 . . gene_id "SS.379"; transcript_id "SS.379.1"; exon_number "1"; cov "8.364230"; +CM143126.1 StringTie transcript 1742858 1743986 1000 . . gene_id "SS.380"; transcript_id "SS.380.1"; cov "10.767936"; FPKM "0.526601"; TPM "1.126055"; +CM143126.1 StringTie exon 1742858 1743986 1000 . . gene_id "SS.380"; transcript_id "SS.380.1"; exon_number "1"; cov "10.767936"; +CM143126.1 StringTie transcript 1707385 1715645 1000 . . gene_id "SS.381"; transcript_id "SS.381.1"; cov "301.951217"; FPKM "14.766773"; TPM "31.576481"; +CM143126.1 StringTie exon 1707385 1715645 1000 . . gene_id "SS.381"; transcript_id "SS.381.1"; exon_number "1"; cov "301.951202"; +CM143126.1 StringTie transcript 1715896 1718592 1000 . . gene_id "SS.382"; transcript_id "SS.382.1"; cov "542.839080"; FPKM "26.547273"; TPM "56.767276"; +CM143126.1 StringTie exon 1715896 1718592 1000 . . gene_id "SS.382"; transcript_id "SS.382.1"; exon_number "1"; cov "542.839050"; +CM143126.1 StringTie transcript 1718917 1721658 1000 . . gene_id "SS.383"; transcript_id "SS.383.1"; cov "294.557987"; FPKM "14.405211"; TPM "30.803336"; +CM143126.1 StringTie exon 1718917 1721658 1000 . . gene_id "SS.383"; transcript_id "SS.383.1"; exon_number "1"; cov "294.557983"; +CM143126.1 StringTie transcript 1722290 1724234 1000 . . gene_id "SS.384"; transcript_id "SS.384.1"; cov "313.361954"; FPKM "15.324809"; TPM "32.769756"; +CM143126.1 StringTie exon 1722290 1724234 1000 . . gene_id "SS.384"; transcript_id "SS.384.1"; exon_number "1"; cov "313.361938"; +CM143126.1 StringTie transcript 1724802 1726906 1000 . . gene_id "SS.385"; transcript_id "SS.385.1"; cov "147.124466"; FPKM "7.195048"; TPM "15.385508"; +CM143126.1 StringTie exon 1724802 1726906 1000 . . gene_id "SS.385"; transcript_id "SS.385.1"; exon_number "1"; cov "147.124466"; +CM143126.1 StringTie transcript 1727217 1728362 1000 . . gene_id "SS.386"; transcript_id "SS.386.1"; cov "1422.780977"; FPKM "69.580391"; TPM "148.787003"; +CM143126.1 StringTie exon 1727217 1728362 1000 . . gene_id "SS.386"; transcript_id "SS.386.1"; exon_number "1"; cov "1422.781006"; +CM143126.1 StringTie transcript 1728569 1730195 1000 . . gene_id "SS.387"; transcript_id "SS.387.1"; cov "2199.437615"; FPKM "107.562396"; TPM "230.005698"; +CM143126.1 StringTie exon 1728569 1730195 1000 . . gene_id "SS.387"; transcript_id "SS.387.1"; exon_number "1"; cov "2199.437500"; +CM143126.1 StringTie transcript 1730566 1731764 1000 . . gene_id "SS.388"; transcript_id "SS.388.1"; cov "1026.688073"; FPKM "50.209666"; TPM "107.365676"; +CM143126.1 StringTie exon 1730566 1731764 1000 . . gene_id "SS.388"; transcript_id "SS.388.1"; exon_number "1"; cov "1026.688110"; +CM143126.1 StringTie transcript 1732081 1733471 1000 + . gene_id "SS.389"; transcript_id "SS.389.1"; cov "1414.207663"; FPKM "69.161118"; TPM "147.890451"; +CM143126.1 StringTie exon 1732081 1732217 1000 + . gene_id "SS.389"; transcript_id "SS.389.1"; exon_number "1"; cov "228.153290"; +CM143126.1 StringTie exon 1732304 1733471 1000 + . gene_id "SS.389"; transcript_id "SS.389.1"; exon_number "2"; cov "1553.325317"; +CM143126.1 StringTie transcript 1734000 1736076 1000 . . gene_id "SS.390"; transcript_id "SS.390.1"; cov "226.730862"; FPKM "11.088159"; TPM "23.710329"; +CM143126.1 StringTie exon 1734000 1736076 1000 . . gene_id "SS.390"; transcript_id "SS.390.1"; exon_number "1"; cov "226.730865"; +CM143126.1 StringTie transcript 1736325 1738141 1000 . . gene_id "SS.391"; transcript_id "SS.391.1"; cov "624.690699"; FPKM "30.550186"; TPM "65.326890"; +CM143126.1 StringTie exon 1736325 1738141 1000 . . gene_id "SS.391"; transcript_id "SS.391.1"; exon_number "1"; cov "624.690674"; +CM143126.1 StringTie transcript 1745030 1745524 1000 . . gene_id "SS.392"; transcript_id "SS.392.1"; cov "15299.240404"; FPKM "748.201693"; TPM "1599.914651"; +CM143126.1 StringTie exon 1745030 1745524 1000 . . gene_id "SS.392"; transcript_id "SS.392.1"; exon_number "1"; cov "15299.240234"; +CM143126.1 StringTie transcript 1746072 1749158 1000 . . gene_id "SS.393"; transcript_id "SS.393.1"; cov "199.933269"; FPKM "9.777636"; TPM "20.907977"; +CM143126.1 StringTie exon 1746072 1749158 1000 . . gene_id "SS.393"; transcript_id "SS.393.1"; exon_number "1"; cov "199.933273"; +CM143126.1 StringTie transcript 1749437 1750802 1000 . . gene_id "SS.394"; transcript_id "SS.394.1"; cov "1871.175695"; FPKM "91.508911"; TPM "195.677781"; +CM143126.1 StringTie exon 1749437 1750802 1000 . . gene_id "SS.394"; transcript_id "SS.394.1"; exon_number "1"; cov "1871.175659"; +CM143126.1 StringTie transcript 1751082 1754002 1000 . . gene_id "SS.395"; transcript_id "SS.395.1"; cov "770.890791"; FPKM "37.700028"; TPM "80.615732"; +CM143126.1 StringTie exon 1751082 1754002 1000 . . gene_id "SS.395"; transcript_id "SS.395.1"; exon_number "1"; cov "770.890808"; +CM143126.1 StringTie transcript 1754320 1755464 1000 . . gene_id "SS.396"; transcript_id "SS.396.1"; cov "3610.468122"; FPKM "176.568136"; TPM "377.563898"; +CM143126.1 StringTie exon 1754320 1755464 1000 . . gene_id "SS.396"; transcript_id "SS.396.1"; exon_number "1"; cov "3610.468018"; +CM143126.1 StringTie transcript 1758464 1759124 1000 . . gene_id "SS.397"; transcript_id "SS.397.1"; cov "6.251135"; FPKM "0.305709"; TPM "0.653711"; +CM143126.1 StringTie exon 1758464 1759124 1000 . . gene_id "SS.397"; transcript_id "SS.397.1"; exon_number "1"; cov "6.251135"; +CM143126.1 StringTie transcript 1762515 1764317 1000 . . gene_id "SS.398"; transcript_id "SS.398.1"; cov "8855.537438"; FPKM "433.075625"; TPM "926.065852"; +CM143126.1 StringTie exon 1762515 1764317 1000 . . gene_id "SS.398"; transcript_id "SS.398.1"; exon_number "1"; cov "8855.537109"; +CM143126.1 StringTie transcript 1772934 1773592 1000 . . gene_id "SS.399"; transcript_id "SS.399.1"; cov "42.915023"; FPKM "2.098738"; TPM "4.487829"; +CM143126.1 StringTie exon 1772934 1773592 1000 . . gene_id "SS.399"; transcript_id "SS.399.1"; exon_number "1"; cov "42.915024"; +CM143126.1 StringTie transcript 1775599 1780908 1000 . . gene_id "SS.400"; transcript_id "SS.400.1"; cov "11024.227495"; FPKM "539.134327"; TPM "1152.856130"; +CM143126.1 StringTie exon 1775599 1780908 1000 . . gene_id "SS.400"; transcript_id "SS.400.1"; exon_number "1"; cov "11024.227539"; +CM143126.1 StringTie transcript 1798603 1799601 1000 . . gene_id "SS.401"; transcript_id "SS.401.1"; cov "11672.884885"; FPKM "570.856592"; TPM "1220.689332"; +CM143126.1 StringTie exon 1798603 1799601 1000 . . gene_id "SS.401"; transcript_id "SS.401.1"; exon_number "1"; cov "11672.884766"; +CM143126.1 StringTie transcript 1807256 1818843 1000 . . gene_id "SS.402"; transcript_id "SS.402.1"; cov "93.106123"; FPKM "4.553308"; TPM "9.736552"; +CM143126.1 StringTie exon 1807256 1818843 1000 . . gene_id "SS.402"; transcript_id "SS.402.1"; exon_number "1"; cov "93.106125"; +CM143126.1 StringTie transcript 1819513 1821330 1000 . . gene_id "SS.403"; transcript_id "SS.403.1"; cov "880.842891"; FPKM "43.077181"; TPM "92.113949"; +CM143126.1 StringTie exon 1819513 1821330 1000 . . gene_id "SS.403"; transcript_id "SS.403.1"; exon_number "1"; cov "880.842896"; +CM143126.1 StringTie transcript 1822381 1826863 1000 . . gene_id "SS.404"; transcript_id "SS.404.1"; cov "141.038925"; FPKM "6.897438"; TPM "14.749114"; +CM143126.1 StringTie exon 1822381 1826863 1000 . . gene_id "SS.404"; transcript_id "SS.404.1"; exon_number "1"; cov "141.038925"; +CM143126.1 StringTie transcript 1827164 1828195 1000 . . gene_id "SS.405"; transcript_id "SS.405.1"; cov "355.400436"; FPKM "17.380680"; TPM "37.165921"; +CM143126.1 StringTie exon 1827164 1828195 1000 . . gene_id "SS.405"; transcript_id "SS.405.1"; exon_number "1"; cov "355.400421"; +CM143126.1 StringTie transcript 1829587 1831209 1000 . . gene_id "SS.406"; transcript_id "SS.406.1"; cov "12.208141"; FPKM "0.597033"; TPM "1.276664"; +CM143126.1 StringTie exon 1829587 1831209 1000 . . gene_id "SS.406"; transcript_id "SS.406.1"; exon_number "1"; cov "12.208140"; +CM143127.1 StringTie transcript 21333 22956 1000 . . gene_id "SS.407"; transcript_id "SS.407.1"; cov "50.325917"; FPKM "2.461164"; TPM "5.262822"; +CM143127.1 StringTie exon 21333 22956 1000 . . gene_id "SS.407"; transcript_id "SS.407.1"; exon_number "1"; cov "50.325916"; +CM143127.1 StringTie transcript 21333 22956 1000 + . gene_id "SS.408"; transcript_id "SS.408.1"; cov "16.189128"; FPKM "0.791721"; TPM "1.692974"; +CM143127.1 StringTie exon 21333 22077 1000 + . gene_id "SS.408"; transcript_id "SS.408.1"; exon_number "1"; cov "17.489477"; +CM143127.1 StringTie exon 22132 22956 1000 + . gene_id "SS.408"; transcript_id "SS.408.1"; exon_number "2"; cov "15.014873"; +CM143127.1 StringTie transcript 21333 22956 1000 + . gene_id "SS.408"; transcript_id "SS.408.2"; cov "9.257534"; FPKM "0.452735"; TPM "0.968105"; +CM143127.1 StringTie exon 21333 22089 1000 + . gene_id "SS.408"; transcript_id "SS.408.2"; exon_number "1"; cov "9.953796"; +CM143127.1 StringTie exon 22117 22956 1000 + . gene_id "SS.408"; transcript_id "SS.408.2"; exon_number "2"; cov "8.630069"; +CM143127.1 StringTie transcript 24857 25098 1000 . . gene_id "SS.409"; transcript_id "SS.409.1"; cov "5.884298"; FPKM "0.287769"; TPM "0.615349"; +CM143127.1 StringTie exon 24857 25098 1000 . . gene_id "SS.409"; transcript_id "SS.409.1"; exon_number "1"; cov "5.884297"; +CM143127.1 StringTie transcript 25529 25740 1000 . . gene_id "SS.410"; transcript_id "SS.410.1"; cov "6.000000"; FPKM "0.293427"; TPM "0.627449"; +CM143127.1 StringTie exon 25529 25740 1000 . . gene_id "SS.410"; transcript_id "SS.410.1"; exon_number "1"; cov "6.000000"; +CM143127.1 StringTie transcript 26107 26316 1000 . . gene_id "SS.411"; transcript_id "SS.411.1"; cov "14.519048"; FPKM "0.710047"; TPM "1.518326"; +CM143127.1 StringTie exon 26107 26316 1000 . . gene_id "SS.411"; transcript_id "SS.411.1"; exon_number "1"; cov "14.519048"; +CM143127.1 StringTie transcript 3381 4369 1000 . . gene_id "SS.412"; transcript_id "SS.412.1"; cov "253.212936"; FPKM "12.383252"; TPM "26.479686"; +CM143127.1 StringTie exon 3381 4369 1000 . . gene_id "SS.412"; transcript_id "SS.412.1"; exon_number "1"; cov "253.212936"; +CM143127.1 StringTie transcript 13985 20944 1000 . . gene_id "SS.413"; transcript_id "SS.413.1"; cov "139.063667"; FPKM "6.800839"; TPM "14.542552"; +CM143127.1 StringTie exon 13985 20944 1000 . . gene_id "SS.413"; transcript_id "SS.413.1"; exon_number "1"; cov "139.063675"; +CM143127.1 StringTie transcript 43698 45375 1000 . . gene_id "SS.414"; transcript_id "SS.414.1"; cov "122.507151"; FPKM "5.991151"; TPM "12.811158"; +CM143127.1 StringTie exon 43698 45375 1000 . . gene_id "SS.414"; transcript_id "SS.414.1"; exon_number "1"; cov "122.507149"; +CM143127.1 StringTie transcript 46144 49594 1000 . . gene_id "SS.415"; transcript_id "SS.415.1"; cov "208.902927"; FPKM "10.216293"; TPM "21.845977"; +CM143127.1 StringTie exon 46144 49594 1000 . . gene_id "SS.415"; transcript_id "SS.415.1"; exon_number "1"; cov "208.902924"; +CM143127.1 StringTie transcript 49901 52055 1000 . . gene_id "SS.416"; transcript_id "SS.416.1"; cov "10.971230"; FPKM "0.536543"; TPM "1.147314"; +CM143127.1 StringTie exon 49901 52055 1000 . . gene_id "SS.416"; transcript_id "SS.416.1"; exon_number "1"; cov "10.971230"; +CM143127.1 StringTie transcript 27261 29313 1000 . . gene_id "SS.417"; transcript_id "SS.417.1"; cov "178.828057"; FPKM "8.745497"; TPM "18.700904"; +CM143127.1 StringTie exon 27261 29313 1000 . . gene_id "SS.417"; transcript_id "SS.417.1"; exon_number "1"; cov "178.828064"; +CM143127.1 StringTie transcript 34069 35518 1000 . . gene_id "SS.418"; transcript_id "SS.418.1"; cov "2470.678621"; FPKM "120.827301"; TPM "258.370665"; +CM143127.1 StringTie exon 34069 35518 1000 . . gene_id "SS.418"; transcript_id "SS.418.1"; exon_number "1"; cov "2470.678711"; +CM143127.1 StringTie transcript 36701 40469 1000 . . gene_id "SS.419"; transcript_id "SS.419.1"; cov "2634.863359"; FPKM "128.856674"; TPM "275.540248"; +CM143127.1 StringTie exon 36701 40469 1000 . . gene_id "SS.419"; transcript_id "SS.419.1"; exon_number "1"; cov "2634.863281"; +CM143127.1 StringTie transcript 41967 42350 1000 . . gene_id "SS.420"; transcript_id "SS.420.1"; cov "6.802083"; FPKM "0.332652"; TPM "0.711326"; +CM143127.1 StringTie exon 41967 42350 1000 . . gene_id "SS.420"; transcript_id "SS.420.1"; exon_number "1"; cov "6.802083"; +CM143127.1 StringTie transcript 54384 55950 1000 + . gene_id "SS.421"; transcript_id "SS.421.1"; cov "3559.113924"; FPKM "174.056685"; TPM "372.193544"; +CM143127.1 StringTie exon 54384 54477 1000 + . gene_id "SS.421"; transcript_id "SS.421.1"; exon_number "1"; cov "833.053162"; +CM143127.1 StringTie exon 54623 55950 1000 + . gene_id "SS.421"; transcript_id "SS.421.1"; exon_number "2"; cov "3752.072998"; +CM143127.1 StringTie transcript 56293 60178 1000 . . gene_id "SS.422"; transcript_id "SS.422.1"; cov "153.065878"; FPKM "7.485610"; TPM "16.006830"; +CM143127.1 StringTie exon 56293 60178 1000 . . gene_id "SS.422"; transcript_id "SS.422.1"; exon_number "1"; cov "153.065872"; +CM143127.1 StringTie transcript 60427 64729 1000 . . gene_id "SS.423"; transcript_id "SS.423.1"; cov "1092.433186"; FPKM "53.424898"; TPM "114.240957"; +CM143127.1 StringTie exon 60427 64729 1000 . . gene_id "SS.423"; transcript_id "SS.423.1"; exon_number "1"; cov "1092.433228"; +CM143127.1 StringTie transcript 68732 69231 1000 . . gene_id "SS.424"; transcript_id "SS.424.1"; cov "6.428000"; FPKM "0.314358"; TPM "0.672207"; +CM143127.1 StringTie exon 68732 69231 1000 . . gene_id "SS.424"; transcript_id "SS.424.1"; exon_number "1"; cov "6.428000"; +CM143127.1 StringTie transcript 65031 66042 1000 . . gene_id "SS.425"; transcript_id "SS.425.1"; cov "662.891304"; FPKM "32.418367"; TPM "69.321710"; +CM143127.1 StringTie exon 65031 66042 1000 . . gene_id "SS.425"; transcript_id "SS.425.1"; exon_number "1"; cov "662.891296"; +CM143127.1 StringTie transcript 69833 73206 1000 . . gene_id "SS.426"; transcript_id "SS.426.1"; cov "1715.282750"; FPKM "83.885044"; TPM "179.375311"; +CM143127.1 StringTie exon 69833 73206 1000 . . gene_id "SS.426"; transcript_id "SS.426.1"; exon_number "1"; cov "1715.282715"; +CM143127.1 StringTie transcript 73835 74718 1000 . . gene_id "SS.427"; transcript_id "SS.427.1"; cov "919.294118"; FPKM "44.957619"; TPM "96.134977"; +CM143127.1 StringTie exon 73835 74718 1000 . . gene_id "SS.427"; transcript_id "SS.427.1"; exon_number "1"; cov "919.294128"; +CM143127.1 StringTie transcript 75295 77080 1000 . . gene_id "SS.428"; transcript_id "SS.428.1"; cov "688.376820"; FPKM "33.664724"; TPM "71.986852"; +CM143127.1 StringTie exon 75295 77080 1000 . . gene_id "SS.428"; transcript_id "SS.428.1"; exon_number "1"; cov "688.376831"; +CM143127.1 StringTie transcript 77496 79533 1000 . . gene_id "SS.429"; transcript_id "SS.429.1"; cov "661.618744"; FPKM "32.356133"; TPM "69.188633"; +CM143127.1 StringTie exon 77496 79533 1000 . . gene_id "SS.429"; transcript_id "SS.429.1"; exon_number "1"; cov "661.618713"; +CM143127.1 StringTie transcript 80063 86129 1000 . . gene_id "SS.430"; transcript_id "SS.430.1"; cov "369.707104"; FPKM "18.080341"; TPM "38.662038"; +CM143127.1 StringTie exon 80063 86129 1000 . . gene_id "SS.430"; transcript_id "SS.430.1"; exon_number "1"; cov "369.707092"; +CM143127.1 StringTie transcript 88769 90225 1000 . . gene_id "SS.431"; transcript_id "SS.431.1"; cov "931.790666"; FPKM "45.568756"; TPM "97.441801"; +CM143127.1 StringTie exon 88769 90225 1000 . . gene_id "SS.431"; transcript_id "SS.431.1"; exon_number "1"; cov "931.790649"; +CM143127.1 StringTie transcript 93464 94184 1000 . . gene_id "SS.432"; transcript_id "SS.432.1"; cov "5356.901526"; FPKM "261.976587"; TPM "560.196782"; +CM143127.1 StringTie exon 93464 94184 1000 . . gene_id "SS.432"; transcript_id "SS.432.1"; exon_number "1"; cov "5356.901367"; +CM143127.1 StringTie transcript 94649 95545 1000 . . gene_id "SS.433"; transcript_id "SS.433.1"; cov "769.372352"; FPKM "37.625770"; TPM "80.456942"; +CM143127.1 StringTie exon 94649 95545 1000 . . gene_id "SS.433"; transcript_id "SS.433.1"; exon_number "1"; cov "769.372375"; +CM143127.1 StringTie transcript 97980 98881 1000 - . gene_id "SS.434"; transcript_id "SS.434.1"; cov "24520.616883"; FPKM "1199.168494"; TPM "2564.238039"; +CM143127.1 StringTie exon 97980 98391 1000 - . gene_id "SS.434"; transcript_id "SS.434.1"; exon_number "1"; cov "27172.683594"; +CM143127.1 StringTie exon 98832 98881 1000 - . gene_id "SS.434"; transcript_id "SS.434.1"; exon_number "2"; cov "2667.580078"; +CM143127.1 StringTie transcript 99641 100603 1000 + . gene_id "SS.435"; transcript_id "SS.435.1"; cov "11973.246454"; FPKM "585.545624"; TPM "1252.099576"; +CM143127.1 StringTie exon 99641 99699 1000 + . gene_id "SS.435"; transcript_id "SS.435.1"; exon_number "1"; cov "747.915283"; +CM143127.1 StringTie exon 100099 100603 1000 + . gene_id "SS.435"; transcript_id "SS.435.1"; exon_number "2"; cov "13284.720703"; +CM143127.1 StringTie transcript 101052 102171 1000 + . gene_id "SS.436"; transcript_id "SS.436.1"; cov "22155.400000"; FPKM "1083.498746"; TPM "2316.896011"; +CM143127.1 StringTie exon 101052 101103 1000 + . gene_id "SS.436"; transcript_id "SS.436.1"; exon_number "1"; cov "1325.923096"; +CM143127.1 StringTie exon 101484 102171 1000 + . gene_id "SS.436"; transcript_id "SS.436.1"; exon_number "2"; cov "23729.720703"; +CM143127.1 StringTie transcript 104925 106034 1000 . . gene_id "SS.437"; transcript_id "SS.437.1"; cov "9.686486"; FPKM "0.473713"; TPM "1.012962"; +CM143127.1 StringTie exon 104925 106034 1000 . . gene_id "SS.437"; transcript_id "SS.437.1"; exon_number "1"; cov "9.686486"; +CM143127.1 StringTie transcript 107407 109246 1000 . . gene_id "SS.438"; transcript_id "SS.438.1"; cov "1429.309783"; FPKM "69.899679"; TPM "149.469752"; +CM143127.1 StringTie exon 107407 109246 1000 . . gene_id "SS.438"; transcript_id "SS.438.1"; exon_number "1"; cov "1429.309814"; +CM143127.1 StringTie transcript 111620 112859 1000 . . gene_id "SS.439"; transcript_id "SS.439.1"; cov "1072.299194"; FPKM "52.440255"; TPM "112.135449"; +CM143127.1 StringTie exon 111620 112859 1000 . . gene_id "SS.439"; transcript_id "SS.439.1"; exon_number "1"; cov "1072.299194"; +CM143127.1 StringTie transcript 118772 120451 1000 . . gene_id "SS.440"; transcript_id "SS.440.1"; cov "3468.661310"; FPKM "169.633145"; TPM "362.734482"; +CM143127.1 StringTie exon 118772 120451 1000 . . gene_id "SS.440"; transcript_id "SS.440.1"; exon_number "1"; cov "3468.661377"; +CM143127.1 StringTie transcript 134242 136606 1000 . . gene_id "SS.441"; transcript_id "SS.441.1"; cov "797.732770"; FPKM "39.012722"; TPM "83.422726"; +CM143127.1 StringTie exon 134242 136606 1000 . . gene_id "SS.441"; transcript_id "SS.441.1"; exon_number "1"; cov "797.732788"; +CM143127.1 StringTie transcript 136933 140584 1000 . . gene_id "SS.442"; transcript_id "SS.442.1"; cov "1278.291073"; FPKM "62.514185"; TPM "133.677004"; +CM143127.1 StringTie exon 136933 140584 1000 . . gene_id "SS.442"; transcript_id "SS.442.1"; exon_number "1"; cov "1278.291016"; +CM143127.1 StringTie transcript 141311 142659 1000 . . gene_id "SS.443"; transcript_id "SS.443.1"; cov "157.108228"; FPKM "7.683299"; TPM "16.429558"; +CM143127.1 StringTie exon 141311 142659 1000 . . gene_id "SS.443"; transcript_id "SS.443.1"; exon_number "1"; cov "157.108231"; +CM143127.1 StringTie transcript 144591 145785 1000 . . gene_id "SS.444"; transcript_id "SS.444.1"; cov "1444.937238"; FPKM "70.663932"; TPM "151.103989"; +CM143127.1 StringTie exon 144591 145785 1000 . . gene_id "SS.444"; transcript_id "SS.444.1"; exon_number "1"; cov "1444.937256"; +CM143127.1 StringTie transcript 146273 146816 1000 . . gene_id "SS.445"; transcript_id "SS.445.1"; cov "311.604779"; FPKM "15.238876"; TPM "32.586000"; +CM143127.1 StringTie exon 146273 146816 1000 . . gene_id "SS.445"; transcript_id "SS.445.1"; exon_number "1"; cov "311.604767"; +CM143127.1 StringTie transcript 147136 148412 1000 . . gene_id "SS.446"; transcript_id "SS.446.1"; cov "702.707909"; FPKM "34.365579"; TPM "73.485523"; +CM143127.1 StringTie exon 147136 148412 1000 . . gene_id "SS.446"; transcript_id "SS.446.1"; exon_number "1"; cov "702.707886"; +CM143127.1 StringTie transcript 148683 152440 1000 . . gene_id "SS.447"; transcript_id "SS.447.1"; cov "592.592070"; FPKM "28.980419"; TPM "61.970183"; +CM143127.1 StringTie exon 148683 152440 1000 . . gene_id "SS.447"; transcript_id "SS.447.1"; exon_number "1"; cov "592.592041"; +CM143127.1 StringTie transcript 152806 154453 1000 . . gene_id "SS.448"; transcript_id "SS.448.1"; cov "515.061286"; FPKM "25.188814"; TPM "53.862419"; +CM143127.1 StringTie exon 152806 154453 1000 . . gene_id "SS.448"; transcript_id "SS.448.1"; exon_number "1"; cov "515.061279"; +CM143127.1 StringTie transcript 160451 163196 1000 - . gene_id "SS.449"; transcript_id "SS.449.1"; cov "1825.143068"; FPKM "89.257708"; TPM "190.863929"; +CM143127.1 StringTie exon 160451 162211 1000 - . gene_id "SS.449"; transcript_id "SS.449.1"; exon_number "1"; cov "955.724243"; +CM143127.1 StringTie exon 162668 163196 1000 - . gene_id "SS.449"; transcript_id "SS.449.1"; exon_number "2"; cov "4719.371094"; +CM143127.1 StringTie transcript 160451 162518 1000 - . gene_id "SS.449"; transcript_id "SS.449.2"; cov "1324.909103"; FPKM "64.794016"; TPM "138.552074"; +CM143127.1 StringTie exon 160451 162211 1000 - . gene_id "SS.449"; transcript_id "SS.449.2"; exon_number "1"; cov "687.465210"; +CM143127.1 StringTie exon 162440 162518 1000 - . gene_id "SS.449"; transcript_id "SS.449.2"; exon_number "2"; cov "15534.259766"; +CM143127.1 StringTie transcript 160451 162576 1000 - . gene_id "SS.449"; transcript_id "SS.449.3"; cov "1884.895285"; FPKM "92.179860"; TPM "197.112504"; +CM143127.1 StringTie exon 160451 162319 1000 - . gene_id "SS.449"; transcript_id "SS.449.3"; exon_number "1"; cov "1612.341553"; +CM143127.1 StringTie exon 162548 162576 1000 - . gene_id "SS.449"; transcript_id "SS.449.3"; exon_number "2"; cov "19450.517578"; +CM143127.1 StringTie transcript 162415 163196 1000 - . gene_id "SS.449"; transcript_id "SS.449.4"; cov "6935.226986"; FPKM "339.163804"; TPM "725.249815"; +CM143127.1 StringTie exon 162415 162439 1000 - . gene_id "SS.449"; transcript_id "SS.449.4"; exon_number "1"; cov "20197.599609"; +CM143127.1 StringTie exon 162668 163196 1000 - . gene_id "SS.449"; transcript_id "SS.449.4"; exon_number "2"; cov "6308.460938"; +CM143127.1 StringTie transcript 162483 163196 1000 - . gene_id "SS.449"; transcript_id "SS.449.5"; cov "4277.689429"; FPKM "209.198260"; TPM "447.338418"; +CM143127.1 StringTie exon 162483 162547 1000 - . gene_id "SS.449"; transcript_id "SS.449.5"; exon_number "1"; cov "14756.375977"; +CM143127.1 StringTie exon 162776 163196 1000 - . gene_id "SS.449"; transcript_id "SS.449.5"; exon_number "2"; cov "2659.839844"; +CM143127.1 StringTie transcript 162643 163196 1000 - . gene_id "SS.449"; transcript_id "SS.449.6"; cov "1794.715443"; FPKM "87.769660"; TPM "187.681967"; +CM143127.1 StringTie exon 162643 162667 1000 - . gene_id "SS.449"; transcript_id "SS.449.6"; exon_number "1"; cov "14778.400391"; +CM143127.1 StringTie exon 162896 163196 1000 - . gene_id "SS.449"; transcript_id "SS.449.6"; exon_number "2"; cov "716.336304"; +CM143127.1 StringTie transcript 190264 193975 1000 . . gene_id "SS.450"; transcript_id "SS.450.1"; cov "298.106950"; FPKM "14.578771"; TPM "31.174468"; +CM143127.1 StringTie exon 190264 193975 1000 . . gene_id "SS.450"; transcript_id "SS.450.1"; exon_number "1"; cov "298.106964"; +CM143127.1 StringTie transcript 194283 199412 1000 . . gene_id "SS.451"; transcript_id "SS.451.1"; cov "202.072515"; FPKM "9.882255"; TPM "21.131688"; +CM143127.1 StringTie exon 194283 199412 1000 . . gene_id "SS.451"; transcript_id "SS.451.1"; exon_number "1"; cov "202.072510"; +CM143127.1 StringTie transcript 164083 165253 1000 - . gene_id "SS.452"; transcript_id "SS.452.1"; cov "663.230181"; FPKM "32.434940"; TPM "69.357148"; +CM143127.1 StringTie exon 164083 165025 1000 - . gene_id "SS.452"; transcript_id "SS.452.1"; exon_number "1"; cov "717.718994"; +CM143127.1 StringTie exon 165150 165253 1000 - . gene_id "SS.452"; transcript_id "SS.452.1"; exon_number "2"; cov "169.163467"; +CM143127.1 StringTie transcript 170110 170973 1000 . . gene_id "SS.453"; transcript_id "SS.453.1"; cov "3467.363426"; FPKM "169.569673"; TPM "362.598757"; +CM143127.1 StringTie exon 170110 170973 1000 . . gene_id "SS.453"; transcript_id "SS.453.1"; exon_number "1"; cov "3467.363525"; +CM143127.1 StringTie transcript 171453 172438 1000 . . gene_id "SS.454"; transcript_id "SS.454.1"; cov "5346.065923"; FPKM "261.446678"; TPM "559.063651"; +CM143127.1 StringTie exon 171453 172438 1000 . . gene_id "SS.454"; transcript_id "SS.454.1"; exon_number "1"; cov "5346.065918"; +CM143127.1 StringTie transcript 176332 178138 1000 . . gene_id "SS.455"; transcript_id "SS.455.1"; cov "1945.884339"; FPKM "95.162499"; TPM "203.490421"; +CM143127.1 StringTie exon 176332 178138 1000 . . gene_id "SS.455"; transcript_id "SS.455.1"; exon_number "1"; cov "1945.884399"; +CM143127.1 StringTie transcript 179723 181738 1000 . . gene_id "SS.456"; transcript_id "SS.456.1"; cov "20214.996032"; FPKM "988.604261"; TPM "2113.978699"; +CM143127.1 StringTie exon 179723 181738 1000 . . gene_id "SS.456"; transcript_id "SS.456.1"; exon_number "1"; cov "20214.996094"; +CM143127.1 StringTie transcript 182714 184272 1000 . . gene_id "SS.457"; transcript_id "SS.457.1"; cov "1753.000641"; FPKM "85.729619"; TPM "183.319651"; +CM143127.1 StringTie exon 182714 184272 1000 . . gene_id "SS.457"; transcript_id "SS.457.1"; exon_number "1"; cov "1753.000610"; +CM143127.1 StringTie transcript 184714 189979 1000 . . gene_id "SS.458"; transcript_id "SS.458.1"; cov "308.339916"; FPKM "15.079209"; TPM "32.244578"; +CM143127.1 StringTie exon 184714 189979 1000 . . gene_id "SS.458"; transcript_id "SS.458.1"; exon_number "1"; cov "308.339905"; +CM143127.1 StringTie transcript 199709 201313 1000 + . gene_id "SS.459"; transcript_id "SS.459.1"; cov "1606.270288"; FPKM "78.553844"; TPM "167.975357"; +CM143127.1 StringTie exon 199709 199853 1000 + . gene_id "SS.459"; transcript_id "SS.459.1"; exon_number "1"; cov "542.875854"; +CM143127.1 StringTie exon 199931 201313 1000 + . gene_id "SS.459"; transcript_id "SS.459.1"; exon_number "2"; cov "1717.761353"; +CM143127.1 StringTie transcript 216236 219056 1000 . . gene_id "SS.460"; transcript_id "SS.460.1"; cov "156.123715"; FPKM "7.635152"; TPM "16.326603"; +CM143127.1 StringTie exon 216236 219056 1000 . . gene_id "SS.460"; transcript_id "SS.460.1"; exon_number "1"; cov "156.123718"; +CM143127.1 StringTie transcript 220553 222012 1000 . . gene_id "SS.461"; transcript_id "SS.461.1"; cov "27450.936986"; FPKM "1342.474331"; TPM "2870.675610"; +CM143127.1 StringTie exon 220553 222012 1000 . . gene_id "SS.461"; transcript_id "SS.461.1"; exon_number "1"; cov "27450.937500"; +CM143127.1 StringTie transcript 225816 226823 1000 - . gene_id "SS.462"; transcript_id "SS.462.1"; cov "14566.064718"; FPKM "712.346103"; TPM "1523.242968"; +CM143127.1 StringTie exon 225816 226238 1000 - . gene_id "SS.462"; transcript_id "SS.462.1"; exon_number "1"; cov "16391.375000"; +CM143127.1 StringTie exon 226768 226823 1000 - . gene_id "SS.462"; transcript_id "SS.462.1"; exon_number "2"; cov "778.446411"; +CM143127.1 StringTie transcript 227484 229958 1000 . . gene_id "SS.463"; transcript_id "SS.463.1"; cov "1275.134949"; FPKM "62.359836"; TPM "133.346953"; +CM143127.1 StringTie exon 227484 229958 1000 . . gene_id "SS.463"; transcript_id "SS.463.1"; exon_number "1"; cov "1275.135010"; +CM143127.1 StringTie transcript 230298 233501 1000 . . gene_id "SS.464"; transcript_id "SS.464.1"; cov "2542.403870"; FPKM "124.334989"; TPM "265.871317"; +CM143127.1 StringTie exon 230298 233501 1000 . . gene_id "SS.464"; transcript_id "SS.464.1"; exon_number "1"; cov "2542.403809"; +CM143127.1 StringTie transcript 234177 235442 1000 . . gene_id "SS.465"; transcript_id "SS.465.1"; cov "169.296998"; FPKM "8.279385"; TPM "17.704196"; +CM143127.1 StringTie exon 234177 235442 1000 . . gene_id "SS.465"; transcript_id "SS.465.1"; exon_number "1"; cov "169.296997"; +CM143127.1 StringTie transcript 236534 242547 1000 . . gene_id "SS.466"; transcript_id "SS.466.1"; cov "1194.145494"; FPKM "58.399088"; TPM "124.877499"; +CM143127.1 StringTie exon 236534 242547 1000 . . gene_id "SS.466"; transcript_id "SS.466.1"; exon_number "1"; cov "1194.145508"; +CM143127.1 StringTie transcript 245046 246137 1000 . . gene_id "SS.467"; transcript_id "SS.467.1"; cov "1293.431319"; FPKM "63.254611"; TPM "135.260292"; +CM143127.1 StringTie exon 245046 246137 1000 . . gene_id "SS.467"; transcript_id "SS.467.1"; exon_number "1"; cov "1293.431274"; +CM143127.1 StringTie transcript 247596 255598 1000 . . gene_id "SS.468"; transcript_id "SS.468.1"; cov "84.386168"; FPKM "4.126863"; TPM "8.824665"; +CM143127.1 StringTie exon 247596 255598 1000 . . gene_id "SS.468"; transcript_id "SS.468.1"; exon_number "1"; cov "84.386169"; +CM143127.1 StringTie transcript 258422 260657 1000 . . gene_id "SS.469"; transcript_id "SS.469.1"; cov "33054.851521"; FPKM "1616.530966"; TPM "3456.703722"; +CM143127.1 StringTie exon 258422 260657 1000 . . gene_id "SS.469"; transcript_id "SS.469.1"; exon_number "1"; cov "33054.851562"; +CM143127.1 StringTie transcript 261593 277199 1000 . . gene_id "SS.470"; transcript_id "SS.470.1"; cov "792.064586"; FPKM "38.735522"; TPM "82.829977"; +CM143127.1 StringTie exon 261593 277199 1000 . . gene_id "SS.470"; transcript_id "SS.470.1"; exon_number "1"; cov "792.064575"; +CM143127.1 StringTie transcript 323722 324891 1000 . . gene_id "SS.471"; transcript_id "SS.471.1"; cov "9.353846"; FPKM "0.457445"; TPM "0.978176"; +CM143127.1 StringTie exon 323722 324891 1000 . . gene_id "SS.471"; transcript_id "SS.471.1"; exon_number "1"; cov "9.353847"; +CM143127.1 StringTie transcript 315500 318413 1000 . . gene_id "SS.472"; transcript_id "SS.472.1"; cov "126.613246"; FPKM "6.191957"; TPM "13.240552"; +CM143127.1 StringTie exon 315500 318413 1000 . . gene_id "SS.472"; transcript_id "SS.472.1"; exon_number "1"; cov "126.613243"; +CM143127.1 StringTie transcript 318903 323304 1000 . . gene_id "SS.473"; transcript_id "SS.473.1"; cov "64.086552"; FPKM "3.134121"; TPM "6.701837"; +CM143127.1 StringTie exon 318903 323304 1000 . . gene_id "SS.473"; transcript_id "SS.473.1"; exon_number "1"; cov "64.086548"; +CM143127.1 StringTie transcript 325260 325480 1000 . . gene_id "SS.474"; transcript_id "SS.474.1"; cov "12.000000"; FPKM "0.586854"; TPM "1.254897"; +CM143127.1 StringTie exon 325260 325480 1000 . . gene_id "SS.474"; transcript_id "SS.474.1"; exon_number "1"; cov "12.000000"; +CM143127.1 StringTie transcript 325947 326476 1000 . . gene_id "SS.475"; transcript_id "SS.475.1"; cov "6.424528"; FPKM "0.314188"; TPM "0.671844"; +CM143127.1 StringTie exon 325947 326476 1000 . . gene_id "SS.475"; transcript_id "SS.475.1"; exon_number "1"; cov "6.424528"; +CM143127.1 StringTie transcript 278819 281522 1000 . . gene_id "SS.476"; transcript_id "SS.476.1"; cov "493.705621"; FPKM "24.144426"; TPM "51.629155"; +CM143127.1 StringTie exon 278819 281522 1000 . . gene_id "SS.476"; transcript_id "SS.476.1"; exon_number "1"; cov "493.705627"; +CM143127.1 StringTie transcript 281816 283457 1000 . . gene_id "SS.477"; transcript_id "SS.477.1"; cov "4900.957978"; FPKM "239.678896"; TPM "512.516587"; +CM143127.1 StringTie exon 281816 283457 1000 . . gene_id "SS.477"; transcript_id "SS.477.1"; exon_number "1"; cov "4900.958008"; +CM143127.1 StringTie transcript 285277 286770 1000 . . gene_id "SS.478"; transcript_id "SS.478.1"; cov "5369.928380"; FPKM "262.613659"; TPM "561.559062"; +CM143127.1 StringTie exon 285277 286770 1000 . . gene_id "SS.478"; transcript_id "SS.478.1"; exon_number "1"; cov "5369.928223"; +CM143127.1 StringTie transcript 287152 290102 1000 . . gene_id "SS.479"; transcript_id "SS.479.1"; cov "793.280583"; FPKM "38.794990"; TPM "82.957140"; +CM143127.1 StringTie exon 287152 290102 1000 . . gene_id "SS.479"; transcript_id "SS.479.1"; exon_number "1"; cov "793.280579"; +CM143127.1 StringTie transcript 295588 299027 1000 . . gene_id "SS.480"; transcript_id "SS.480.1"; cov "1618.829070"; FPKM "79.168025"; TPM "169.288689"; +CM143127.1 StringTie exon 295588 299027 1000 . . gene_id "SS.480"; transcript_id "SS.480.1"; exon_number "1"; cov "1618.829102"; +CM143127.1 StringTie transcript 299274 301744 1000 . . gene_id "SS.481"; transcript_id "SS.481.1"; cov "1078.199514"; FPKM "52.728807"; TPM "112.752474"; +CM143127.1 StringTie exon 299274 301744 1000 . . gene_id "SS.481"; transcript_id "SS.481.1"; exon_number "1"; cov "1078.199463"; +CM143127.1 StringTie transcript 303853 305807 1000 . . gene_id "SS.482"; transcript_id "SS.482.1"; cov "2556.459847"; FPKM "125.022389"; TPM "267.341218"; +CM143127.1 StringTie exon 303853 305807 1000 . . gene_id "SS.482"; transcript_id "SS.482.1"; exon_number "1"; cov "2556.459961"; +CM143127.1 StringTie transcript 306923 308120 1000 . . gene_id "SS.483"; transcript_id "SS.483.1"; cov "3602.561770"; FPKM "176.181480"; TPM "376.737093"; +CM143127.1 StringTie exon 306923 308120 1000 . . gene_id "SS.483"; transcript_id "SS.483.1"; exon_number "1"; cov "3602.561768"; +CM143127.1 StringTie transcript 308655 310424 1000 . . gene_id "SS.484"; transcript_id "SS.484.1"; cov "1824.022034"; FPKM "89.202884"; TPM "190.746697"; +CM143127.1 StringTie exon 308655 310424 1000 . . gene_id "SS.484"; transcript_id "SS.484.1"; exon_number "1"; cov "1824.022095"; +CM143127.1 StringTie transcript 310864 313373 1000 . . gene_id "SS.485"; transcript_id "SS.485.1"; cov "1367.139442"; FPKM "66.859270"; TPM "142.968302"; +CM143127.1 StringTie exon 310864 313373 1000 . . gene_id "SS.485"; transcript_id "SS.485.1"; exon_number "1"; cov "1367.139404"; +CM143127.1 StringTie transcript 383586 387554 1000 . . gene_id "SS.486"; transcript_id "SS.486.1"; cov "866.618166"; FPKM "42.381528"; TPM "90.626401"; +CM143127.1 StringTie exon 383586 387554 1000 . . gene_id "SS.486"; transcript_id "SS.486.1"; exon_number "1"; cov "866.618164"; +CM143127.1 StringTie transcript 387875 391681 1000 . . gene_id "SS.487"; transcript_id "SS.487.1"; cov "229.290780"; FPKM "11.213351"; TPM "23.978032"; +CM143127.1 StringTie exon 387875 391681 1000 . . gene_id "SS.487"; transcript_id "SS.487.1"; exon_number "1"; cov "229.290787"; +CM143127.1 StringTie transcript 326887 329565 1000 . . gene_id "SS.488"; transcript_id "SS.488.1"; cov "1653.877566"; FPKM "80.882054"; TPM "172.953877"; +CM143127.1 StringTie exon 326887 329565 1000 . . gene_id "SS.488"; transcript_id "SS.488.1"; exon_number "1"; cov "1653.877563"; +CM143127.1 StringTie transcript 329830 332648 1000 - . gene_id "SS.489"; transcript_id "SS.489.1"; cov "1640.046630"; FPKM "80.205659"; TPM "171.507510"; +CM143127.1 StringTie exon 329830 332445 1000 - . gene_id "SS.489"; transcript_id "SS.489.1"; exon_number "1"; cov "1706.148682"; +CM143127.1 StringTie exon 332520 332648 1000 - . gene_id "SS.489"; transcript_id "SS.489.1"; exon_number "2"; cov "299.558136"; +CM143127.1 StringTie transcript 343867 347659 1000 . . gene_id "SS.490"; transcript_id "SS.490.1"; cov "1298.593725"; FPKM "63.507076"; TPM "135.800149"; +CM143127.1 StringTie exon 343867 347659 1000 . . gene_id "SS.490"; transcript_id "SS.490.1"; exon_number "1"; cov "1298.593750"; +CM143127.1 StringTie transcript 348179 349116 1000 . . gene_id "SS.491"; transcript_id "SS.491.1"; cov "1548.259062"; FPKM "75.716834"; TPM "161.908846"; +CM143127.1 StringTie exon 348179 349116 1000 . . gene_id "SS.491"; transcript_id "SS.491.1"; exon_number "1"; cov "1548.259033"; +CM143127.1 StringTie transcript 349602 351289 1000 . . gene_id "SS.492"; transcript_id "SS.492.1"; cov "1194.631517"; FPKM "58.422856"; TPM "124.928324"; +CM143127.1 StringTie exon 349602 351289 1000 . . gene_id "SS.492"; transcript_id "SS.492.1"; exon_number "1"; cov "1194.631470"; +CM143127.1 StringTie transcript 351502 354317 1000 . . gene_id "SS.493"; transcript_id "SS.493.1"; cov "830.104403"; FPKM "40.595840"; TPM "86.807983"; +CM143127.1 StringTie exon 351502 354317 1000 . . gene_id "SS.493"; transcript_id "SS.493.1"; exon_number "1"; cov "830.104431"; +CM143127.1 StringTie transcript 354575 360731 1000 . . gene_id "SS.494"; transcript_id "SS.494.1"; cov "765.978155"; FPKM "37.459778"; TPM "80.101995"; +CM143127.1 StringTie exon 354575 360731 1000 . . gene_id "SS.494"; transcript_id "SS.494.1"; exon_number "1"; cov "765.978149"; +CM143127.1 StringTie transcript 356238 371582 1000 - . gene_id "SS.495"; transcript_id "SS.495.1"; cov "181.538284"; FPKM "8.878039"; TPM "18.984326"; +CM143127.1 StringTie exon 356238 363981 1000 - . gene_id "SS.495"; transcript_id "SS.495.1"; exon_number "1"; cov "253.521881"; +CM143127.1 StringTie exon 364048 371582 1000 - . gene_id "SS.495"; transcript_id "SS.495.1"; exon_number "2"; cov "107.558052"; +CM143127.1 StringTie transcript 364489 371582 1000 . . gene_id "SS.496"; transcript_id "SS.496.1"; cov "389.446152"; FPKM "19.045669"; TPM "40.726244"; +CM143127.1 StringTie exon 364489 371582 1000 . . gene_id "SS.496"; transcript_id "SS.496.1"; exon_number "1"; cov "389.446136"; +CM143127.1 StringTie transcript 379320 381661 1000 . . gene_id "SS.497"; transcript_id "SS.497.1"; cov "5052.741247"; FPKM "247.101781"; TPM "528.389288"; +CM143127.1 StringTie exon 379320 381661 1000 . . gene_id "SS.497"; transcript_id "SS.497.1"; exon_number "1"; cov "5052.741211"; +CM143127.1 StringTie transcript 392097 400767 1000 . . gene_id "SS.498"; transcript_id "SS.498.1"; cov "325.928959"; FPKM "15.939393"; TPM "34.083948"; +CM143127.1 StringTie exon 392097 400767 1000 . . gene_id "SS.498"; transcript_id "SS.498.1"; exon_number "1"; cov "325.928955"; +CM143127.1 StringTie transcript 401447 403755 1000 . . gene_id "SS.499"; transcript_id "SS.499.1"; cov "1766.716761"; FPKM "86.400399"; TPM "184.754011"; +CM143127.1 StringTie exon 401447 403755 1000 . . gene_id "SS.499"; transcript_id "SS.499.1"; exon_number "1"; cov "1766.716797"; +CM143127.1 StringTie transcript 441587 441833 1000 . . gene_id "SS.500"; transcript_id "SS.500.1"; cov "5.489879"; FPKM "0.268480"; TPM "0.574103"; +CM143127.1 StringTie exon 441587 441833 1000 . . gene_id "SS.500"; transcript_id "SS.500.1"; exon_number "1"; cov "5.489879"; +CM143127.1 StringTie transcript 442125 442395 1000 . . gene_id "SS.501"; transcript_id "SS.501.1"; cov "7.000000"; FPKM "0.342331"; TPM "0.732023"; +CM143127.1 StringTie exon 442125 442395 1000 . . gene_id "SS.501"; transcript_id "SS.501.1"; exon_number "1"; cov "7.000000"; +CM143127.1 StringTie transcript 437798 439489 1000 . . gene_id "SS.502"; transcript_id "SS.502.1"; cov "2963.969267"; FPKM "144.951433"; TPM "309.956425"; +CM143127.1 StringTie exon 437798 439489 1000 . . gene_id "SS.502"; transcript_id "SS.502.1"; exon_number "1"; cov "2963.969238"; +CM143127.1 StringTie transcript 404366 406396 1000 . . gene_id "SS.503"; transcript_id "SS.503.1"; cov "1950.057607"; FPKM "95.366591"; TPM "203.926839"; +CM143127.1 StringTie exon 404366 406396 1000 . . gene_id "SS.503"; transcript_id "SS.503.1"; exon_number "1"; cov "1950.057617"; +CM143127.1 StringTie transcript 406825 409298 1000 . . gene_id "SS.504"; transcript_id "SS.504.1"; cov "733.822150"; FPKM "35.887205"; TPM "76.739288"; +CM143127.1 StringTie exon 406825 409298 1000 . . gene_id "SS.504"; transcript_id "SS.504.1"; exon_number "1"; cov "733.822144"; +CM143127.1 StringTie transcript 409559 411640 1000 . . gene_id "SS.505"; transcript_id "SS.505.1"; cov "3914.719741"; FPKM "191.447409"; TPM "409.380943"; +CM143127.1 StringTie exon 409559 411640 1000 . . gene_id "SS.505"; transcript_id "SS.505.1"; exon_number "1"; cov "3914.719727"; +CM143127.1 StringTie transcript 409559 415626 1000 - . gene_id "SS.506"; transcript_id "SS.506.1"; cov "981.570756"; FPKM "48.003226"; TPM "102.647543"; +CM143127.1 StringTie exon 409559 410920 1000 - . gene_id "SS.506"; transcript_id "SS.506.1"; exon_number "1"; cov "1729.378296"; +CM143127.1 StringTie exon 413325 415626 1000 - . gene_id "SS.506"; transcript_id "SS.506.1"; exon_number "2"; cov "539.123352"; +CM143127.1 StringTie transcript 416575 418678 1000 . . gene_id "SS.507"; transcript_id "SS.507.1"; cov "1245.450095"; FPKM "60.908113"; TPM "130.242666"; +CM143127.1 StringTie exon 416575 418678 1000 . . gene_id "SS.507"; transcript_id "SS.507.1"; exon_number "1"; cov "1245.450073"; +CM143127.1 StringTie transcript 418938 421455 1000 . . gene_id "SS.508"; transcript_id "SS.508.1"; cov "1367.716442"; FPKM "66.887488"; TPM "143.028642"; +CM143127.1 StringTie exon 418938 421455 1000 . . gene_id "SS.508"; transcript_id "SS.508.1"; exon_number "1"; cov "1367.716431"; +CM143127.1 StringTie transcript 429179 432494 1000 . . gene_id "SS.509"; transcript_id "SS.509.1"; cov "14206.136309"; FPKM "694.743985"; TPM "1485.603535"; +CM143127.1 StringTie exon 429179 432494 1000 . . gene_id "SS.509"; transcript_id "SS.509.1"; exon_number "1"; cov "14206.136719"; +CM143127.1 StringTie transcript 433019 435988 1000 . . gene_id "SS.510"; transcript_id "SS.510.1"; cov "297.497643"; FPKM "14.548973"; TPM "31.110750"; +CM143127.1 StringTie exon 433019 435988 1000 . . gene_id "SS.510"; transcript_id "SS.510.1"; exon_number "1"; cov "297.497650"; +CM143127.1 StringTie transcript 436272 436886 1000 . . gene_id "SS.511"; transcript_id "SS.511.1"; cov "280.543089"; FPKM "13.719819"; TPM "29.337731"; +CM143127.1 StringTie exon 436272 436886 1000 . . gene_id "SS.511"; transcript_id "SS.511.1"; exon_number "1"; cov "280.543091"; +CM143127.1 StringTie transcript 445272 446522 1000 . . gene_id "SS.512"; transcript_id "SS.512.1"; cov "4046.663070"; FPKM "197.900032"; TPM "423.178888"; +CM143127.1 StringTie exon 445272 446522 1000 . . gene_id "SS.512"; transcript_id "SS.512.1"; exon_number "1"; cov "4046.663086"; +CM143127.1 StringTie transcript 445272 451203 1000 + . gene_id "SS.513"; transcript_id "SS.513.1"; cov "187.823708"; FPKM "9.185424"; TPM "19.641622"; +CM143127.1 StringTie exon 445272 445990 1000 + . gene_id "SS.513"; transcript_id "SS.513.1"; exon_number "1"; cov "447.245361"; +CM143127.1 StringTie exon 446045 446871 1000 + . gene_id "SS.513"; transcript_id "SS.513.1"; exon_number "2"; cov "189.293549"; +CM143127.1 StringTie exon 446963 451203 1000 + . gene_id "SS.513"; transcript_id "SS.513.1"; exon_number "3"; cov "143.555908"; +CM143127.1 StringTie transcript 447974 451203 1000 . . gene_id "SS.514"; transcript_id "SS.514.1"; cov "370.644079"; FPKM "18.126163"; TPM "38.760022"; +CM143127.1 StringTie exon 447974 451203 1000 . . gene_id "SS.514"; transcript_id "SS.514.1"; exon_number "1"; cov "370.644073"; +CM143127.1 StringTie transcript 455541 456227 1000 + . gene_id "SS.515"; transcript_id "SS.515.1"; cov "7326.305425"; FPKM "358.289299"; TPM "766.146755"; +CM143127.1 StringTie exon 455541 455619 1000 + . gene_id "SS.515"; transcript_id "SS.515.1"; exon_number "1"; cov "4855.689941"; +CM143127.1 StringTie exon 455782 455918 1000 + . gene_id "SS.515"; transcript_id "SS.515.1"; exon_number "2"; cov "11119.204102"; +CM143127.1 StringTie exon 456020 456227 1000 + . gene_id "SS.515"; transcript_id "SS.515.1"; exon_number "3"; cov "5766.456543"; +CM143127.1 StringTie transcript 455541 456227 1000 + . gene_id "SS.515"; transcript_id "SS.515.2"; cov "1025.423235"; FPKM "50.147810"; TPM "107.233406"; +CM143127.1 StringTie exon 455541 455918 1000 + . gene_id "SS.515"; transcript_id "SS.515.2"; exon_number "1"; cov "1130.076782"; +CM143127.1 StringTie exon 456020 456227 1000 + . gene_id "SS.515"; transcript_id "SS.515.2"; exon_number "2"; cov "835.235474"; +CM143127.1 StringTie transcript 456827 464526 1000 . . gene_id "SS.516"; transcript_id "SS.516.1"; cov "549.989221"; FPKM "26.896948"; TPM "57.515000"; +CM143127.1 StringTie exon 456827 464526 1000 . . gene_id "SS.516"; transcript_id "SS.516.1"; exon_number "1"; cov "549.989197"; +CM143127.1 StringTie transcript 465516 471960 1000 . . gene_id "SS.517"; transcript_id "SS.517.1"; cov "302.728317"; FPKM "14.804777"; TPM "31.657746"; +CM143127.1 StringTie exon 465516 471960 1000 . . gene_id "SS.517"; transcript_id "SS.517.1"; exon_number "1"; cov "302.728302"; +CM143127.1 StringTie transcript 472243 476795 1000 . . gene_id "SS.518"; transcript_id "SS.518.1"; cov "496.110696"; FPKM "24.262045"; TPM "51.880665"; +CM143127.1 StringTie exon 472243 476795 1000 . . gene_id "SS.518"; transcript_id "SS.518.1"; exon_number "1"; cov "496.110687"; +CM143127.1 StringTie transcript 477038 478483 1000 . . gene_id "SS.519"; transcript_id "SS.519.1"; cov "599.458506"; FPKM "29.316218"; TPM "62.688239"; +CM143127.1 StringTie exon 477038 478483 1000 . . gene_id "SS.519"; transcript_id "SS.519.1"; exon_number "1"; cov "599.458496"; +CM143127.1 StringTie transcript 494390 495845 1000 . . gene_id "SS.520"; transcript_id "SS.520.1"; cov "637.666209"; FPKM "31.184747"; TPM "66.683802"; +CM143127.1 StringTie exon 494390 495845 1000 . . gene_id "SS.520"; transcript_id "SS.520.1"; exon_number "1"; cov "637.666199"; +CM143127.1 StringTie transcript 479128 480124 1000 + . gene_id "SS.521"; transcript_id "SS.521.1"; cov "31265.493023"; FPKM "1529.023285"; TPM "3269.581956"; +CM143127.1 StringTie exon 479128 479179 1000 + . gene_id "SS.521"; transcript_id "SS.521.1"; exon_number "1"; cov "1523.538452"; +CM143127.1 StringTie exon 479747 480124 1000 + . gene_id "SS.521"; transcript_id "SS.521.1"; exon_number "2"; cov "35356.980469"; +CM143127.1 StringTie transcript 482625 494015 1000 . . gene_id "SS.522"; transcript_id "SS.522.1"; cov "264.714599"; FPKM "12.945735"; TPM "27.682470"; +CM143127.1 StringTie exon 482625 494015 1000 . . gene_id "SS.522"; transcript_id "SS.522.1"; exon_number "1"; cov "264.714600"; +CM143127.1 StringTie transcript 500002 501322 1000 - . gene_id "SS.523"; transcript_id "SS.523.1"; cov "114.577075"; FPKM "5.603334"; TPM "11.981872"; +CM143127.1 StringTie exon 500002 500729 1000 - . gene_id "SS.523"; transcript_id "SS.523.1"; exon_number "1"; cov "139.226868"; +CM143127.1 StringTie exon 500965 501322 1000 - . gene_id "SS.523"; transcript_id "SS.523.1"; exon_number "2"; cov "64.451248"; +CM143127.1 StringTie transcript 501586 504179 1000 - . gene_id "SS.524"; transcript_id "SS.524.1"; cov "44.497559"; FPKM "2.176131"; TPM "4.653322"; +CM143127.1 StringTie exon 501586 502844 1000 - . gene_id "SS.524"; transcript_id "SS.524.1"; exon_number "1"; cov "28.514446"; +CM143127.1 StringTie exon 502932 503365 1000 - . gene_id "SS.524"; transcript_id "SS.524.1"; exon_number "2"; cov "20.908051"; +CM143127.1 StringTie exon 503415 504179 1000 - . gene_id "SS.524"; transcript_id "SS.524.1"; exon_number "3"; cov "84.184601"; +CM143127.1 StringTie transcript 522556 523844 1000 + . gene_id "SS.525"; transcript_id "SS.525.1"; cov "1311.664185"; FPKM "64.146280"; TPM "137.166989"; +CM143127.1 StringTie exon 522556 522802 1000 + . gene_id "SS.525"; transcript_id "SS.525.1"; exon_number "1"; cov "2441.287354"; +CM143127.1 StringTie exon 522883 523844 1000 + . gene_id "SS.525"; transcript_id "SS.525.1"; exon_number "2"; cov "1021.625793"; +CM143127.1 StringTie transcript 533274 536046 1000 . . gene_id "SS.526"; transcript_id "SS.526.1"; cov "1707.508114"; FPKM "83.504830"; TPM "178.562280"; +CM143127.1 StringTie exon 533274 536046 1000 . . gene_id "SS.526"; transcript_id "SS.526.1"; exon_number "1"; cov "1707.508057"; +CM143127.1 StringTie transcript 536279 546124 1000 . . gene_id "SS.527"; transcript_id "SS.527.1"; cov "92.813224"; FPKM "4.538984"; TPM "9.705922"; +CM143127.1 StringTie exon 536279 546124 1000 . . gene_id "SS.527"; transcript_id "SS.527.1"; exon_number "1"; cov "92.813225"; +CM143127.1 StringTie transcript 546544 554047 1000 . . gene_id "SS.528"; transcript_id "SS.528.1"; cov "134.923774"; FPKM "6.598380"; TPM "14.109624"; +CM143127.1 StringTie exon 546544 554047 1000 . . gene_id "SS.528"; transcript_id "SS.528.1"; exon_number "1"; cov "134.923767"; +CM143127.1 StringTie transcript 554286 555388 1000 . . gene_id "SS.529"; transcript_id "SS.529.1"; cov "169.728921"; FPKM "8.300508"; TPM "17.749364"; +CM143127.1 StringTie exon 554286 555388 1000 . . gene_id "SS.529"; transcript_id "SS.529.1"; exon_number "1"; cov "169.728928"; +CM143127.1 StringTie transcript 556384 561033 1000 . . gene_id "SS.530"; transcript_id "SS.530.1"; cov "227.139570"; FPKM "11.108147"; TPM "23.753070"; +CM143127.1 StringTie exon 556384 561033 1000 . . gene_id "SS.530"; transcript_id "SS.530.1"; exon_number "1"; cov "227.139572"; +CM143127.1 StringTie transcript 561331 567305 1000 . . gene_id "SS.531"; transcript_id "SS.531.1"; cov "243.695063"; FPKM "11.917785"; TPM "25.484357"; +CM143127.1 StringTie exon 561331 567305 1000 . . gene_id "SS.531"; transcript_id "SS.531.1"; exon_number "1"; cov "243.695068"; +CM143127.1 StringTie transcript 567528 569745 1000 . . gene_id "SS.532"; transcript_id "SS.532.1"; cov "392.187556"; FPKM "19.179736"; TPM "41.012926"; +CM143127.1 StringTie exon 567528 569745 1000 . . gene_id "SS.532"; transcript_id "SS.532.1"; exon_number "1"; cov "392.187561"; +CM143127.1 StringTie transcript 570627 572918 1000 . . gene_id "SS.533"; transcript_id "SS.533.1"; cov "2036.188045"; FPKM "99.578757"; TPM "212.933910"; +CM143127.1 StringTie exon 570627 572918 1000 . . gene_id "SS.533"; transcript_id "SS.533.1"; exon_number "1"; cov "2036.187988"; +CM143127.1 StringTie transcript 573607 575011 1000 + . gene_id "SS.534"; transcript_id "SS.534.1"; cov "14952.927070"; FPKM "731.265413"; TPM "1563.699012"; +CM143127.1 StringTie exon 573607 573710 1000 + . gene_id "SS.534"; transcript_id "SS.534.1"; exon_number "1"; cov "1292.850952"; +CM143127.1 StringTie exon 574355 575011 1000 + . gene_id "SS.534"; transcript_id "SS.534.1"; exon_number "2"; cov "17115.251953"; +CM143127.1 StringTie transcript 575268 585779 1000 . . gene_id "SS.535"; transcript_id "SS.535.1"; cov "1012.175323"; FPKM "49.499927"; TPM "105.848009"; +CM143127.1 StringTie exon 575268 585779 1000 . . gene_id "SS.535"; transcript_id "SS.535.1"; exon_number "1"; cov "1012.175293"; +CM143127.1 StringTie transcript 586094 587542 1000 . . gene_id "SS.536"; transcript_id "SS.536.1"; cov "53.842650"; FPKM "2.633148"; TPM "5.630583"; +CM143127.1 StringTie exon 586094 587542 1000 . . gene_id "SS.536"; transcript_id "SS.536.1"; exon_number "1"; cov "53.842651"; +CM143127.1 StringTie transcript 587927 592143 1000 . . gene_id "SS.537"; transcript_id "SS.537.1"; cov "1991.426132"; FPKM "97.389698"; TPM "208.252943"; +CM143127.1 StringTie exon 587927 592143 1000 . . gene_id "SS.537"; transcript_id "SS.537.1"; exon_number "1"; cov "1991.426147"; +CM143127.1 StringTie transcript 592806 594592 1000 . . gene_id "SS.538"; transcript_id "SS.538.1"; cov "4446.343033"; FPKM "217.446180"; TPM "464.975331"; +CM143127.1 StringTie exon 592806 594592 1000 . . gene_id "SS.538"; transcript_id "SS.538.1"; exon_number "1"; cov "4446.343262"; +CM143127.1 StringTie transcript 594977 597405 1000 . . gene_id "SS.539"; transcript_id "SS.539.1"; cov "1325.610128"; FPKM "64.828300"; TPM "138.625383"; +CM143127.1 StringTie exon 594977 597405 1000 . . gene_id "SS.539"; transcript_id "SS.539.1"; exon_number "1"; cov "1325.610107"; +CM143127.1 StringTie transcript 597867 598648 1000 . . gene_id "SS.540"; transcript_id "SS.540.1"; cov "864.841432"; FPKM "42.294637"; TPM "90.440600"; +CM143127.1 StringTie exon 597867 598648 1000 . . gene_id "SS.540"; transcript_id "SS.540.1"; exon_number "1"; cov "864.841431"; +CM143127.1 StringTie transcript 602227 604232 1000 . . gene_id "SS.541"; transcript_id "SS.541.1"; cov "1260.535892"; FPKM "61.645877"; TPM "131.820260"; +CM143127.1 StringTie exon 602227 604232 1000 . . gene_id "SS.541"; transcript_id "SS.541.1"; exon_number "1"; cov "1260.535889"; +CM143127.1 StringTie transcript 606504 608364 1000 . . gene_id "SS.542"; transcript_id "SS.542.1"; cov "432.019344"; FPKM "21.127690"; TPM "45.178326"; +CM143127.1 StringTie exon 606504 608364 1000 . . gene_id "SS.542"; transcript_id "SS.542.1"; exon_number "1"; cov "432.019348"; +CM143127.1 StringTie transcript 609587 628344 1000 + . gene_id "SS.543"; transcript_id "SS.543.1"; cov "140.508308"; FPKM "6.871488"; TPM "14.693625"; +CM143127.1 StringTie exon 609587 614232 1000 + . gene_id "SS.543"; transcript_id "SS.543.1"; exon_number "1"; cov "206.386673"; +CM143127.1 StringTie exon 615598 628344 1000 + . gene_id "SS.543"; transcript_id "SS.543.1"; exon_number "2"; cov "116.497101"; +CM143127.1 StringTie transcript 630366 631524 1000 . . gene_id "SS.544"; transcript_id "SS.544.1"; cov "827.410699"; FPKM "40.464106"; TPM "86.526289"; +CM143127.1 StringTie exon 630366 631524 1000 . . gene_id "SS.544"; transcript_id "SS.544.1"; exon_number "1"; cov "827.410706"; +CM143127.1 StringTie transcript 632187 634483 1000 . . gene_id "SS.545"; transcript_id "SS.545.1"; cov "471.643448"; FPKM "23.065487"; TPM "49.322008"; +CM143127.1 StringTie exon 632187 634483 1000 . . gene_id "SS.545"; transcript_id "SS.545.1"; exon_number "1"; cov "471.643463"; +CM143127.1 StringTie transcript 632187 635861 1000 + . gene_id "SS.546"; transcript_id "SS.546.1"; cov "467.510632"; FPKM "22.863373"; TPM "48.889820"; +CM143127.1 StringTie exon 632187 635164 1000 + . gene_id "SS.546"; transcript_id "SS.546.1"; exon_number "1"; cov "330.808594"; +CM143127.1 StringTie exon 635266 635861 1000 + . gene_id "SS.546"; transcript_id "SS.546.1"; exon_number "2"; cov "1150.562134"; +CM143127.1 StringTie transcript 636894 640242 1000 . . gene_id "SS.547"; transcript_id "SS.547.1"; cov "482.279486"; FPKM "23.585637"; TPM "50.434270"; +CM143127.1 StringTie exon 636894 640242 1000 . . gene_id "SS.547"; transcript_id "SS.547.1"; exon_number "1"; cov "482.279480"; +CM143127.1 StringTie transcript 649835 664868 1000 . . gene_id "SS.548"; transcript_id "SS.548.1"; cov "1393.898098"; FPKM "68.167889"; TPM "145.766583"; +CM143127.1 StringTie exon 649835 664868 1000 . . gene_id "SS.548"; transcript_id "SS.548.1"; exon_number "1"; cov "1393.898071"; +CM143127.1 StringTie transcript 665080 666359 1000 . . gene_id "SS.549"; transcript_id "SS.549.1"; cov "1858.045312"; FPKM "90.866776"; TPM "194.304674"; +CM143127.1 StringTie exon 665080 666359 1000 . . gene_id "SS.549"; transcript_id "SS.549.1"; exon_number "1"; cov "1858.045288"; +CM143127.1 StringTie transcript 666494 673216 1000 . . gene_id "SS.550"; transcript_id "SS.550.1"; cov "88.713753"; FPKM "4.338502"; TPM "9.277221"; +CM143127.1 StringTie exon 666494 673216 1000 . . gene_id "SS.550"; transcript_id "SS.550.1"; exon_number "1"; cov "88.713753"; +CM143127.1 StringTie transcript 666494 673216 1000 + . gene_id "SS.551"; transcript_id "SS.551.1"; cov "25.694728"; FPKM "1.256588"; TPM "2.687020"; +CM143127.1 StringTie exon 666494 667542 1000 + . gene_id "SS.551"; transcript_id "SS.551.1"; exon_number "1"; cov "4.280801"; +CM143127.1 StringTie exon 667621 673216 1000 + . gene_id "SS.551"; transcript_id "SS.551.1"; exon_number "2"; cov "29.708883"; +CM143127.1 StringTie transcript 673479 679667 1000 + . gene_id "SS.552"; transcript_id "SS.552.1"; cov "299.088404"; FPKM "14.626769"; TPM "31.277103"; +CM143127.1 StringTie exon 673479 677244 1000 + . gene_id "SS.552"; transcript_id "SS.552.1"; exon_number "1"; cov "67.524696"; +CM143127.1 StringTie exon 677320 679667 1000 + . gene_id "SS.552"; transcript_id "SS.552.1"; exon_number "2"; cov "670.497681"; +CM143127.1 StringTie transcript 678278 679667 1000 . . gene_id "SS.553"; transcript_id "SS.553.1"; cov "1218.740647"; FPKM "59.601901"; TPM "127.449531"; +CM143127.1 StringTie exon 678278 679667 1000 . . gene_id "SS.553"; transcript_id "SS.553.1"; exon_number "1"; cov "1218.740601"; +CM143127.1 StringTie transcript 680331 683738 1000 . . gene_id "SS.554"; transcript_id "SS.554.1"; cov "3033.578052"; FPKM "148.355616"; TPM "317.235748"; +CM143127.1 StringTie exon 680331 683738 1000 . . gene_id "SS.554"; transcript_id "SS.554.1"; exon_number "1"; cov "3033.578125"; +CM143127.1 StringTie transcript 684546 686525 1000 . . gene_id "SS.555"; transcript_id "SS.555.1"; cov "1194.316162"; FPKM "58.407434"; TPM "124.895346"; +CM143127.1 StringTie exon 684546 686525 1000 . . gene_id "SS.555"; transcript_id "SS.555.1"; exon_number "1"; cov "1194.316162"; +CM143127.1 StringTie transcript 687357 690239 1000 . . gene_id "SS.556"; transcript_id "SS.556.1"; cov "1381.497745"; FPKM "67.561456"; TPM "144.469818"; +CM143127.1 StringTie exon 687357 690239 1000 . . gene_id "SS.556"; transcript_id "SS.556.1"; exon_number "1"; cov "1381.497803"; +CM143127.1 StringTie transcript 693145 694097 1000 . . gene_id "SS.557"; transcript_id "SS.557.1"; cov "2326.121721"; FPKM "113.757818"; TPM "243.253660"; +CM143127.1 StringTie exon 693145 694097 1000 . . gene_id "SS.557"; transcript_id "SS.557.1"; exon_number "1"; cov "2326.121826"; +CM143127.1 StringTie transcript 694453 700704 1000 + . gene_id "SS.558"; transcript_id "SS.558.1"; cov "364.812936"; FPKM "17.840994"; TPM "38.150231"; +CM143127.1 StringTie exon 694453 696933 1000 + . gene_id "SS.558"; transcript_id "SS.558.1"; exon_number "1"; cov "226.395004"; +CM143127.1 StringTie exon 697017 700704 1000 + . gene_id "SS.558"; transcript_id "SS.558.1"; exon_number "2"; cov "457.929779"; +CM143127.1 StringTie transcript 701009 704182 1000 . . gene_id "SS.559"; transcript_id "SS.559.1"; cov "263.397606"; FPKM "12.881328"; TPM "27.544746"; +CM143127.1 StringTie exon 701009 704182 1000 . . gene_id "SS.559"; transcript_id "SS.559.1"; exon_number "1"; cov "263.397614"; +CM143127.1 StringTie transcript 704550 709599 1000 . . gene_id "SS.560"; transcript_id "SS.560.1"; cov "671.806733"; FPKM "32.854372"; TPM "70.254039"; +CM143127.1 StringTie exon 704550 709599 1000 . . gene_id "SS.560"; transcript_id "SS.560.1"; exon_number "1"; cov "671.806763"; +CM143127.1 StringTie transcript 709940 710922 1000 . . gene_id "SS.561"; transcript_id "SS.561.1"; cov "1415.973550"; FPKM "69.247478"; TPM "148.075118"; +CM143127.1 StringTie exon 709940 710922 1000 . . gene_id "SS.561"; transcript_id "SS.561.1"; exon_number "1"; cov "1415.973511"; +CM143127.1 StringTie transcript 711221 712744 1000 . . gene_id "SS.562"; transcript_id "SS.562.1"; cov "700.736220"; FPKM "34.269154"; TPM "73.279334"; +CM143127.1 StringTie exon 711221 712744 1000 . . gene_id "SS.562"; transcript_id "SS.562.1"; exon_number "1"; cov "700.736206"; +CM143127.1 StringTie transcript 713067 714949 1000 . . gene_id "SS.563"; transcript_id "SS.563.1"; cov "291.134891"; FPKM "14.237806"; TPM "30.445366"; +CM143127.1 StringTie exon 713067 714949 1000 . . gene_id "SS.563"; transcript_id "SS.563.1"; exon_number "1"; cov "291.134888"; +CM143127.1 StringTie transcript 715806 716379 1000 . . gene_id "SS.564"; transcript_id "SS.564.1"; cov "14453.686411"; FPKM "706.850298"; TPM "1511.491031"; +CM143127.1 StringTie exon 715806 716379 1000 . . gene_id "SS.564"; transcript_id "SS.564.1"; exon_number "1"; cov "14453.686523"; +CM143127.1 StringTie transcript 716728 717522 1000 . . gene_id "SS.565"; transcript_id "SS.565.1"; cov "2947.947170"; FPKM "144.167881"; TPM "308.280917"; +CM143127.1 StringTie exon 716728 717522 1000 . . gene_id "SS.565"; transcript_id "SS.565.1"; exon_number "1"; cov "2947.947266"; +CM143127.1 StringTie transcript 719574 721388 1000 . . gene_id "SS.566"; transcript_id "SS.566.1"; cov "1225.470523"; FPKM "59.931022"; TPM "128.153306"; +CM143127.1 StringTie exon 719574 721388 1000 . . gene_id "SS.566"; transcript_id "SS.566.1"; exon_number "1"; cov "1225.470581"; +CM143127.1 StringTie transcript 721898 726184 1000 . . gene_id "SS.567"; transcript_id "SS.567.1"; cov "530.762538"; FPKM "25.956676"; TPM "55.504374"; +CM143127.1 StringTie exon 721898 726184 1000 . . gene_id "SS.567"; transcript_id "SS.567.1"; exon_number "1"; cov "530.762512"; +CM143127.1 StringTie transcript 726394 727603 1000 . . gene_id "SS.568"; transcript_id "SS.568.1"; cov "264.441322"; FPKM "12.932370"; TPM "27.653892"; +CM143127.1 StringTie exon 726394 727603 1000 . . gene_id "SS.568"; transcript_id "SS.568.1"; exon_number "1"; cov "264.441315"; +CM143127.1 StringTie transcript 727954 731327 1000 . . gene_id "SS.569"; transcript_id "SS.569.1"; cov "240.954653"; FPKM "11.783767"; TPM "25.197779"; +CM143127.1 StringTie exon 727954 731327 1000 . . gene_id "SS.569"; transcript_id "SS.569.1"; exon_number "1"; cov "240.954651"; +CM143127.1 StringTie transcript 731633 732753 1000 . . gene_id "SS.570"; transcript_id "SS.570.1"; cov "598.611062"; FPKM "29.274774"; TPM "62.599618"; +CM143127.1 StringTie exon 731633 732753 1000 . . gene_id "SS.570"; transcript_id "SS.570.1"; exon_number "1"; cov "598.611084"; +CM143127.1 StringTie transcript 733001 735172 1000 . . gene_id "SS.571"; transcript_id "SS.571.1"; cov "426.004144"; FPKM "20.833519"; TPM "44.549288"; +CM143127.1 StringTie exon 733001 735172 1000 . . gene_id "SS.571"; transcript_id "SS.571.1"; exon_number "1"; cov "426.004150"; +CM143127.1 StringTie transcript 735516 737606 1000 . . gene_id "SS.572"; transcript_id "SS.572.1"; cov "1194.373984"; FPKM "58.410262"; TPM "124.901393"; +CM143127.1 StringTie exon 735516 737606 1000 . . gene_id "SS.572"; transcript_id "SS.572.1"; exon_number "1"; cov "1194.374023"; +CM143127.1 StringTie transcript 738069 741456 1000 . . gene_id "SS.573"; transcript_id "SS.573.1"; cov "1049.389315"; FPKM "51.319859"; TPM "109.739653"; +CM143127.1 StringTie exon 738069 741456 1000 . . gene_id "SS.573"; transcript_id "SS.573.1"; exon_number "1"; cov "1049.389282"; +CM143127.1 StringTie transcript 742355 744393 1000 . . gene_id "SS.574"; transcript_id "SS.574.1"; cov "934.117705"; FPKM "45.682559"; TPM "97.685151"; +CM143127.1 StringTie exon 742355 744393 1000 . . gene_id "SS.574"; transcript_id "SS.574.1"; exon_number "1"; cov "934.117676"; +CM143127.1 StringTie transcript 744779 749068 1000 . . gene_id "SS.575"; transcript_id "SS.575.1"; cov "109.082751"; FPKM "5.334637"; TPM "11.407304"; +CM143127.1 StringTie exon 744779 749068 1000 . . gene_id "SS.575"; transcript_id "SS.575.1"; exon_number "1"; cov "109.082748"; +CM143127.1 StringTie transcript 750165 750485 1000 . . gene_id "SS.576"; transcript_id "SS.576.1"; cov "24.797508"; FPKM "1.212710"; TPM "2.593194"; +CM143127.1 StringTie exon 750165 750485 1000 . . gene_id "SS.576"; transcript_id "SS.576.1"; exon_number "1"; cov "24.797508"; +CM143127.1 StringTie transcript 756291 757507 1000 . . gene_id "SS.577"; transcript_id "SS.577.1"; cov "5223.614626"; FPKM "255.458258"; TPM "546.258334"; +CM143127.1 StringTie exon 756291 757507 1000 . . gene_id "SS.577"; transcript_id "SS.577.1"; exon_number "1"; cov "5223.614746"; +CM143127.1 StringTie transcript 763218 764626 1000 . . gene_id "SS.578"; transcript_id "SS.578.1"; cov "4148.503903"; FPKM "202.880507"; TPM "433.828870"; +CM143127.1 StringTie exon 763218 764626 1000 . . gene_id "SS.578"; transcript_id "SS.578.1"; exon_number "1"; cov "4148.503906"; +CM143127.1 StringTie transcript 767287 771143 1000 . . gene_id "SS.579"; transcript_id "SS.579.1"; cov "455.657765"; FPKM "22.283715"; TPM "47.650309"; +CM143127.1 StringTie exon 767287 771143 1000 . . gene_id "SS.579"; transcript_id "SS.579.1"; exon_number "1"; cov "455.657776"; +CM143127.1 StringTie transcript 776932 787524 1000 . . gene_id "SS.580"; transcript_id "SS.580.1"; cov "454.443500"; FPKM "22.224332"; TPM "47.523328"; +CM143127.1 StringTie exon 776932 787524 1000 . . gene_id "SS.580"; transcript_id "SS.580.1"; exon_number "1"; cov "454.443512"; +CM143127.1 StringTie transcript 787943 790923 1000 - . gene_id "SS.581"; transcript_id "SS.581.1"; cov "84.837671"; FPKM "4.148944"; TPM "8.871881"; +CM143127.1 StringTie exon 787943 790727 1000 - . gene_id "SS.581"; transcript_id "SS.581.1"; exon_number "1"; cov "87.569839"; +CM143127.1 StringTie exon 790789 790923 1000 - . gene_id "SS.581"; transcript_id "SS.581.1"; exon_number "2"; cov "28.474073"; +CM143127.1 StringTie transcript 791263 794791 1000 . . gene_id "SS.582"; transcript_id "SS.582.1"; cov "567.154151"; FPKM "27.736390"; TPM "59.310019"; +CM143127.1 StringTie exon 791263 794791 1000 . . gene_id "SS.582"; transcript_id "SS.582.1"; exon_number "1"; cov "567.154175"; +CM143127.1 StringTie transcript 795265 796303 1000 . . gene_id "SS.583"; transcript_id "SS.583.1"; cov "169.632339"; FPKM "8.295785"; TPM "17.739264"; +CM143127.1 StringTie exon 795265 796303 1000 . . gene_id "SS.583"; transcript_id "SS.583.1"; exon_number "1"; cov "169.632339"; +CM143127.1 StringTie transcript 816763 819071 1000 . . gene_id "SS.584"; transcript_id "SS.584.1"; cov "994.549155"; FPKM "48.637929"; TPM "104.004756"; +CM143127.1 StringTie exon 816763 819071 1000 . . gene_id "SS.584"; transcript_id "SS.584.1"; exon_number "1"; cov "994.549133"; +CM143127.1 StringTie transcript 827928 828392 1000 . . gene_id "SS.585"; transcript_id "SS.585.1"; cov "8.219149"; FPKM "0.401953"; TPM "0.859516"; +CM143127.1 StringTie exon 827928 828392 1000 . . gene_id "SS.585"; transcript_id "SS.585.1"; exon_number "1"; cov "8.219149"; +CM143127.1 StringTie transcript 820392 823708 1000 . . gene_id "SS.586"; transcript_id "SS.586.1"; cov "367.507085"; FPKM "17.972750"; TPM "38.431971"; +CM143127.1 StringTie exon 820392 823708 1000 . . gene_id "SS.586"; transcript_id "SS.586.1"; exon_number "1"; cov "367.507080"; +CM143127.1 StringTie transcript 824172 824557 1000 . . gene_id "SS.587"; transcript_id "SS.587.1"; cov "240.889896"; FPKM "11.780600"; TPM "25.191007"; +CM143127.1 StringTie exon 824172 824557 1000 . . gene_id "SS.587"; transcript_id "SS.587.1"; exon_number "1"; cov "240.889893"; +CM143127.1 StringTie transcript 852492 855214 1000 . . gene_id "SS.588"; transcript_id "SS.588.1"; cov "4164.779655"; FPKM "203.676464"; TPM "435.530903"; +CM143127.1 StringTie exon 852492 855214 1000 . . gene_id "SS.588"; transcript_id "SS.588.1"; exon_number "1"; cov "4164.779785"; +CM143127.1 StringTie transcript 856755 871629 1000 . . gene_id "SS.589"; transcript_id "SS.589.1"; cov "238.887395"; FPKM "11.682668"; TPM "24.981596"; +CM143127.1 StringTie exon 856755 871629 1000 . . gene_id "SS.589"; transcript_id "SS.589.1"; exon_number "1"; cov "238.887390"; +CM143127.1 StringTie transcript 877441 879700 1000 . . gene_id "SS.590"; transcript_id "SS.590.1"; cov "2113.921903"; FPKM "103.380292"; TPM "221.062911"; +CM143127.1 StringTie exon 877441 879700 1000 . . gene_id "SS.590"; transcript_id "SS.590.1"; exon_number "1"; cov "2113.921875"; +CM143127.1 StringTie transcript 881066 884353 1000 . . gene_id "SS.591"; transcript_id "SS.591.1"; cov "659.528285"; FPKM "32.253901"; TPM "68.970023"; +CM143127.1 StringTie exon 881066 884353 1000 . . gene_id "SS.591"; transcript_id "SS.591.1"; exon_number "1"; cov "659.528259"; +CM143127.1 StringTie transcript 884688 885860 1000 . . gene_id "SS.592"; transcript_id "SS.592.1"; cov "646.880648"; FPKM "31.635374"; TPM "67.647399"; +CM143127.1 StringTie exon 884688 885860 1000 . . gene_id "SS.592"; transcript_id "SS.592.1"; exon_number "1"; cov "646.880676"; +CM143127.1 StringTie transcript 886749 893232 1000 . . gene_id "SS.593"; transcript_id "SS.593.1"; cov "73.089759"; FPKM "3.574418"; TPM "7.643345"; +CM143127.1 StringTie exon 886749 893232 1000 . . gene_id "SS.593"; transcript_id "SS.593.1"; exon_number "1"; cov "73.089760"; +CM143127.1 StringTie transcript 893539 897852 1000 . . gene_id "SS.594"; transcript_id "SS.594.1"; cov "171.622624"; FPKM "8.393119"; TPM "17.947398"; +CM143127.1 StringTie exon 893539 897852 1000 . . gene_id "SS.594"; transcript_id "SS.594.1"; exon_number "1"; cov "171.622620"; +CM143127.1 StringTie transcript 898181 904543 1000 . . gene_id "SS.595"; transcript_id "SS.595.1"; cov "286.887003"; FPKM "14.030065"; TPM "30.001144"; +CM143127.1 StringTie exon 898181 904543 1000 . . gene_id "SS.595"; transcript_id "SS.595.1"; exon_number "1"; cov "286.886993"; +CM143127.1 StringTie transcript 904836 919308 1000 . . gene_id "SS.596"; transcript_id "SS.596.1"; cov "232.723036"; FPKM "11.381204"; TPM "24.336960"; +CM143127.1 StringTie exon 904836 919308 1000 . . gene_id "SS.596"; transcript_id "SS.596.1"; exon_number "1"; cov "232.723038"; +CM143127.1 StringTie transcript 919650 926048 1000 . . gene_id "SS.597"; transcript_id "SS.597.1"; cov "426.710267"; FPKM "20.868052"; TPM "44.623131"; +CM143127.1 StringTie exon 919650 926048 1000 . . gene_id "SS.597"; transcript_id "SS.597.1"; exon_number "1"; cov "426.710266"; +CM143127.1 StringTie transcript 926250 929035 1000 . . gene_id "SS.598"; transcript_id "SS.598.1"; cov "946.563532"; FPKM "46.291216"; TPM "98.986670"; +CM143127.1 StringTie exon 926250 929035 1000 . . gene_id "SS.598"; transcript_id "SS.598.1"; exon_number "1"; cov "946.563538"; +CM143127.1 StringTie transcript 933555 936945 1000 - . gene_id "SS.599"; transcript_id "SS.599.1"; cov "3268.513350"; FPKM "159.845009"; TPM "341.804054"; +CM143127.1 StringTie exon 933555 936202 1000 - . gene_id "SS.599"; transcript_id "SS.599.1"; exon_number "1"; cov "3135.593018"; +CM143127.1 StringTie exon 936785 936945 1000 - . gene_id "SS.599"; transcript_id "SS.599.1"; exon_number "2"; cov "5454.683105"; +CM143127.1 StringTie transcript 937640 939503 1000 . . gene_id "SS.600"; transcript_id "SS.600.1"; cov "280.949571"; FPKM "13.739698"; TPM "29.380239"; +CM143127.1 StringTie exon 937640 939503 1000 . . gene_id "SS.600"; transcript_id "SS.600.1"; exon_number "1"; cov "280.949585"; +CM143127.1 StringTie transcript 939862 942486 1000 . . gene_id "SS.601"; transcript_id "SS.601.1"; cov "543.189714"; FPKM "26.564421"; TPM "56.803943"; +CM143127.1 StringTie exon 939862 942486 1000 . . gene_id "SS.601"; transcript_id "SS.601.1"; exon_number "1"; cov "543.189697"; +CM143127.1 StringTie transcript 943082 944333 1000 . . gene_id "SS.602"; transcript_id "SS.602.1"; cov "1865.242013"; FPKM "91.218727"; TPM "195.057267"; +CM143127.1 StringTie exon 943082 944333 1000 . . gene_id "SS.602"; transcript_id "SS.602.1"; exon_number "1"; cov "1865.242065"; +CM143127.1 StringTie transcript 945698 951074 1000 - . gene_id "SS.603"; transcript_id "SS.603.1"; cov "447.015906"; FPKM "21.861089"; TPM "46.746589"; +CM143127.1 StringTie exon 945698 949672 1000 - . gene_id "SS.603"; transcript_id "SS.603.1"; exon_number "1"; cov "533.778015"; +CM143127.1 StringTie exon 949769 951074 1000 - . gene_id "SS.603"; transcript_id "SS.603.1"; exon_number "2"; cov "182.942963"; +CM143127.1 StringTie transcript 951514 955030 1000 - . gene_id "SS.604"; transcript_id "SS.604.1"; cov "724.035777"; FPKM "35.408607"; TPM "75.715880"; +CM143127.1 StringTie exon 951514 952202 1000 - . gene_id "SS.604"; transcript_id "SS.604.1"; exon_number "1"; cov "1398.203247"; +CM143127.1 StringTie exon 952310 955030 1000 - . gene_id "SS.604"; transcript_id "SS.604.1"; exon_number "2"; cov "553.325989"; +CM143127.1 StringTie transcript 955497 961968 1000 . . gene_id "SS.605"; transcript_id "SS.605.1"; cov "697.291873"; FPKM "34.100710"; TPM "72.919142"; +CM143127.1 StringTie exon 955497 961968 1000 . . gene_id "SS.605"; transcript_id "SS.605.1"; exon_number "1"; cov "697.291870"; +CM143127.1 StringTie transcript 968996 970459 1000 . . gene_id "SS.606"; transcript_id "SS.606.1"; cov "1594.662568"; FPKM "77.986175"; TPM "166.761482"; +CM143127.1 StringTie exon 968996 970459 1000 . . gene_id "SS.606"; transcript_id "SS.606.1"; exon_number "1"; cov "1594.662598"; +CM143127.1 StringTie transcript 971442 976475 1000 . . gene_id "SS.607"; transcript_id "SS.607.1"; cov "275.026420"; FPKM "13.450029"; TPM "28.760827"; +CM143127.1 StringTie exon 971442 976475 1000 . . gene_id "SS.607"; transcript_id "SS.607.1"; exon_number "1"; cov "275.026428"; +CM143127.1 StringTie transcript 976764 977237 1000 . . gene_id "SS.608"; transcript_id "SS.608.1"; cov "258.464135"; FPKM "12.640059"; TPM "27.028829"; +CM143127.1 StringTie exon 976764 977237 1000 . . gene_id "SS.608"; transcript_id "SS.608.1"; exon_number "1"; cov "258.464142"; +CM143127.1 StringTie transcript 981927 988195 1000 . . gene_id "SS.609"; transcript_id "SS.609.1"; cov "586.804115"; FPKM "28.697361"; TPM "61.364909"; +CM143127.1 StringTie exon 981927 988195 1000 . . gene_id "SS.609"; transcript_id "SS.609.1"; exon_number "1"; cov "586.804138"; +CM143127.1 StringTie transcript 988894 1007675 1000 . . gene_id "SS.610"; transcript_id "SS.610.1"; cov "444.954025"; FPKM "21.760254"; TPM "46.530968"; +CM143127.1 StringTie exon 988894 1007675 1000 . . gene_id "SS.610"; transcript_id "SS.610.1"; exon_number "1"; cov "444.954010"; +CM143127.1 StringTie transcript 988894 991453 1000 + . gene_id "SS.611"; transcript_id "SS.611.1"; cov "37.723959"; FPKM "1.844871"; TPM "3.944975"; +CM143127.1 StringTie exon 988894 989069 1000 + . gene_id "SS.611"; transcript_id "SS.611.1"; exon_number "1"; cov "9.235509"; +CM143127.1 StringTie exon 989372 991453 1000 + . gene_id "SS.611"; transcript_id "SS.611.1"; exon_number "2"; cov "40.132206"; +CM143127.1 StringTie transcript 1014657 1018286 1000 . . gene_id "SS.612"; transcript_id "SS.612.1"; cov "749.360124"; FPKM "36.647082"; TPM "78.364168"; +CM143127.1 StringTie exon 1014657 1018286 1000 . . gene_id "SS.612"; transcript_id "SS.612.1"; exon_number "1"; cov "749.360107"; +CM143127.1 StringTie transcript 1014657 1018107 1000 - . gene_id "SS.613"; transcript_id "SS.613.1"; cov "85.327562"; FPKM "4.172902"; TPM "8.923111"; +CM143127.1 StringTie exon 1014657 1017671 1000 - . gene_id "SS.613"; transcript_id "SS.613.1"; exon_number "1"; cov "76.367348"; +CM143127.1 StringTie exon 1017735 1018107 1000 - . gene_id "SS.613"; transcript_id "SS.613.1"; exon_number "2"; cov "157.753983"; +CM143127.1 StringTie transcript 1018315 1022707 1000 + . gene_id "SS.614"; transcript_id "SS.614.1"; cov "434.559041"; FPKM "21.251892"; TPM "45.443915"; +CM143127.1 StringTie exon 1018315 1018687 1000 + . gene_id "SS.614"; transcript_id "SS.614.1"; exon_number "1"; cov "55.273029"; +CM143127.1 StringTie exon 1018758 1018819 1000 + . gene_id "SS.614"; transcript_id "SS.614.1"; exon_number "2"; cov "227.732620"; +CM143127.1 StringTie exon 1018991 1022707 1000 + . gene_id "SS.614"; transcript_id "SS.614.1"; exon_number "3"; cov "476.070190"; +CM143127.1 StringTie transcript 1018318 1022707 1000 + . gene_id "SS.614"; transcript_id "SS.614.2"; cov "91.140293"; FPKM "4.457170"; TPM "9.530976"; +CM143127.1 StringTie exon 1018318 1018819 1000 + . gene_id "SS.614"; transcript_id "SS.614.2"; exon_number "1"; cov "22.107048"; +CM143127.1 StringTie exon 1018991 1022707 1000 + . gene_id "SS.614"; transcript_id "SS.614.2"; exon_number "2"; cov "100.463585"; +CM143127.1 StringTie transcript 1030712 1031744 1000 + . gene_id "SS.615"; transcript_id "SS.615.1"; cov "38.763975"; FPKM "1.895733"; TPM "4.053734"; +CM143127.1 StringTie exon 1030712 1031288 1000 + . gene_id "SS.615"; transcript_id "SS.615.1"; exon_number "1"; cov "18.358751"; +CM143127.1 StringTie exon 1031356 1031744 1000 + . gene_id "SS.615"; transcript_id "SS.615.1"; exon_number "2"; cov "69.030846"; +CM143127.1 StringTie transcript 1032114 1037217 1000 . . gene_id "SS.616"; transcript_id "SS.616.1"; cov "320.071317"; FPKM "15.652928"; TPM "33.471387"; +CM143127.1 StringTie exon 1032114 1037217 1000 . . gene_id "SS.616"; transcript_id "SS.616.1"; exon_number "1"; cov "320.071320"; +CM143127.1 StringTie transcript 1037446 1047259 1000 + . gene_id "SS.617"; transcript_id "SS.617.1"; cov "888.980039"; FPKM "43.475124"; TPM "92.964889"; +CM143127.1 StringTie exon 1037446 1042143 1000 + . gene_id "SS.617"; transcript_id "SS.617.1"; exon_number "1"; cov "810.180176"; +CM143127.1 StringTie exon 1042214 1047259 1000 + . gene_id "SS.617"; transcript_id "SS.617.1"; exon_number "2"; cov "962.345398"; +CM143127.1 StringTie transcript 1047682 1049698 1000 . . gene_id "SS.618"; transcript_id "SS.618.1"; cov "833.332672"; FPKM "40.753717"; TPM "87.145578"; +CM143127.1 StringTie exon 1047682 1049698 1000 . . gene_id "SS.618"; transcript_id "SS.618.1"; exon_number "1"; cov "833.332703"; +CM143127.1 StringTie transcript 1049957 1050653 1000 . . gene_id "SS.619"; transcript_id "SS.619.1"; cov "277.667145"; FPKM "13.579173"; TPM "29.036980"; +CM143127.1 StringTie exon 1049957 1050653 1000 . . gene_id "SS.619"; transcript_id "SS.619.1"; exon_number "1"; cov "277.667145"; +CM143127.1 StringTie transcript 1050874 1052029 1000 . . gene_id "SS.620"; transcript_id "SS.620.1"; cov "1819.536332"; FPKM "88.983513"; TPM "190.277606"; +CM143127.1 StringTie exon 1050874 1052029 1000 . . gene_id "SS.620"; transcript_id "SS.620.1"; exon_number "1"; cov "1819.536377"; +CM143127.1 StringTie transcript 1059721 1061063 1000 . . gene_id "SS.621"; transcript_id "SS.621.1"; cov "1335.338049"; FPKM "65.304039"; TPM "139.642679"; +CM143127.1 StringTie exon 1059721 1061063 1000 . . gene_id "SS.621"; transcript_id "SS.621.1"; exon_number "1"; cov "1335.338013"; +CM143127.1 StringTie transcript 1061811 1063313 1000 . . gene_id "SS.622"; transcript_id "SS.622.1"; cov "19424.005323"; FPKM "949.921257"; TPM "2031.261022"; +CM143127.1 StringTie exon 1061811 1063313 1000 . . gene_id "SS.622"; transcript_id "SS.622.1"; exon_number "1"; cov "19424.005859"; +CM143127.1 StringTie transcript 1069461 1073872 1000 . . gene_id "SS.623"; transcript_id "SS.623.1"; cov "782.353808"; FPKM "38.260621"; TPM "81.814475"; +CM143127.1 StringTie exon 1069461 1073872 1000 . . gene_id "SS.623"; transcript_id "SS.623.1"; exon_number "1"; cov "782.353821"; +CM143127.1 StringTie transcript 1074163 1076108 1000 . . gene_id "SS.624"; transcript_id "SS.624.1"; cov "1864.023124"; FPKM "91.159118"; TPM "194.929802"; +CM143127.1 StringTie exon 1074163 1076108 1000 . . gene_id "SS.624"; transcript_id "SS.624.1"; exon_number "1"; cov "1864.023071"; +CM143127.1 StringTie transcript 1076809 1078953 1000 . . gene_id "SS.625"; transcript_id "SS.625.1"; cov "321.774825"; FPKM "15.736237"; TPM "33.649531"; +CM143127.1 StringTie exon 1076809 1078953 1000 . . gene_id "SS.625"; transcript_id "SS.625.1"; exon_number "1"; cov "321.774811"; +CM143127.1 StringTie transcript 1080579 1080889 1000 . . gene_id "SS.626"; transcript_id "SS.626.1"; cov "44.099678"; FPKM "2.156673"; TPM "4.611714"; +CM143127.1 StringTie exon 1080579 1080889 1000 . . gene_id "SS.626"; transcript_id "SS.626.1"; exon_number "1"; cov "44.099678"; +CM143127.1 StringTie transcript 1081404 1084004 1000 . . gene_id "SS.627"; transcript_id "SS.627.1"; cov "2967.215302"; FPKM "145.110179"; TPM "310.295878"; +CM143127.1 StringTie exon 1081404 1084004 1000 . . gene_id "SS.627"; transcript_id "SS.627.1"; exon_number "1"; cov "2967.215332"; +CM143127.1 StringTie transcript 1084405 1086055 1000 . . gene_id "SS.628"; transcript_id "SS.628.1"; cov "455.049061"; FPKM "22.253947"; TPM "47.586654"; +CM143127.1 StringTie exon 1084405 1086055 1000 . . gene_id "SS.628"; transcript_id "SS.628.1"; exon_number "1"; cov "455.049072"; +CM143127.1 StringTie transcript 1089572 1090587 1000 . . gene_id "SS.629"; transcript_id "SS.629.1"; cov "3088.121063"; FPKM "151.023015"; TPM "322.939571"; +CM143127.1 StringTie exon 1089572 1090587 1000 . . gene_id "SS.629"; transcript_id "SS.629.1"; exon_number "1"; cov "3088.121094"; +CM143127.1 StringTie transcript 1091112 1091856 1000 . . gene_id "SS.630"; transcript_id "SS.630.1"; cov "18963.100671"; FPKM "927.380945"; TPM "1983.062021"; +CM143127.1 StringTie exon 1091112 1091856 1000 . . gene_id "SS.630"; transcript_id "SS.630.1"; exon_number "1"; cov "18963.101562"; +CM143127.1 StringTie transcript 1092181 1094201 1000 - . gene_id "SS.631"; transcript_id "SS.631.1"; cov "686.527721"; FPKM "33.574295"; TPM "71.793483"; +CM143127.1 StringTie exon 1092181 1093998 1000 - . gene_id "SS.631"; transcript_id "SS.631.1"; exon_number "1"; cov "722.698547"; +CM143127.1 StringTie exon 1094072 1094201 1000 - . gene_id "SS.631"; transcript_id "SS.631.1"; exon_number "2"; cov "180.692307"; +CM143127.1 StringTie transcript 1094530 1095308 1000 . . gene_id "SS.632"; transcript_id "SS.632.1"; cov "750.535302"; FPKM "36.704553"; TPM "78.487062"; +CM143127.1 StringTie exon 1094530 1095308 1000 . . gene_id "SS.632"; transcript_id "SS.632.1"; exon_number "1"; cov "750.535278"; +CM143127.1 StringTie transcript 1097180 1099685 1000 . . gene_id "SS.633"; transcript_id "SS.633.1"; cov "457.826018"; FPKM "22.389752"; TPM "47.877054"; +CM143127.1 StringTie exon 1097180 1099685 1000 . . gene_id "SS.633"; transcript_id "SS.633.1"; exon_number "1"; cov "457.826019"; +CM143127.1 StringTie transcript 1100025 1115622 1000 . . gene_id "SS.634"; transcript_id "SS.634.1"; cov "154.167137"; FPKM "7.539467"; TPM "16.121994"; +CM143127.1 StringTie exon 1100025 1115622 1000 . . gene_id "SS.634"; transcript_id "SS.634.1"; exon_number "1"; cov "154.167130"; +CM143127.1 StringTie transcript 1115893 1116667 1000 . . gene_id "SS.635"; transcript_id "SS.635.1"; cov "1674.203871"; FPKM "81.876102"; TPM "175.079496"; +CM143127.1 StringTie exon 1115893 1116667 1000 . . gene_id "SS.635"; transcript_id "SS.635.1"; exon_number "1"; cov "1674.203857"; +CM143127.1 StringTie transcript 1117111 1118988 1000 . . gene_id "SS.636"; transcript_id "SS.636.1"; cov "218.396699"; FPKM "10.680581"; TPM "22.838786"; +CM143127.1 StringTie exon 1117111 1118988 1000 . . gene_id "SS.636"; transcript_id "SS.636.1"; exon_number "1"; cov "218.396698"; +CM143127.1 StringTie transcript 1119345 1126973 1000 . . gene_id "SS.637"; transcript_id "SS.637.1"; cov "106.281574"; FPKM "5.197647"; TPM "11.114372"; +CM143127.1 StringTie exon 1119345 1126973 1000 . . gene_id "SS.637"; transcript_id "SS.637.1"; exon_number "1"; cov "106.281570"; +CM143127.1 StringTie transcript 1127638 1127876 1000 . . gene_id "SS.638"; transcript_id "SS.638.1"; cov "8.511768"; FPKM "0.416264"; TPM "0.890116"; +CM143127.1 StringTie exon 1127638 1127876 1000 . . gene_id "SS.638"; transcript_id "SS.638.1"; exon_number "1"; cov "8.511767"; +CM143127.1 StringTie transcript 1129072 1131008 1000 . . gene_id "SS.639"; transcript_id "SS.639.1"; cov "324.218895"; FPKM "15.855763"; TPM "33.905119"; +CM143127.1 StringTie exon 1129072 1131008 1000 . . gene_id "SS.639"; transcript_id "SS.639.1"; exon_number "1"; cov "324.218903"; +CM143127.1 StringTie transcript 1131840 1134592 1000 . . gene_id "SS.640"; transcript_id "SS.640.1"; cov "176.929168"; FPKM "8.652632"; TPM "18.502328"; +CM143127.1 StringTie exon 1131840 1134592 1000 . . gene_id "SS.640"; transcript_id "SS.640.1"; exon_number "1"; cov "176.929169"; +CM143127.1 StringTie transcript 1136094 1136793 1000 + . gene_id "SS.641"; transcript_id "SS.641.1"; cov "6892.032668"; FPKM "337.051407"; TPM "720.732778"; +CM143127.1 StringTie exon 1136094 1136223 1000 + . gene_id "SS.641"; transcript_id "SS.641.1"; exon_number "1"; cov "1000.992310"; +CM143127.1 StringTie exon 1136373 1136793 1000 + . gene_id "SS.641"; transcript_id "SS.641.1"; exon_number "2"; cov "8711.119141"; +CM143127.1 StringTie transcript 1143816 1144894 1000 . . gene_id "SS.642"; transcript_id "SS.642.1"; cov "1063.835959"; FPKM "52.026365"; TPM "111.250408"; +CM143127.1 StringTie exon 1143816 1144894 1000 . . gene_id "SS.642"; transcript_id "SS.642.1"; exon_number "1"; cov "1063.835938"; +CM143127.1 StringTie transcript 1145728 1147365 1000 . . gene_id "SS.643"; transcript_id "SS.643.1"; cov "16250.059829"; FPKM "794.701041"; TPM "1699.346381"; +CM143127.1 StringTie exon 1145728 1147365 1000 . . gene_id "SS.643"; transcript_id "SS.643.1"; exon_number "1"; cov "16250.059570"; +CM143127.1 StringTie transcript 1147668 1149190 1000 . . gene_id "SS.644"; transcript_id "SS.644.1"; cov "1502.938936"; FPKM "73.500476"; TPM "157.169504"; +CM143127.1 StringTie exon 1147668 1149190 1000 . . gene_id "SS.644"; transcript_id "SS.644.1"; exon_number "1"; cov "1502.938965"; +CM143127.1 StringTie transcript 1149556 1154058 1000 . . gene_id "SS.645"; transcript_id "SS.645.1"; cov "1733.642016"; FPKM "84.782895"; TPM "181.295227"; +CM143127.1 StringTie exon 1149556 1154058 1000 . . gene_id "SS.645"; transcript_id "SS.645.1"; exon_number "1"; cov "1733.641968"; +CM143127.1 StringTie transcript 1154341 1157180 1000 . . gene_id "SS.646"; transcript_id "SS.646.1"; cov "453.100704"; FPKM "22.158663"; TPM "47.382905"; +CM143127.1 StringTie exon 1154341 1157180 1000 . . gene_id "SS.646"; transcript_id "SS.646.1"; exon_number "1"; cov "453.100708"; +CM143127.1 StringTie transcript 1157393 1161741 1000 . . gene_id "SS.647"; transcript_id "SS.647.1"; cov "337.140032"; FPKM "16.487664"; TPM "35.256344"; +CM143127.1 StringTie exon 1157393 1161741 1000 . . gene_id "SS.647"; transcript_id "SS.647.1"; exon_number "1"; cov "337.140045"; +CM143127.1 StringTie transcript 1161999 1164170 1000 . . gene_id "SS.648"; transcript_id "SS.648.1"; cov "463.799724"; FPKM "22.681893"; TPM "48.501753"; +CM143127.1 StringTie exon 1161999 1164170 1000 . . gene_id "SS.648"; transcript_id "SS.648.1"; exon_number "1"; cov "463.799713"; +CM143127.1 StringTie transcript 1164421 1168353 1000 . . gene_id "SS.649"; transcript_id "SS.649.1"; cov "326.508772"; FPKM "15.967748"; TPM "34.144582"; +CM143127.1 StringTie exon 1164421 1168353 1000 . . gene_id "SS.649"; transcript_id "SS.649.1"; exon_number "1"; cov "326.508759"; +CM143127.1 StringTie transcript 1168718 1171176 1000 . . gene_id "SS.650"; transcript_id "SS.650.1"; cov "344.349329"; FPKM "16.840232"; TPM "36.010254"; +CM143127.1 StringTie exon 1168718 1171176 1000 . . gene_id "SS.650"; transcript_id "SS.650.1"; exon_number "1"; cov "344.349335"; +CM143127.1 StringTie transcript 1171486 1175480 1000 . . gene_id "SS.651"; transcript_id "SS.651.1"; cov "295.271589"; FPKM "14.440109"; TPM "30.877961"; +CM143127.1 StringTie exon 1171486 1175480 1000 . . gene_id "SS.651"; transcript_id "SS.651.1"; exon_number "1"; cov "295.271576"; +CM143127.1 StringTie transcript 1181973 1182513 1000 . . gene_id "SS.652"; transcript_id "SS.652.1"; cov "1941.055453"; FPKM "94.926345"; TPM "202.985441"; +CM143127.1 StringTie exon 1181973 1182513 1000 . . gene_id "SS.652"; transcript_id "SS.652.1"; exon_number "1"; cov "1941.055420"; +CM143127.1 StringTie transcript 1182772 1185370 1000 + . gene_id "SS.653"; transcript_id "SS.653.1"; cov "1354.056549"; FPKM "66.219458"; TPM "141.600161"; +CM143127.1 StringTie exon 1182772 1182916 1000 + . gene_id "SS.653"; transcript_id "SS.653.1"; exon_number "1"; cov "610.896545"; +CM143127.1 StringTie exon 1183111 1185370 1000 + . gene_id "SS.653"; transcript_id "SS.653.1"; exon_number "2"; cov "1401.737183"; +CM143127.1 StringTie transcript 1185723 1187129 1000 . . gene_id "SS.654"; transcript_id "SS.654.1"; cov "369.337598"; FPKM "18.062270"; TPM "38.623397"; +CM143127.1 StringTie exon 1185723 1187129 1000 . . gene_id "SS.654"; transcript_id "SS.654.1"; exon_number "1"; cov "369.337585"; +CM143127.1 StringTie transcript 1187458 1191938 1000 . . gene_id "SS.655"; transcript_id "SS.655.1"; cov "1187.922116"; FPKM "58.094736"; TPM "124.226690"; +CM143127.1 StringTie exon 1187458 1191938 1000 . . gene_id "SS.655"; transcript_id "SS.655.1"; exon_number "1"; cov "1187.922119"; +CM143127.1 StringTie transcript 1192794 1195382 1000 - . gene_id "SS.656"; transcript_id "SS.656.1"; cov "19421.358589"; FPKM "949.791819"; TPM "2030.984241"; +CM143127.1 StringTie exon 1192794 1194152 1000 - . gene_id "SS.656"; transcript_id "SS.656.1"; exon_number "1"; cov "20712.511719"; +CM143127.1 StringTie exon 1195211 1195382 1000 - . gene_id "SS.656"; transcript_id "SS.656.1"; exon_number "2"; cov "9219.744141"; +CM143127.1 StringTie transcript 1195673 1197083 1000 . . gene_id "SS.657"; transcript_id "SS.657.1"; cov "163.197732"; FPKM "7.981103"; TPM "17.066366"; +CM143127.1 StringTie exon 1195673 1197083 1000 . . gene_id "SS.657"; transcript_id "SS.657.1"; exon_number "1"; cov "163.197739"; +CM143127.1 StringTie transcript 1201431 1202397 1000 + . gene_id "SS.658"; transcript_id "SS.658.1"; cov "208.868156"; FPKM "10.214593"; TPM "21.842341"; +CM143127.1 StringTie exon 1201431 1201780 1000 + . gene_id "SS.658"; transcript_id "SS.658.1"; exon_number "1"; cov "37.902859"; +CM143127.1 StringTie exon 1201853 1202397 1000 + . gene_id "SS.658"; transcript_id "SS.658.1"; exon_number "2"; cov "318.662384"; +CM143127.1 StringTie transcript 1205776 1206792 1000 - . gene_id "SS.659"; transcript_id "SS.659.1"; cov "21714.623229"; FPKM "1061.942779"; TPM "2270.801879"; +CM143127.1 StringTie exon 1205776 1206332 1000 - . gene_id "SS.659"; transcript_id "SS.659.1"; exon_number "1"; cov "23975.859375"; +CM143127.1 StringTie exon 1206644 1206792 1000 - . gene_id "SS.659"; transcript_id "SS.659.1"; exon_number "2"; cov "13261.543945"; +CM143127.1 StringTie transcript 1269276 1269525 1000 . . gene_id "SS.660"; transcript_id "SS.660.1"; cov "12.284000"; FPKM "0.600743"; TPM "1.284597"; +CM143127.1 StringTie exon 1269276 1269525 1000 . . gene_id "SS.660"; transcript_id "SS.660.1"; exon_number "1"; cov "12.284000"; +CM143127.1 StringTie transcript 1269889 1270253 1000 . . gene_id "SS.661"; transcript_id "SS.661.1"; cov "7.654795"; FPKM "0.374354"; TPM "0.800498"; +CM143127.1 StringTie exon 1269889 1270253 1000 . . gene_id "SS.661"; transcript_id "SS.661.1"; exon_number "1"; cov "7.654795"; +CM143127.1 StringTie transcript 1207288 1208177 1000 + . gene_id "SS.662"; transcript_id "SS.662.1"; cov "623.162790"; FPKM "30.475464"; TPM "65.167110"; +CM143127.1 StringTie exon 1207288 1207332 1000 + . gene_id "SS.662"; transcript_id "SS.662.1"; exon_number "1"; cov "82.083275"; +CM143127.1 StringTie exon 1207478 1208177 1000 + . gene_id "SS.662"; transcript_id "SS.662.1"; exon_number "2"; cov "657.946472"; +CM143127.1 StringTie transcript 1207288 1208177 1000 + . gene_id "SS.662"; transcript_id "SS.662.2"; cov "67.515408"; FPKM "3.301807"; TPM "7.060409"; +CM143127.1 StringTie exon 1207288 1207347 1000 + . gene_id "SS.662"; transcript_id "SS.662.2"; exon_number "1"; cov "10.954211"; +CM143127.1 StringTie exon 1207478 1208177 1000 + . gene_id "SS.662"; transcript_id "SS.662.2"; exon_number "2"; cov "72.363510"; +CM143127.1 StringTie transcript 1209752 1213849 1000 + . gene_id "SS.663"; transcript_id "SS.663.1"; cov "278.620234"; FPKM "13.625783"; TPM "29.136649"; +CM143127.1 StringTie exon 1209752 1210845 1000 + . gene_id "SS.663"; transcript_id "SS.663.1"; exon_number "1"; cov "136.931442"; +CM143127.1 StringTie exon 1210931 1213849 1000 + . gene_id "SS.663"; transcript_id "SS.663.1"; exon_number "2"; cov "331.723206"; +CM143127.1 StringTie transcript 1215411 1218816 1000 - . gene_id "SS.664"; transcript_id "SS.664.1"; cov "602.318375"; FPKM "29.456079"; TPM "62.987310"; +CM143127.1 StringTie exon 1215411 1218615 1000 - . gene_id "SS.664"; transcript_id "SS.664.1"; exon_number "1"; cov "618.057739"; +CM143127.1 StringTie exon 1218724 1218816 1000 - . gene_id "SS.664"; transcript_id "SS.664.1"; exon_number "2"; cov "59.903225"; +CM143127.1 StringTie transcript 1219201 1222800 1000 . . gene_id "SS.665"; transcript_id "SS.665.1"; cov "179.592778"; FPKM "8.782895"; TPM "18.780875"; +CM143127.1 StringTie exon 1219201 1222800 1000 . . gene_id "SS.665"; transcript_id "SS.665.1"; exon_number "1"; cov "179.592773"; +CM143127.1 StringTie transcript 1227192 1228929 1000 . . gene_id "SS.666"; transcript_id "SS.666.1"; cov "52255.581128"; FPKM "2555.533036"; TPM "5464.615736"; +CM143127.1 StringTie exon 1227192 1228929 1000 . . gene_id "SS.666"; transcript_id "SS.666.1"; exon_number "1"; cov "52255.582031"; +CM143127.1 StringTie transcript 1230935 1233682 1000 . . gene_id "SS.667"; transcript_id "SS.667.1"; cov "414.034934"; FPKM "20.248171"; TPM "43.297611"; +CM143127.1 StringTie exon 1230935 1233682 1000 . . gene_id "SS.667"; transcript_id "SS.667.1"; exon_number "1"; cov "414.034943"; +CM143127.1 StringTie transcript 1235955 1240125 1000 . . gene_id "SS.668"; transcript_id "SS.668.1"; cov "890.871254"; FPKM "43.567613"; TPM "93.162663"; +CM143127.1 StringTie exon 1235955 1240125 1000 . . gene_id "SS.668"; transcript_id "SS.668.1"; exon_number "1"; cov "890.871277"; +CM143127.1 StringTie transcript 1240397 1253705 1000 . . gene_id "SS.669"; transcript_id "SS.669.1"; cov "211.244045"; FPKM "10.330784"; TPM "22.090799"; +CM143127.1 StringTie exon 1240397 1253705 1000 . . gene_id "SS.669"; transcript_id "SS.669.1"; exon_number "1"; cov "211.244049"; +CM143127.1 StringTie transcript 1254255 1258036 1000 . . gene_id "SS.670"; transcript_id "SS.670.1"; cov "464.569276"; FPKM "22.719528"; TPM "48.582228"; +CM143127.1 StringTie exon 1254255 1258036 1000 . . gene_id "SS.670"; transcript_id "SS.670.1"; exon_number "1"; cov "464.569275"; +CM143127.1 StringTie transcript 1258841 1260335 1000 . . gene_id "SS.671"; transcript_id "SS.671.1"; cov "4418.568562"; FPKM "216.087884"; TPM "462.070821"; +CM143127.1 StringTie exon 1258841 1260335 1000 . . gene_id "SS.671"; transcript_id "SS.671.1"; exon_number "1"; cov "4418.568359"; +CM143127.1 StringTie transcript 1260817 1263537 1000 . . gene_id "SS.672"; transcript_id "SS.672.1"; cov "2144.176406"; FPKM "104.859874"; TPM "224.226769"; +CM143127.1 StringTie exon 1260817 1263537 1000 . . gene_id "SS.672"; transcript_id "SS.672.1"; exon_number "1"; cov "2144.176514"; +CM143127.1 StringTie transcript 1264419 1267171 1000 . . gene_id "SS.673"; transcript_id "SS.673.1"; cov "583.528151"; FPKM "28.537152"; TPM "61.022326"; +CM143127.1 StringTie exon 1264419 1267171 1000 . . gene_id "SS.673"; transcript_id "SS.673.1"; exon_number "1"; cov "583.528137"; +CM143127.1 StringTie transcript 1340698 1355932 1000 . . gene_id "SS.674"; transcript_id "SS.674.1"; cov "290.107844"; FPKM "14.187579"; TPM "30.337963"; +CM143127.1 StringTie exon 1340698 1355932 1000 . . gene_id "SS.674"; transcript_id "SS.674.1"; exon_number "1"; cov "290.107849"; +CM143127.1 StringTie transcript 1356192 1358192 1000 - . gene_id "SS.675"; transcript_id "SS.675.1"; cov "898.190292"; FPKM "43.925547"; TPM "93.928049"; +CM143127.1 StringTie exon 1356192 1357912 1000 - . gene_id "SS.675"; transcript_id "SS.675.1"; exon_number "1"; cov "932.855347"; +CM143127.1 StringTie exon 1358002 1358024 1000 - . gene_id "SS.675"; transcript_id "SS.675.1"; exon_number "2"; cov "520.913025"; +CM143127.1 StringTie exon 1358124 1358192 1000 - . gene_id "SS.675"; transcript_id "SS.675.1"; exon_number "3"; cov "159.333328"; +CM143127.1 StringTie transcript 1273459 1274123 1000 - . gene_id "SS.676"; transcript_id "SS.676.1"; cov "18746.700752"; FPKM "916.798016"; TPM "1960.432048"; +CM143127.1 StringTie exon 1273459 1274123 1000 - . gene_id "SS.676"; transcript_id "SS.676.1"; exon_number "1"; cov "18746.701172"; +CM143127.1 StringTie transcript 1273459 1274862 1000 - . gene_id "SS.676"; transcript_id "SS.676.2"; cov "1974.615299"; FPKM "96.567573"; TPM "206.494954"; +CM143127.1 StringTie exon 1273459 1274123 1000 - . gene_id "SS.676"; transcript_id "SS.676.2"; exon_number "1"; cov "2225.277588"; +CM143127.1 StringTie exon 1274742 1274862 1000 - . gene_id "SS.676"; transcript_id "SS.676.2"; exon_number "2"; cov "597.008240"; +CM143127.1 StringTie transcript 1276349 1277580 1000 + . gene_id "SS.677"; transcript_id "SS.677.1"; cov "21153.976331"; FPKM "1034.524623"; TPM "2212.172354"; +CM143127.1 StringTie exon 1276349 1276475 1000 + . gene_id "SS.677"; transcript_id "SS.677.1"; exon_number "1"; cov "1249.984253"; +CM143127.1 StringTie exon 1277032 1277580 1000 + . gene_id "SS.677"; transcript_id "SS.677.1"; exon_number "2"; cov "25758.361328"; +CM143127.1 StringTie transcript 1278143 1278639 1000 . . gene_id "SS.678"; transcript_id "SS.678.1"; cov "13393.694165"; FPKM "655.011908"; TPM "1400.642579"; +CM143127.1 StringTie exon 1278143 1278639 1000 . . gene_id "SS.678"; transcript_id "SS.678.1"; exon_number "1"; cov "13393.694336"; +CM143127.1 StringTie transcript 1279572 1281390 1000 . . gene_id "SS.679"; transcript_id "SS.679.1"; cov "1080.468389"; FPKM "52.839766"; TPM "112.989741"; +CM143127.1 StringTie exon 1279572 1281390 1000 . . gene_id "SS.679"; transcript_id "SS.679.1"; exon_number "1"; cov "1080.468384"; +CM143127.1 StringTie transcript 1281639 1285725 1000 . . gene_id "SS.680"; transcript_id "SS.680.1"; cov "506.953878"; FPKM "24.792326"; TPM "53.014589"; +CM143127.1 StringTie exon 1281639 1285725 1000 . . gene_id "SS.680"; transcript_id "SS.680.1"; exon_number "1"; cov "506.953888"; +CM143127.1 StringTie transcript 1281639 1290477 1000 - . gene_id "SS.681"; transcript_id "SS.681.1"; cov "117.066225"; FPKM "5.725065"; TPM "12.242174"; +CM143127.1 StringTie exon 1281639 1287685 1000 - . gene_id "SS.681"; transcript_id "SS.681.1"; exon_number "1"; cov "56.416698"; +CM143127.1 StringTie exon 1287780 1288593 1000 - . gene_id "SS.681"; transcript_id "SS.681.1"; exon_number "2"; cov "70.932846"; +CM143127.1 StringTie exon 1288666 1290477 1000 - . gene_id "SS.681"; transcript_id "SS.681.1"; exon_number "3"; cov "340.189972"; +CM143127.1 StringTie transcript 1286547 1287949 1000 - . gene_id "SS.681"; transcript_id "SS.681.2"; cov "1046.722570"; FPKM "51.189443"; TPM "109.460779"; +CM143127.1 StringTie exon 1286547 1287685 1000 - . gene_id "SS.681"; transcript_id "SS.681.2"; exon_number "1"; cov "987.007568"; +CM143127.1 StringTie exon 1287780 1287949 1000 - . gene_id "SS.681"; transcript_id "SS.681.2"; exon_number "2"; cov "1446.813110"; +CM143127.1 StringTie transcript 1286547 1290477 1000 - . gene_id "SS.681"; transcript_id "SS.681.3"; cov "679.098877"; FPKM "33.210991"; TPM "71.016614"; +CM143127.1 StringTie exon 1286547 1288665 1000 - . gene_id "SS.681"; transcript_id "SS.681.3"; exon_number "1"; cov "301.043671"; +CM143127.1 StringTie exon 1288690 1290477 1000 - . gene_id "SS.681"; transcript_id "SS.681.3"; exon_number "2"; cov "1127.140747"; +CM143127.1 StringTie transcript 1290750 1293091 1000 . . gene_id "SS.682"; transcript_id "SS.682.1"; cov "1086.125640"; FPKM "53.116431"; TPM "113.581346"; +CM143127.1 StringTie exon 1290750 1293091 1000 . . gene_id "SS.682"; transcript_id "SS.682.1"; exon_number "1"; cov "1086.125610"; +CM143127.1 StringTie transcript 1293439 1294157 1000 . . gene_id "SS.683"; transcript_id "SS.683.1"; cov "1014.682893"; FPKM "49.622559"; TPM "106.110237"; +CM143127.1 StringTie exon 1293439 1294157 1000 . . gene_id "SS.683"; transcript_id "SS.683.1"; exon_number "1"; cov "1014.682922"; +CM143127.1 StringTie transcript 1294764 1299764 1000 . . gene_id "SS.684"; transcript_id "SS.684.1"; cov "210.177115"; FPKM "10.278607"; TPM "21.979225"; +CM143127.1 StringTie exon 1294764 1299764 1000 . . gene_id "SS.684"; transcript_id "SS.684.1"; exon_number "1"; cov "210.177109"; +CM143127.1 StringTie transcript 1301035 1304656 1000 . . gene_id "SS.685"; transcript_id "SS.685.1"; cov "320.218940"; FPKM "15.660147"; TPM "33.486824"; +CM143127.1 StringTie exon 1301035 1304656 1000 . . gene_id "SS.685"; transcript_id "SS.685.1"; exon_number "1"; cov "320.218933"; +CM143127.1 StringTie transcript 1304870 1307419 1000 . . gene_id "SS.686"; transcript_id "SS.686.1"; cov "390.381176"; FPKM "19.091396"; TPM "40.824024"; +CM143127.1 StringTie exon 1304870 1307419 1000 . . gene_id "SS.686"; transcript_id "SS.686.1"; exon_number "1"; cov "390.381165"; +CM143127.1 StringTie transcript 1309902 1311863 1000 - . gene_id "SS.687"; transcript_id "SS.687.1"; cov "6111.775116"; FPKM "298.893302"; TPM "639.137519"; +CM143127.1 StringTie exon 1309902 1311379 1000 - . gene_id "SS.687"; transcript_id "SS.687.1"; exon_number "1"; cov "6139.684082"; +CM143127.1 StringTie exon 1311839 1311863 1000 - . gene_id "SS.687"; transcript_id "SS.687.1"; exon_number "2"; cov "4461.799805"; +CM143127.1 StringTie transcript 1314342 1315315 1000 . . gene_id "SS.688"; transcript_id "SS.688.1"; cov "2067.119097"; FPKM "101.091425"; TPM "216.168518"; +CM143127.1 StringTie exon 1314342 1315315 1000 . . gene_id "SS.688"; transcript_id "SS.688.1"; exon_number "1"; cov "2067.119141"; +CM143127.1 StringTie transcript 1322624 1324321 1000 . . gene_id "SS.689"; transcript_id "SS.689.1"; cov "22670.534747"; FPKM "1108.691153"; TPM "2370.766112"; +CM143127.1 StringTie exon 1322624 1324321 1000 . . gene_id "SS.689"; transcript_id "SS.689.1"; exon_number "1"; cov "22670.535156"; +CM143127.1 StringTie transcript 1324824 1325912 1000 . . gene_id "SS.690"; transcript_id "SS.690.1"; cov "1212.440771"; FPKM "59.293809"; TPM "126.790723"; +CM143127.1 StringTie exon 1324824 1325912 1000 . . gene_id "SS.690"; transcript_id "SS.690.1"; exon_number "1"; cov "1212.440796"; +CM143127.1 StringTie transcript 1326443 1327234 1000 . . gene_id "SS.691"; transcript_id "SS.691.1"; cov "1487.161616"; FPKM "72.728894"; TPM "155.519594"; +CM143127.1 StringTie exon 1326443 1327234 1000 . . gene_id "SS.691"; transcript_id "SS.691.1"; exon_number "1"; cov "1487.161621"; +CM143127.1 StringTie transcript 1327514 1329305 1000 . . gene_id "SS.692"; transcript_id "SS.692.1"; cov "349.984375"; FPKM "17.115811"; TPM "36.599538"; +CM143127.1 StringTie exon 1327514 1329305 1000 . . gene_id "SS.692"; transcript_id "SS.692.1"; exon_number "1"; cov "349.984375"; +CM143127.1 StringTie transcript 1329641 1331452 1000 . . gene_id "SS.693"; transcript_id "SS.693.1"; cov "883.726269"; FPKM "43.218191"; TPM "92.415477"; +CM143127.1 StringTie exon 1329641 1331452 1000 . . gene_id "SS.693"; transcript_id "SS.693.1"; exon_number "1"; cov "883.726257"; +CM143127.1 StringTie transcript 1331664 1337765 1000 . . gene_id "SS.694"; transcript_id "SS.694.1"; cov "564.315798"; FPKM "27.597582"; TPM "59.013199"; +CM143127.1 StringTie exon 1331664 1337765 1000 . . gene_id "SS.694"; transcript_id "SS.694.1"; exon_number "1"; cov "564.315796"; +CM143127.1 StringTie transcript 1338078 1339588 1000 . . gene_id "SS.695"; transcript_id "SS.695.1"; cov "1290.479153"; FPKM "63.110237"; TPM "134.951569"; +CM143127.1 StringTie exon 1338078 1339588 1000 . . gene_id "SS.695"; transcript_id "SS.695.1"; exon_number "1"; cov "1290.479126"; +CM143127.1 StringTie transcript 1359047 1360736 1000 . . gene_id "SS.696"; transcript_id "SS.696.1"; cov "2273.188757"; FPKM "111.169158"; TPM "237.718207"; +CM143127.1 StringTie exon 1359047 1360736 1000 . . gene_id "SS.696"; transcript_id "SS.696.1"; exon_number "1"; cov "2273.188721"; +CM143127.1 StringTie transcript 1380872 1381602 1000 . . gene_id "SS.697"; transcript_id "SS.697.1"; cov "121.303833"; FPKM "5.932303"; TPM "12.685321"; +CM143127.1 StringTie exon 1380872 1381602 1000 . . gene_id "SS.697"; transcript_id "SS.697.1"; exon_number "1"; cov "121.303833"; +CM143127.1 StringTie transcript 1361953 1363162 1000 + . gene_id "SS.698"; transcript_id "SS.698.1"; cov "18563.576827"; FPKM "907.842432"; TPM "1941.281904"; +CM143127.1 StringTie exon 1361953 1362116 1000 + . gene_id "SS.698"; transcript_id "SS.698.1"; exon_number "1"; cov "16437.835938"; +CM143127.1 StringTie exon 1362725 1363162 1000 + . gene_id "SS.698"; transcript_id "SS.698.1"; exon_number "2"; cov "19359.515625"; +CM143127.1 StringTie transcript 1363511 1365734 1000 . . gene_id "SS.699"; transcript_id "SS.699.1"; cov "667.414119"; FPKM "32.639553"; TPM "69.794683"; +CM143127.1 StringTie exon 1363511 1365734 1000 . . gene_id "SS.699"; transcript_id "SS.699.1"; exon_number "1"; cov "667.414124"; +CM143127.1 StringTie transcript 1366254 1368178 1000 . . gene_id "SS.700"; transcript_id "SS.700.1"; cov "1868.925195"; FPKM "91.398851"; TPM "195.442435"; +CM143127.1 StringTie exon 1366254 1368178 1000 . . gene_id "SS.700"; transcript_id "SS.700.1"; exon_number "1"; cov "1868.925171"; +CM143127.1 StringTie transcript 1369041 1372004 1000 . . gene_id "SS.701"; transcript_id "SS.701.1"; cov "652.321862"; FPKM "31.901474"; TPM "68.216413"; +CM143127.1 StringTie exon 1369041 1372004 1000 . . gene_id "SS.701"; transcript_id "SS.701.1"; exon_number "1"; cov "652.321838"; +CM143127.1 StringTie transcript 1372288 1380586 1000 . . gene_id "SS.702"; transcript_id "SS.702.1"; cov "238.769008"; FPKM "11.676879"; TPM "24.969216"; +CM143127.1 StringTie exon 1372288 1380586 1000 . . gene_id "SS.702"; transcript_id "SS.702.1"; exon_number "1"; cov "238.769012"; +CM143127.1 StringTie transcript 1388920 1390723 1000 . . gene_id "SS.703"; transcript_id "SS.703.1"; cov "2135.297118"; FPKM "104.425637"; TPM "223.298220"; +CM143127.1 StringTie exon 1388920 1390723 1000 . . gene_id "SS.703"; transcript_id "SS.703.1"; exon_number "1"; cov "2135.297119"; +CM143127.1 StringTie transcript 1392195 1393998 1000 . . gene_id "SS.704"; transcript_id "SS.704.1"; cov "6305.873060"; FPKM "308.385565"; TPM "659.435268"; +CM143127.1 StringTie exon 1392195 1393998 1000 . . gene_id "SS.704"; transcript_id "SS.704.1"; exon_number "1"; cov "6305.873047"; +CM143127.1 StringTie transcript 1394670 1397686 1000 . . gene_id "SS.705"; transcript_id "SS.705.1"; cov "623.320517"; FPKM "30.483178"; TPM "65.183604"; +CM143127.1 StringTie exon 1394670 1397686 1000 . . gene_id "SS.705"; transcript_id "SS.705.1"; exon_number "1"; cov "623.320496"; +CM143127.1 StringTie transcript 1398198 1399708 1000 . . gene_id "SS.706"; transcript_id "SS.706.1"; cov "721.339510"; FPKM "35.276748"; TPM "75.433918"; +CM143127.1 StringTie exon 1398198 1399708 1000 . . gene_id "SS.706"; transcript_id "SS.706.1"; exon_number "1"; cov "721.339539"; +CM143127.1 StringTie transcript 1400102 1401369 1000 . . gene_id "SS.707"; transcript_id "SS.707.1"; cov "748.834385"; FPKM "36.621371"; TPM "78.309189"; +CM143127.1 StringTie exon 1400102 1401369 1000 . . gene_id "SS.707"; transcript_id "SS.707.1"; exon_number "1"; cov "748.834412"; +CM143127.1 StringTie transcript 1402260 1407712 1000 . . gene_id "SS.708"; transcript_id "SS.708.1"; cov "250.920778"; FPKM "12.271155"; TPM "26.239984"; +CM143127.1 StringTie exon 1402260 1407712 1000 . . gene_id "SS.708"; transcript_id "SS.708.1"; exon_number "1"; cov "250.920776"; +CM143127.1 StringTie transcript 1408181 1434808 1000 . . gene_id "SS.709"; transcript_id "SS.709.1"; cov "823.331681"; FPKM "40.264624"; TPM "86.099727"; +CM143127.1 StringTie exon 1408181 1434808 1000 . . gene_id "SS.709"; transcript_id "SS.709.1"; exon_number "1"; cov "823.331665"; +CM143127.1 StringTie transcript 1423626 1430511 1000 + . gene_id "SS.710"; transcript_id "SS.710.1"; cov "11.197816"; FPKM "0.547624"; TPM "1.171009"; +CM143127.1 StringTie exon 1423626 1426770 1000 + . gene_id "SS.710"; transcript_id "SS.710.1"; exon_number "1"; cov "11.653635"; +CM143127.1 StringTie exon 1426957 1430511 1000 + . gene_id "SS.710"; transcript_id "SS.710.1"; exon_number "2"; cov "10.794566"; +CM143127.1 StringTie transcript 1435290 1439365 1000 . . gene_id "SS.711"; transcript_id "SS.711.1"; cov "1324.861629"; FPKM "64.791695"; TPM "138.547109"; +CM143127.1 StringTie exon 1435290 1439365 1000 . . gene_id "SS.711"; transcript_id "SS.711.1"; exon_number "1"; cov "1324.861572"; +CM143127.1 StringTie transcript 1439690 1440860 1000 . . gene_id "SS.712"; transcript_id "SS.712.1"; cov "528.289496"; FPKM "25.835733"; TPM "55.245756"; +CM143127.1 StringTie exon 1439690 1440860 1000 . . gene_id "SS.712"; transcript_id "SS.712.1"; exon_number "1"; cov "528.289490"; +CM143127.1 StringTie transcript 1441263 1448536 1000 . . gene_id "SS.713"; transcript_id "SS.713.1"; cov "867.730272"; FPKM "42.435915"; TPM "90.742700"; +CM143127.1 StringTie exon 1441263 1448536 1000 . . gene_id "SS.713"; transcript_id "SS.713.1"; exon_number "1"; cov "867.730286"; +CM143127.1 StringTie transcript 1448934 1451126 1000 . . gene_id "SS.714"; transcript_id "SS.714.1"; cov "1140.546740"; FPKM "55.777867"; TPM "119.272421"; +CM143127.1 StringTie exon 1448934 1451126 1000 . . gene_id "SS.714"; transcript_id "SS.714.1"; exon_number "1"; cov "1140.546753"; +CM143127.1 StringTie transcript 1451513 1453248 1000 . . gene_id "SS.715"; transcript_id "SS.715.1"; cov "276.701037"; FPKM "13.531926"; TPM "28.935949"; +CM143127.1 StringTie exon 1451513 1453248 1000 . . gene_id "SS.715"; transcript_id "SS.715.1"; exon_number "1"; cov "276.701050"; +CM143127.1 StringTie transcript 1453594 1459716 1000 . . gene_id "SS.716"; transcript_id "SS.716.1"; cov "281.628450"; FPKM "13.772898"; TPM "29.451232"; +CM143127.1 StringTie exon 1453594 1459716 1000 . . gene_id "SS.716"; transcript_id "SS.716.1"; exon_number "1"; cov "281.628448"; +CM143127.1 StringTie transcript 1460004 1463305 1000 - . gene_id "SS.717"; transcript_id "SS.717.1"; cov "1102.803157"; FPKM "53.932036"; TPM "115.325394"; +CM143127.1 StringTie exon 1460004 1461058 1000 - . gene_id "SS.717"; transcript_id "SS.717.1"; exon_number "1"; cov "871.725098"; +CM143127.1 StringTie exon 1461130 1463305 1000 - . gene_id "SS.717"; transcript_id "SS.717.1"; exon_number "2"; cov "1214.837769"; +CM143127.1 StringTie transcript 1465170 1466953 1000 . . gene_id "SS.718"; transcript_id "SS.718.1"; cov "7217.235426"; FPKM "352.955286"; TPM "754.740784"; +CM143127.1 StringTie exon 1465170 1466953 1000 . . gene_id "SS.718"; transcript_id "SS.718.1"; exon_number "1"; cov "7217.235352"; +CM143127.1 StringTie transcript 1467583 1469270 1000 . . gene_id "SS.719"; transcript_id "SS.719.1"; cov "260.697275"; FPKM "12.749270"; TPM "27.262359"; +CM143127.1 StringTie exon 1467583 1469270 1000 . . gene_id "SS.719"; transcript_id "SS.719.1"; exon_number "1"; cov "260.697266"; +CM143127.1 StringTie transcript 1469607 1469923 1000 . . gene_id "SS.720"; transcript_id "SS.720.1"; cov "111.709779"; FPKM "5.463111"; TPM "11.682025"; +CM143127.1 StringTie exon 1469607 1469923 1000 . . gene_id "SS.720"; transcript_id "SS.720.1"; exon_number "1"; cov "111.709778"; +CM143127.1 StringTie transcript 1470239 1476150 1000 . . gene_id "SS.721"; transcript_id "SS.721.1"; cov "219.653586"; FPKM "10.742049"; TPM "22.970225"; +CM143127.1 StringTie exon 1470239 1476150 1000 . . gene_id "SS.721"; transcript_id "SS.721.1"; exon_number "1"; cov "219.653580"; +CM143127.1 StringTie transcript 1476459 1477099 1000 . . gene_id "SS.722"; transcript_id "SS.722.1"; cov "1778.204368"; FPKM "86.962194"; TPM "185.955325"; +CM143127.1 StringTie exon 1476459 1477099 1000 . . gene_id "SS.722"; transcript_id "SS.722.1"; exon_number "1"; cov "1778.204346"; +CM143127.1 StringTie transcript 1477437 1478929 1000 . . gene_id "SS.723"; transcript_id "SS.723.1"; cov "16112.964501"; FPKM "787.996463"; TPM "1685.009667"; +CM143127.1 StringTie exon 1477437 1478929 1000 . . gene_id "SS.723"; transcript_id "SS.723.1"; exon_number "1"; cov "16112.964844"; +CM143127.1 StringTie transcript 1479180 1482455 1000 . . gene_id "SS.724"; transcript_id "SS.724.1"; cov "2284.103175"; FPKM "111.702922"; TPM "238.859580"; +CM143127.1 StringTie exon 1479180 1482455 1000 . . gene_id "SS.724"; transcript_id "SS.724.1"; exon_number "1"; cov "2284.103271"; +CM143127.1 StringTie transcript 1482746 1484416 1000 - . gene_id "SS.725"; transcript_id "SS.725.1"; cov "2657.284020"; FPKM "129.953145"; TPM "277.884883"; +CM143127.1 StringTie exon 1482746 1483816 1000 - . gene_id "SS.725"; transcript_id "SS.725.1"; exon_number "1"; cov "2909.602539"; +CM143127.1 StringTie exon 1484177 1484190 1000 - . gene_id "SS.725"; transcript_id "SS.725.1"; exon_number "2"; cov "805.491882"; +CM143127.1 StringTie exon 1484319 1484416 1000 - . gene_id "SS.725"; transcript_id "SS.725.1"; exon_number "3"; cov "164.345505"; +CM143127.1 StringTie transcript 1482746 1484416 1000 - . gene_id "SS.725"; transcript_id "SS.725.2"; cov "364.836721"; FPKM "17.842157"; TPM "38.152719"; +CM143127.1 StringTie exon 1482746 1483816 1000 - . gene_id "SS.725"; transcript_id "SS.725.2"; exon_number "1"; cov "433.235931"; +CM143127.1 StringTie exon 1484177 1484416 1000 - . gene_id "SS.725"; transcript_id "SS.725.2"; exon_number "2"; cov "59.605225"; +CM143127.1 StringTie transcript 1484742 1487640 1000 . . gene_id "SS.726"; transcript_id "SS.726.1"; cov "127.235598"; FPKM "6.222393"; TPM "13.305634"; +CM143127.1 StringTie exon 1484742 1487640 1000 . . gene_id "SS.726"; transcript_id "SS.726.1"; exon_number "1"; cov "127.235596"; +CM143127.1 StringTie transcript 1488058 1492628 1000 . . gene_id "SS.727"; transcript_id "SS.727.1"; cov "1514.879020"; FPKM "74.084400"; TPM "158.418135"; +CM143127.1 StringTie exon 1488058 1492628 1000 . . gene_id "SS.727"; transcript_id "SS.727.1"; exon_number "1"; cov "1514.879028"; +CM143127.1 StringTie transcript 1492953 1494046 1000 . . gene_id "SS.728"; transcript_id "SS.728.1"; cov "1090.648995"; FPKM "53.337643"; TPM "114.054375"; +CM143127.1 StringTie exon 1492953 1494046 1000 . . gene_id "SS.728"; transcript_id "SS.728.1"; exon_number "1"; cov "1090.649048"; +CM143127.1 StringTie transcript 1494907 1498932 1000 . . gene_id "SS.729"; transcript_id "SS.729.1"; cov "2367.549677"; FPKM "115.783832"; TPM "247.585979"; +CM143127.1 StringTie exon 1494907 1498932 1000 . . gene_id "SS.729"; transcript_id "SS.729.1"; exon_number "1"; cov "2367.549561"; +CM143127.1 StringTie transcript 1499408 1500352 1000 + . gene_id "SS.730"; transcript_id "SS.730.1"; cov "2086.892541"; FPKM "102.058435"; TPM "218.236322"; +CM143127.1 StringTie exon 1499408 1499588 1000 + . gene_id "SS.730"; transcript_id "SS.730.1"; exon_number "1"; cov "519.751404"; +CM143127.1 StringTie exon 1499666 1499722 1000 + . gene_id "SS.730"; transcript_id "SS.730.1"; exon_number "2"; cov "2030.789429"; +CM143127.1 StringTie exon 1499800 1500352 1000 + . gene_id "SS.730"; transcript_id "SS.730.1"; exon_number "3"; cov "2605.609375"; +CM143127.1 StringTie transcript 1500522 1502087 1000 . . gene_id "SS.731"; transcript_id "SS.731.1"; cov "1702.287835"; FPKM "83.249534"; TPM "178.016370"; +CM143127.1 StringTie exon 1500522 1502087 1000 . . gene_id "SS.731"; transcript_id "SS.731.1"; exon_number "1"; cov "1702.287842"; +CM143127.1 StringTie transcript 1501522 1502265 1000 - . gene_id "SS.732"; transcript_id "SS.732.1"; cov "98.180623"; FPKM "4.801474"; TPM "10.267217"; +CM143127.1 StringTie exon 1501522 1502089 1000 - . gene_id "SS.732"; transcript_id "SS.732.1"; exon_number "1"; cov "77.062233"; +CM143127.1 StringTie exon 1502212 1502265 1000 - . gene_id "SS.732"; transcript_id "SS.732.1"; exon_number "2"; cov "320.314819"; +CM143127.1 StringTie transcript 1504396 1505631 1000 . . gene_id "SS.733"; transcript_id "SS.733.1"; cov "741.883495"; FPKM "36.281441"; TPM "77.582301"; +CM143127.1 StringTie exon 1504396 1505631 1000 . . gene_id "SS.733"; transcript_id "SS.733.1"; exon_number "1"; cov "741.883484"; +CM143127.1 StringTie transcript 1505953 1508462 1000 . . gene_id "SS.734"; transcript_id "SS.734.1"; cov "3083.984064"; FPKM "150.820697"; TPM "322.506945"; +CM143127.1 StringTie exon 1505953 1508462 1000 . . gene_id "SS.734"; transcript_id "SS.734.1"; exon_number "1"; cov "3083.984131"; +CM143127.1 StringTie transcript 1508667 1511560 1000 . . gene_id "SS.735"; transcript_id "SS.735.1"; cov "1243.323773"; FPKM "60.804127"; TPM "130.020306"; +CM143127.1 StringTie exon 1508667 1511560 1000 . . gene_id "SS.735"; transcript_id "SS.735.1"; exon_number "1"; cov "1243.323730"; +CM143127.1 StringTie transcript 1511861 1513886 1000 . . gene_id "SS.736"; transcript_id "SS.736.1"; cov "819.908687"; FPKM "40.097224"; TPM "85.741768"; +CM143127.1 StringTie exon 1511861 1513886 1000 . . gene_id "SS.736"; transcript_id "SS.736.1"; exon_number "1"; cov "819.908691"; +CM143127.1 StringTie transcript 1514346 1515065 1000 . . gene_id "SS.737"; transcript_id "SS.737.1"; cov "1674.454167"; FPKM "81.888343"; TPM "175.105671"; +CM143127.1 StringTie exon 1514346 1515065 1000 . . gene_id "SS.737"; transcript_id "SS.737.1"; exon_number "1"; cov "1674.454224"; +CM143127.1 StringTie transcript 1515890 1516863 1000 . . gene_id "SS.738"; transcript_id "SS.738.1"; cov "6011.754620"; FPKM "294.001850"; TPM "628.677898"; +CM143127.1 StringTie exon 1515890 1516863 1000 . . gene_id "SS.738"; transcript_id "SS.738.1"; exon_number "1"; cov "6011.754395"; +CM143127.1 StringTie transcript 1520508 1521837 1000 . . gene_id "SS.739"; transcript_id "SS.739.1"; cov "1976.584962"; FPKM "96.663898"; TPM "206.700931"; +CM143127.1 StringTie exon 1520508 1521837 1000 . . gene_id "SS.739"; transcript_id "SS.739.1"; exon_number "1"; cov "1976.584961"; +CM143127.1 StringTie transcript 1522295 1524099 1000 . . gene_id "SS.740"; transcript_id "SS.740.1"; cov "943.124100"; FPKM "46.123012"; TPM "98.626992"; +CM143127.1 StringTie exon 1522295 1524099 1000 . . gene_id "SS.740"; transcript_id "SS.740.1"; exon_number "1"; cov "943.124084"; +CM143127.1 StringTie transcript 1524564 1527134 1000 . . gene_id "SS.741"; transcript_id "SS.741.1"; cov "1236.010113"; FPKM "60.446456"; TPM "129.255482"; +CM143127.1 StringTie exon 1524564 1527134 1000 . . gene_id "SS.741"; transcript_id "SS.741.1"; exon_number "1"; cov "1236.010132"; +CM143127.1 StringTie transcript 1527457 1530823 1000 . . gene_id "SS.742"; transcript_id "SS.742.1"; cov "686.426789"; FPKM "33.569358"; TPM "71.782928"; +CM143127.1 StringTie exon 1527457 1530823 1000 . . gene_id "SS.742"; transcript_id "SS.742.1"; exon_number "1"; cov "686.426819"; +CM143127.1 StringTie transcript 1531377 1536723 1000 . . gene_id "SS.743"; transcript_id "SS.743.1"; cov "536.111464"; FPKM "26.218263"; TPM "56.063737"; +CM143127.1 StringTie exon 1531377 1536723 1000 . . gene_id "SS.743"; transcript_id "SS.743.1"; exon_number "1"; cov "536.111450"; +CM143127.1 StringTie transcript 1537029 1538792 1000 - . gene_id "SS.744"; transcript_id "SS.744.1"; cov "830.814617"; FPKM "40.630573"; TPM "86.882253"; +CM143127.1 StringTie exon 1537029 1538593 1000 - . gene_id "SS.744"; transcript_id "SS.744.1"; exon_number "1"; cov "870.621094"; +CM143127.1 StringTie exon 1538675 1538792 1000 - . gene_id "SS.744"; transcript_id "SS.744.1"; exon_number "2"; cov "302.872894"; +CM143127.1 StringTie transcript 1539823 1541975 1000 . . gene_id "SS.745"; transcript_id "SS.745.1"; cov "1008.029726"; FPKM "49.297189"; TPM "105.414484"; +CM143127.1 StringTie exon 1539823 1541975 1000 . . gene_id "SS.745"; transcript_id "SS.745.1"; exon_number "1"; cov "1008.029724"; +CM143127.1 StringTie transcript 1544159 1546624 1000 . . gene_id "SS.746"; transcript_id "SS.746.1"; cov "296.741281"; FPKM "14.511984"; TPM "31.031653"; +CM143127.1 StringTie exon 1544159 1546624 1000 . . gene_id "SS.746"; transcript_id "SS.746.1"; exon_number "1"; cov "296.741272"; +CM143127.1 StringTie transcript 1546950 1551584 1000 . . gene_id "SS.747"; transcript_id "SS.747.1"; cov "465.079827"; FPKM "22.744496"; TPM "48.635619"; +CM143127.1 StringTie exon 1546950 1551584 1000 . . gene_id "SS.747"; transcript_id "SS.747.1"; exon_number "1"; cov "465.079834"; +CM143127.1 StringTie transcript 1551925 1552567 1000 + . gene_id "SS.748"; transcript_id "SS.748.1"; cov "491.682844"; FPKM "24.045503"; TPM "51.417624"; +CM143127.1 StringTie exon 1551925 1551978 1000 + . gene_id "SS.748"; transcript_id "SS.748.1"; exon_number "1"; cov "12.598423"; +CM143127.1 StringTie exon 1552052 1552567 1000 + . gene_id "SS.748"; transcript_id "SS.748.1"; exon_number "2"; cov "541.819580"; +CM143127.1 StringTie transcript 1551925 1552567 1000 + . gene_id "SS.748"; transcript_id "SS.748.2"; cov "49.591747"; FPKM "2.425260"; TPM "5.186046"; +CM143127.1 StringTie exon 1551925 1551978 1000 + . gene_id "SS.748"; transcript_id "SS.748.2"; exon_number "1"; cov "1.253429"; +CM143127.1 StringTie exon 1552063 1552567 1000 + . gene_id "SS.748"; transcript_id "SS.748.2"; exon_number "2"; cov "54.760597"; +CM143127.1 StringTie transcript 1556589 1557524 1000 - . gene_id "SS.749"; transcript_id "SS.749.1"; cov "15614.610877"; FPKM "763.624728"; TPM "1632.894448"; +CM143127.1 StringTie exon 1556589 1557105 1000 - . gene_id "SS.749"; transcript_id "SS.749.1"; exon_number "1"; cov "16802.656250"; +CM143127.1 StringTie exon 1557470 1557524 1000 - . gene_id "SS.749"; transcript_id "SS.749.1"; exon_number "2"; cov "4446.989258"; +CM143127.1 StringTie transcript 1556589 1557524 1000 - . gene_id "SS.749"; transcript_id "SS.749.2"; cov "6678.920144"; FPKM "326.629246"; TPM "698.446584"; +CM143127.1 StringTie exon 1556589 1557105 1000 - . gene_id "SS.749"; transcript_id "SS.749.2"; exon_number "1"; cov "7571.815430"; +CM143127.1 StringTie exon 1557392 1557524 1000 - . gene_id "SS.749"; transcript_id "SS.749.2"; exon_number "2"; cov "3208.041992"; +CM143127.1 StringTie transcript 1562558 1563889 1000 . . gene_id "SS.750"; transcript_id "SS.750.1"; cov "14456.605105"; FPKM "706.993036"; TPM "1511.796253"; +CM143127.1 StringTie exon 1562558 1563889 1000 . . gene_id "SS.750"; transcript_id "SS.750.1"; exon_number "1"; cov "14456.605469"; +CM143127.1 StringTie transcript 1566590 1567077 1000 . . gene_id "SS.751"; transcript_id "SS.751.1"; cov "15688.050205"; FPKM "767.216242"; TPM "1640.574350"; +CM143127.1 StringTie exon 1566590 1567077 1000 . . gene_id "SS.751"; transcript_id "SS.751.1"; exon_number "1"; cov "15688.049805"; +CM143127.1 StringTie transcript 1571403 1572082 1000 . . gene_id "SS.752"; transcript_id "SS.752.1"; cov "2838.116176"; FPKM "138.796651"; TPM "296.795366"; +CM143127.1 StringTie exon 1571403 1572082 1000 . . gene_id "SS.752"; transcript_id "SS.752.1"; exon_number "1"; cov "2838.116211"; +CM143127.1 StringTie transcript 1572527 1575432 1000 . . gene_id "SS.753"; transcript_id "SS.753.1"; cov "706.800757"; FPKM "34.565737"; TPM "73.913531"; +CM143127.1 StringTie exon 1572527 1575432 1000 . . gene_id "SS.753"; transcript_id "SS.753.1"; exon_number "1"; cov "706.800781"; +CM143127.1 StringTie transcript 1575650 1577874 1000 . . gene_id "SS.754"; transcript_id "SS.754.1"; cov "658.859326"; FPKM "32.221186"; TPM "68.900067"; +CM143127.1 StringTie exon 1575650 1577874 1000 . . gene_id "SS.754"; transcript_id "SS.754.1"; exon_number "1"; cov "658.859314"; +CM143127.1 StringTie transcript 1580769 1581715 1000 . . gene_id "SS.755"; transcript_id "SS.755.1"; cov "1883.091869"; FPKM "92.091665"; TPM "196.923912"; +CM143127.1 StringTie exon 1580769 1581715 1000 . . gene_id "SS.755"; transcript_id "SS.755.1"; exon_number "1"; cov "1883.091919"; +CM143127.1 StringTie transcript 1586196 1587372 1000 . . gene_id "SS.756"; transcript_id "SS.756.1"; cov "404.317757"; FPKM "19.772958"; TPM "42.281439"; +CM143127.1 StringTie exon 1586196 1587372 1000 . . gene_id "SS.756"; transcript_id "SS.756.1"; exon_number "1"; cov "404.317749"; +CM143127.1 StringTie transcript 1595872 1598465 1000 . . gene_id "SS.757"; transcript_id "SS.757.1"; cov "140.171164"; FPKM "6.855001"; TPM "14.658368"; +CM143127.1 StringTie exon 1595872 1598465 1000 . . gene_id "SS.757"; transcript_id "SS.757.1"; exon_number "1"; cov "140.171158"; +CM143127.1 StringTie transcript 1588264 1595394 1000 . . gene_id "SS.758"; transcript_id "SS.758.1"; cov "1250.258028"; FPKM "61.143243"; TPM "130.745454"; +CM143127.1 StringTie exon 1588264 1595394 1000 . . gene_id "SS.758"; transcript_id "SS.758.1"; exon_number "1"; cov "1250.258057"; +CM143127.1 StringTie transcript 1644038 1652699 1000 . . gene_id "SS.759"; transcript_id "SS.759.1"; cov "56.457130"; FPKM "2.761008"; TPM "5.903992"; +CM143127.1 StringTie exon 1644038 1652699 1000 . . gene_id "SS.759"; transcript_id "SS.759.1"; exon_number "1"; cov "56.457130"; +CM143127.1 StringTie transcript 1653007 1659102 1000 . . gene_id "SS.760"; transcript_id "SS.760.1"; cov "113.261760"; FPKM "5.539010"; TPM "11.844323"; +CM143127.1 StringTie exon 1653007 1659102 1000 . . gene_id "SS.760"; transcript_id "SS.760.1"; exon_number "1"; cov "113.261757"; +CM143127.1 StringTie transcript 1599006 1606427 1000 . . gene_id "SS.761"; transcript_id "SS.761.1"; cov "278.570870"; FPKM "13.623369"; TPM "29.131487"; +CM143127.1 StringTie exon 1599006 1606427 1000 . . gene_id "SS.761"; transcript_id "SS.761.1"; exon_number "1"; cov "278.570862"; +CM143127.1 StringTie transcript 1606984 1610316 1000 . . gene_id "SS.762"; transcript_id "SS.762.1"; cov "150.067207"; FPKM "7.338962"; TPM "15.693245"; +CM143127.1 StringTie exon 1606984 1610316 1000 . . gene_id "SS.762"; transcript_id "SS.762.1"; exon_number "1"; cov "150.067200"; +CM143127.1 StringTie transcript 1610623 1612383 1000 . . gene_id "SS.763"; transcript_id "SS.763.1"; cov "363.800681"; FPKM "17.791490"; TPM "38.044375"; +CM143127.1 StringTie exon 1610623 1612383 1000 . . gene_id "SS.763"; transcript_id "SS.763.1"; exon_number "1"; cov "363.800690"; +CM143127.1 StringTie transcript 1612641 1614612 1000 . . gene_id "SS.764"; transcript_id "SS.764.1"; cov "1048.939148"; FPKM "51.297844"; TPM "109.692577"; +CM143127.1 StringTie exon 1612641 1614612 1000 . . gene_id "SS.764"; transcript_id "SS.764.1"; exon_number "1"; cov "1048.939209"; +CM143127.1 StringTie transcript 1614911 1629584 1000 . . gene_id "SS.765"; transcript_id "SS.765.1"; cov "693.615715"; FPKM "33.920929"; TPM "72.534709"; +CM143127.1 StringTie exon 1614911 1629584 1000 . . gene_id "SS.765"; transcript_id "SS.765.1"; exon_number "1"; cov "693.615723"; +CM143127.1 StringTie transcript 1624808 1628079 1000 - . gene_id "SS.766"; transcript_id "SS.766.1"; cov "109.598481"; FPKM "5.359859"; TPM "11.461237"; +CM143127.1 StringTie exon 1624808 1626822 1000 - . gene_id "SS.766"; transcript_id "SS.766.1"; exon_number "1"; cov "63.541035"; +CM143127.1 StringTie exon 1626898 1628079 1000 - . gene_id "SS.766"; transcript_id "SS.766.1"; exon_number "2"; cov "188.114349"; +CM143127.1 StringTie transcript 1629946 1639487 1000 + . gene_id "SS.767"; transcript_id "SS.767.1"; cov "755.766381"; FPKM "36.960377"; TPM "79.034101"; +CM143127.1 StringTie exon 1629946 1630146 1000 + . gene_id "SS.767"; transcript_id "SS.767.1"; exon_number "1"; cov "167.721390"; +CM143127.1 StringTie exon 1630225 1630273 1000 + . gene_id "SS.767"; transcript_id "SS.767.1"; exon_number "2"; cov "290.653076"; +CM143127.1 StringTie exon 1630398 1639487 1000 + . gene_id "SS.767"; transcript_id "SS.767.1"; exon_number "3"; cov "771.276550"; +CM143127.1 StringTie transcript 1635845 1637825 1000 . . gene_id "SS.768"; transcript_id "SS.768.1"; cov "2571.438415"; FPKM "125.754908"; TPM "268.907598"; +CM143127.1 StringTie exon 1635845 1637825 1000 . . gene_id "SS.768"; transcript_id "SS.768.1"; exon_number "1"; cov "2571.438477"; +CM143127.1 StringTie transcript 1638167 1639487 1000 . . gene_id "SS.769"; transcript_id "SS.769.1"; cov "17605.586677"; FPKM "860.992403"; TPM "1841.100298"; +CM143127.1 StringTie exon 1638167 1639487 1000 . . gene_id "SS.769"; transcript_id "SS.769.1"; exon_number "1"; cov "17605.585938"; +CM143127.1 StringTie transcript 1640185 1643405 1000 . . gene_id "SS.770"; transcript_id "SS.770.1"; cov "599.503260"; FPKM "29.318407"; TPM "62.692920"; +CM143127.1 StringTie exon 1640185 1643405 1000 . . gene_id "SS.770"; transcript_id "SS.770.1"; exon_number "1"; cov "599.503235"; +CM143127.1 StringTie transcript 1659471 1681046 1000 . . gene_id "SS.771"; transcript_id "SS.771.1"; cov "264.619044"; FPKM "12.941062"; TPM "27.672477"; +CM143127.1 StringTie exon 1659471 1681046 1000 . . gene_id "SS.771"; transcript_id "SS.771.1"; exon_number "1"; cov "264.619049"; +CM143127.1 StringTie transcript 1679384 1685038 1000 - . gene_id "SS.772"; transcript_id "SS.772.1"; cov "481.847514"; FPKM "23.564511"; TPM "50.389096"; +CM143127.1 StringTie exon 1679384 1684871 1000 - . gene_id "SS.772"; transcript_id "SS.772.1"; exon_number "1"; cov "485.043549"; +CM143127.1 StringTie exon 1684956 1685038 1000 - . gene_id "SS.772"; transcript_id "SS.772.1"; exon_number "2"; cov "270.524109"; +CM143127.1 StringTie transcript 1685306 1688283 1000 . . gene_id "SS.773"; transcript_id "SS.773.1"; cov "562.799194"; FPKM "27.523413"; TPM "58.854600"; +CM143127.1 StringTie exon 1685306 1688283 1000 . . gene_id "SS.773"; transcript_id "SS.773.1"; exon_number "1"; cov "562.799194"; +CM143127.1 StringTie transcript 1688592 1692081 1000 . . gene_id "SS.774"; transcript_id "SS.774.1"; cov "520.087393"; FPKM "25.434614"; TPM "54.388023"; +CM143127.1 StringTie exon 1688592 1692081 1000 . . gene_id "SS.774"; transcript_id "SS.774.1"; exon_number "1"; cov "520.087402"; +CM143127.1 StringTie transcript 1692479 1696688 1000 . . gene_id "SS.775"; transcript_id "SS.775.1"; cov "948.401900"; FPKM "46.381120"; TPM "99.178917"; +CM143127.1 StringTie exon 1692479 1696688 1000 . . gene_id "SS.775"; transcript_id "SS.775.1"; exon_number "1"; cov "948.401917"; +CM143127.1 StringTie transcript 1697593 1699752 1000 . . gene_id "SS.776"; transcript_id "SS.776.1"; cov "3029.906019"; FPKM "148.176037"; TPM "316.851746"; +CM143127.1 StringTie exon 1697593 1699752 1000 . . gene_id "SS.776"; transcript_id "SS.776.1"; exon_number "1"; cov "3029.906006"; +CM143127.1 StringTie transcript 1700229 1701465 1000 . . gene_id "SS.777"; transcript_id "SS.777.1"; cov "1515.012935"; FPKM "74.090949"; TPM "158.432140"; +CM143127.1 StringTie exon 1700229 1701465 1000 . . gene_id "SS.777"; transcript_id "SS.777.1"; exon_number "1"; cov "1515.012939"; +CM143127.1 StringTie transcript 1705402 1706880 1000 . . gene_id "SS.778"; transcript_id "SS.778.1"; cov "152.524679"; FPKM "7.459143"; TPM "15.950234"; +CM143127.1 StringTie exon 1705402 1706880 1000 . . gene_id "SS.778"; transcript_id "SS.778.1"; exon_number "1"; cov "152.524673"; +CM143127.1 StringTie transcript 1707782 1711971 1000 . . gene_id "SS.779"; transcript_id "SS.779.1"; cov "504.329356"; FPKM "24.663975"; TPM "52.740130"; +CM143127.1 StringTie exon 1707782 1711971 1000 . . gene_id "SS.779"; transcript_id "SS.779.1"; exon_number "1"; cov "504.329346"; +CM143127.1 StringTie transcript 1712213 1724111 1000 . . gene_id "SS.780"; transcript_id "SS.780.1"; cov "820.206236"; FPKM "40.111775"; TPM "85.772884"; +CM143127.1 StringTie exon 1712213 1724111 1000 . . gene_id "SS.780"; transcript_id "SS.780.1"; exon_number "1"; cov "820.206238"; +CM143127.1 StringTie transcript 1724490 1727090 1000 . . gene_id "SS.781"; transcript_id "SS.781.1"; cov "117.302960"; FPKM "5.736643"; TPM "12.266931"; +CM143127.1 StringTie exon 1724490 1727090 1000 . . gene_id "SS.781"; transcript_id "SS.781.1"; exon_number "1"; cov "117.302963"; +CM143127.1 StringTie transcript 1727401 1732599 1000 . . gene_id "SS.782"; transcript_id "SS.782.1"; cov "160.179265"; FPKM "7.833487"; TPM "16.750711"; +CM143127.1 StringTie exon 1727401 1732599 1000 . . gene_id "SS.782"; transcript_id "SS.782.1"; exon_number "1"; cov "160.179260"; +CM143127.1 StringTie transcript 1732836 1734039 1000 . . gene_id "SS.783"; transcript_id "SS.783.1"; cov "2501.024086"; FPKM "122.311331"; TPM "261.544036"; +CM143127.1 StringTie exon 1732836 1734039 1000 . . gene_id "SS.783"; transcript_id "SS.783.1"; exon_number "1"; cov "2501.024170"; +CM143127.1 StringTie transcript 1734395 1734957 1000 . . gene_id "SS.784"; transcript_id "SS.784.1"; cov "2142.298401"; FPKM "104.768031"; TPM "224.030377"; +CM143127.1 StringTie exon 1734395 1734957 1000 . . gene_id "SS.784"; transcript_id "SS.784.1"; exon_number "1"; cov "2142.298340"; +CM143127.1 StringTie transcript 1738766 1740465 1000 . . gene_id "SS.785"; transcript_id "SS.785.1"; cov "1245.647647"; FPKM "60.917775"; TPM "130.263325"; +CM143127.1 StringTie exon 1738766 1740465 1000 . . gene_id "SS.785"; transcript_id "SS.785.1"; exon_number "1"; cov "1245.647705"; +CM143127.1 StringTie transcript 1740762 1743545 1000 . . gene_id "SS.786"; transcript_id "SS.786.1"; cov "360.124641"; FPKM "17.611715"; TPM "37.659954"; +CM143127.1 StringTie exon 1740762 1743545 1000 . . gene_id "SS.786"; transcript_id "SS.786.1"; exon_number "1"; cov "360.124634"; +CM143127.1 StringTie transcript 1743775 1746359 1000 + . gene_id "SS.787"; transcript_id "SS.787.1"; cov "458.883082"; FPKM "22.441447"; TPM "47.987596"; +CM143127.1 StringTie exon 1743775 1743826 1000 + . gene_id "SS.787"; transcript_id "SS.787.1"; exon_number "1"; cov "347.193878"; +CM143127.1 StringTie exon 1743989 1746359 1000 + . gene_id "SS.787"; transcript_id "SS.787.1"; exon_number "2"; cov "461.332611"; +CM143127.1 StringTie transcript 1743775 1746359 1000 + . gene_id "SS.787"; transcript_id "SS.787.2"; cov "81.123843"; FPKM "3.967321"; TPM "8.483508"; +CM143127.1 StringTie exon 1743775 1743826 1000 + . gene_id "SS.787"; transcript_id "SS.787.2"; exon_number "1"; cov "57.063480"; +CM143127.1 StringTie exon 1743930 1746359 1000 + . gene_id "SS.787"; transcript_id "SS.787.2"; exon_number "2"; cov "81.638718"; +CM143127.1 StringTie transcript 1743775 1746359 1000 + . gene_id "SS.787"; transcript_id "SS.787.3"; cov "68.725897"; FPKM "3.361006"; TPM "7.186995"; +CM143127.1 StringTie exon 1743775 1743826 1000 + . gene_id "SS.787"; transcript_id "SS.787.3"; exon_number "1"; cov "52.088802"; +CM143127.1 StringTie exon 1743993 1746359 1000 + . gene_id "SS.787"; transcript_id "SS.787.3"; exon_number "2"; cov "69.091393"; +CM143127.1 StringTie transcript 1750359 1754242 1000 . . gene_id "SS.788"; transcript_id "SS.788.1"; cov "1052.675335"; FPKM "51.480560"; TPM "110.083288"; +CM143127.1 StringTie exon 1750359 1754242 1000 . . gene_id "SS.788"; transcript_id "SS.788.1"; exon_number "1"; cov "1052.675293"; +CM143127.1 StringTie transcript 1755846 1757063 1000 . . gene_id "SS.789"; transcript_id "SS.789.1"; cov "1500.010673"; FPKM "73.357271"; TPM "156.863281"; +CM143127.1 StringTie exon 1755846 1757063 1000 . . gene_id "SS.789"; transcript_id "SS.789.1"; exon_number "1"; cov "1500.010620"; +CM143127.1 StringTie transcript 1757591 1762337 1000 - . gene_id "SS.790"; transcript_id "SS.790.1"; cov "139.452448"; FPKM "6.819852"; TPM "14.583209"; +CM143127.1 StringTie exon 1757591 1758951 1000 - . gene_id "SS.790"; transcript_id "SS.790.1"; exon_number "1"; cov "363.645111"; +CM143127.1 StringTie exon 1759038 1762337 1000 - . gene_id "SS.790"; transcript_id "SS.790.1"; exon_number "2"; cov "46.989956"; +CM143127.1 StringTie transcript 1759415 1763794 1000 . . gene_id "SS.791"; transcript_id "SS.791.1"; cov "462.294321"; FPKM "22.608272"; TPM "48.344325"; +CM143127.1 StringTie exon 1759415 1763794 1000 . . gene_id "SS.791"; transcript_id "SS.791.1"; exon_number "1"; cov "462.294312"; +CM143127.1 StringTie transcript 1763995 1766408 1000 . . gene_id "SS.792"; transcript_id "SS.792.1"; cov "397.010356"; FPKM "19.415593"; TPM "41.517269"; +CM143127.1 StringTie exon 1763995 1766408 1000 . . gene_id "SS.792"; transcript_id "SS.792.1"; exon_number "1"; cov "397.010345"; +CM143127.1 StringTie transcript 1766974 1768268 1000 - . gene_id "SS.793"; transcript_id "SS.793.1"; cov "14361.208333"; FPKM "702.327704"; TPM "1501.820157"; +CM143127.1 StringTie exon 1766974 1767609 1000 - . gene_id "SS.793"; transcript_id "SS.793.1"; exon_number "1"; cov "17326.933594"; +CM143127.1 StringTie exon 1768089 1768268 1000 - . gene_id "SS.793"; transcript_id "SS.793.1"; exon_number "2"; cov "3882.311035"; +CM143127.1 StringTie transcript 1768618 1771907 1000 . . gene_id "SS.794"; transcript_id "SS.794.1"; cov "290.446505"; FPKM "14.204141"; TPM "30.373378"; +CM143127.1 StringTie exon 1768618 1771907 1000 . . gene_id "SS.794"; transcript_id "SS.794.1"; exon_number "1"; cov "290.446503"; +CM143127.1 StringTie transcript 1772149 1773676 1000 . . gene_id "SS.795"; transcript_id "SS.795.1"; cov "15.786649"; FPKM "0.772038"; TPM "1.650885"; +CM143127.1 StringTie exon 1772149 1773676 1000 . . gene_id "SS.795"; transcript_id "SS.795.1"; exon_number "1"; cov "15.786649"; +CM143127.1 StringTie transcript 1774062 1780080 1000 . . gene_id "SS.796"; transcript_id "SS.796.1"; cov "567.694966"; FPKM "27.762838"; TPM "59.366574"; +CM143127.1 StringTie exon 1774062 1780080 1000 . . gene_id "SS.796"; transcript_id "SS.796.1"; exon_number "1"; cov "567.694946"; +CM143127.1 StringTie transcript 1780341 1784201 1000 . . gene_id "SS.797"; transcript_id "SS.797.1"; cov "219.098161"; FPKM "10.714886"; TPM "22.912141"; +CM143127.1 StringTie exon 1780341 1784201 1000 . . gene_id "SS.797"; transcript_id "SS.797.1"; exon_number "1"; cov "219.098160"; +CM143127.1 StringTie transcript 1784542 1787661 1000 . . gene_id "SS.798"; transcript_id "SS.798.1"; cov "1850.402564"; FPKM "90.493011"; TPM "193.505435"; +CM143127.1 StringTie exon 1784542 1787661 1000 . . gene_id "SS.798"; transcript_id "SS.798.1"; exon_number "1"; cov "1850.402588"; +CM143127.1 StringTie transcript 1788411 1789285 1000 . . gene_id "SS.799"; transcript_id "SS.799.1"; cov "2071.035429"; FPKM "101.282951"; TPM "216.578068"; +CM143127.1 StringTie exon 1788411 1789285 1000 . . gene_id "SS.799"; transcript_id "SS.799.1"; exon_number "1"; cov "2071.035400"; +CM143127.1 StringTie transcript 1790308 1791550 1000 . . gene_id "SS.800"; transcript_id "SS.800.1"; cov "567.358005"; FPKM "27.746359"; TPM "59.331337"; +CM143127.1 StringTie exon 1790308 1791550 1000 . . gene_id "SS.800"; transcript_id "SS.800.1"; exon_number "1"; cov "567.358032"; +CM143127.1 StringTie transcript 1791878 1794568 1000 . . gene_id "SS.801"; transcript_id "SS.801.1"; cov "657.781865"; FPKM "32.168493"; TPM "68.787392"; +CM143127.1 StringTie exon 1791878 1794568 1000 . . gene_id "SS.801"; transcript_id "SS.801.1"; exon_number "1"; cov "657.781860"; +CM143127.1 StringTie transcript 1794900 1802528 1000 . . gene_id "SS.802"; transcript_id "SS.802.1"; cov "396.592312"; FPKM "19.395148"; TPM "41.473553"; +CM143127.1 StringTie exon 1794900 1802528 1000 . . gene_id "SS.802"; transcript_id "SS.802.1"; exon_number "1"; cov "396.592316"; +CM143127.1 StringTie transcript 1794900 1795581 1000 + . gene_id "SS.803"; transcript_id "SS.803.1"; cov "8.261053"; FPKM "0.404003"; TPM "0.863898"; +CM143127.1 StringTie exon 1794900 1794937 1000 + . gene_id "SS.803"; transcript_id "SS.803.1"; exon_number "1"; cov "0.734462"; +CM143127.1 StringTie exon 1795075 1795581 1000 + . gene_id "SS.803"; transcript_id "SS.803.1"; exon_number "2"; cov "8.825176"; +CM143127.1 StringTie transcript 1795835 1802528 1000 - . gene_id "SS.804"; transcript_id "SS.804.1"; cov "77.178763"; FPKM "3.774389"; TPM "8.070952"; +CM143127.1 StringTie exon 1795835 1796341 1000 - . gene_id "SS.804"; transcript_id "SS.804.1"; exon_number "1"; cov "50.311321"; +CM143127.1 StringTie exon 1796458 1802528 1000 - . gene_id "SS.804"; transcript_id "SS.804.1"; exon_number "2"; cov "79.422508"; +CM143127.1 StringTie transcript 1877424 1880766 1000 . . gene_id "SS.805"; transcript_id "SS.805.1"; cov "300.530362"; FPKM "14.697287"; TPM "31.427896"; +CM143127.1 StringTie exon 1877424 1880766 1000 . . gene_id "SS.805"; transcript_id "SS.805.1"; exon_number "1"; cov "300.530365"; +CM143127.1 StringTie transcript 1802844 1804495 1000 . . gene_id "SS.806"; transcript_id "SS.806.1"; cov "8521.088983"; FPKM "416.719591"; TPM "891.090979"; +CM143127.1 StringTie exon 1802844 1804495 1000 . . gene_id "SS.806"; transcript_id "SS.806.1"; exon_number "1"; cov "8521.088867"; +CM143127.1 StringTie transcript 1805083 1810820 1000 . . gene_id "SS.807"; transcript_id "SS.807.1"; cov "863.895085"; FPKM "42.248357"; TPM "90.341636"; +CM143127.1 StringTie exon 1805083 1810820 1000 . . gene_id "SS.807"; transcript_id "SS.807.1"; exon_number "1"; cov "863.895081"; +CM143127.1 StringTie transcript 1811189 1815368 1000 + . gene_id "SS.808"; transcript_id "SS.808.1"; cov "1169.631255"; FPKM "57.200231"; TPM "122.313927"; +CM143127.1 StringTie exon 1811189 1811354 1000 + . gene_id "SS.808"; transcript_id "SS.808.1"; exon_number "1"; cov "2932.746338"; +CM143127.1 StringTie exon 1811435 1811537 1000 + . gene_id "SS.808"; transcript_id "SS.808.1"; exon_number "2"; cov "5536.092773"; +CM143127.1 StringTie exon 1811631 1815368 1000 + . gene_id "SS.808"; transcript_id "SS.808.1"; exon_number "3"; cov "971.016296"; +CM143127.1 StringTie transcript 1811189 1815368 1000 + . gene_id "SS.808"; transcript_id "SS.808.2"; cov "155.978890"; FPKM "7.628070"; TPM "16.311458"; +CM143127.1 StringTie exon 1811189 1811354 1000 + . gene_id "SS.808"; transcript_id "SS.808.2"; exon_number "1"; cov "360.880341"; +CM143127.1 StringTie exon 1811435 1815368 1000 + . gene_id "SS.808"; transcript_id "SS.808.2"; exon_number "2"; cov "147.332825"; +CM143127.1 StringTie transcript 1815693 1820333 1000 . . gene_id "SS.809"; transcript_id "SS.809.1"; cov "301.065072"; FPKM "14.723437"; TPM "31.483813"; +CM143127.1 StringTie exon 1815693 1820333 1000 . . gene_id "SS.809"; transcript_id "SS.809.1"; exon_number "1"; cov "301.065063"; +CM143127.1 StringTie transcript 1823060 1825582 1000 + . gene_id "SS.810"; transcript_id "SS.810.1"; cov "338.438568"; FPKM "16.551169"; TPM "35.392138"; +CM143127.1 StringTie exon 1823060 1823172 1000 + . gene_id "SS.810"; transcript_id "SS.810.1"; exon_number "1"; cov "92.876106"; +CM143127.1 StringTie exon 1823238 1825582 1000 + . gene_id "SS.810"; transcript_id "SS.810.1"; exon_number "2"; cov "350.271637"; +CM143127.1 StringTie transcript 1825882 1828443 1000 . . gene_id "SS.811"; transcript_id "SS.811.1"; cov "506.695550"; FPKM "24.779692"; TPM "52.987574"; +CM143127.1 StringTie exon 1825882 1828443 1000 . . gene_id "SS.811"; transcript_id "SS.811.1"; exon_number "1"; cov "506.695557"; +CM143127.1 StringTie transcript 1831362 1832161 1000 . . gene_id "SS.812"; transcript_id "SS.812.1"; cov "9512.463750"; FPKM "465.202278"; TPM "994.763774"; +CM143127.1 StringTie exon 1831362 1832161 1000 . . gene_id "SS.812"; transcript_id "SS.812.1"; exon_number "1"; cov "9512.463867"; +CM143127.1 StringTie transcript 1833959 1835700 1000 . . gene_id "SS.813"; transcript_id "SS.813.1"; cov "9415.185993"; FPKM "460.444958"; TPM "984.590974"; +CM143127.1 StringTie exon 1833959 1835700 1000 . . gene_id "SS.813"; transcript_id "SS.813.1"; exon_number "1"; cov "9415.185547"; +CM143127.1 StringTie transcript 1838983 1840307 1000 . . gene_id "SS.814"; transcript_id "SS.814.1"; cov "10142.839245"; FPKM "496.030476"; TPM "1060.685151"; +CM143127.1 StringTie exon 1838983 1840307 1000 . . gene_id "SS.814"; transcript_id "SS.814.1"; exon_number "1"; cov "10142.838867"; +CM143127.1 StringTie transcript 1843796 1848189 1000 - . gene_id "SS.815"; transcript_id "SS.815.1"; cov "282.311643"; FPKM "13.806310"; TPM "29.522677"; +CM143127.1 StringTie exon 1843796 1847896 1000 - . gene_id "SS.815"; transcript_id "SS.815.1"; exon_number "1"; cov "293.575226"; +CM143127.1 StringTie exon 1847988 1848189 1000 - . gene_id "SS.815"; transcript_id "SS.815.1"; exon_number "2"; cov "53.638615"; +CM143127.1 StringTie transcript 1848753 1855049 1000 . . gene_id "SS.816"; transcript_id "SS.816.1"; cov "693.852787"; FPKM "33.932523"; TPM "72.559500"; +CM143127.1 StringTie exon 1848753 1855049 1000 . . gene_id "SS.816"; transcript_id "SS.816.1"; exon_number "1"; cov "693.852783"; +CM143127.1 StringTie transcript 1855862 1862782 1000 . . gene_id "SS.817"; transcript_id "SS.817.1"; cov "236.502962"; FPKM "11.566059"; TPM "24.732244"; +CM143127.1 StringTie exon 1855862 1862782 1000 . . gene_id "SS.817"; transcript_id "SS.817.1"; exon_number "1"; cov "236.502960"; +CM143127.1 StringTie transcript 1863040 1866267 1000 . . gene_id "SS.818"; transcript_id "SS.818.1"; cov "184.466543"; FPKM "9.021244"; TPM "19.290548"; +CM143127.1 StringTie exon 1863040 1866267 1000 . . gene_id "SS.818"; transcript_id "SS.818.1"; exon_number "1"; cov "184.466537"; +CM143127.1 StringTie transcript 1866548 1870387 1000 . . gene_id "SS.819"; transcript_id "SS.819.1"; cov "174.764844"; FPKM "8.546787"; TPM "18.275995"; +CM143127.1 StringTie exon 1866548 1870387 1000 . . gene_id "SS.819"; transcript_id "SS.819.1"; exon_number "1"; cov "174.764847"; +CM143127.1 StringTie transcript 1870718 1876053 1000 . . gene_id "SS.820"; transcript_id "SS.820.1"; cov "140.848013"; FPKM "6.888102"; TPM "14.729150"; +CM143127.1 StringTie exon 1870718 1876053 1000 . . gene_id "SS.820"; transcript_id "SS.820.1"; exon_number "1"; cov "140.848007"; +CM143127.1 StringTie transcript 1894132 1894856 1000 . . gene_id "SS.821"; transcript_id "SS.821.1"; cov "6195.841379"; FPKM "303.004521"; TPM "647.928730"; +CM143127.1 StringTie exon 1894132 1894856 1000 . . gene_id "SS.821"; transcript_id "SS.821.1"; exon_number "1"; cov "6195.841309"; +CM143127.1 StringTie transcript 1900235 1903042 1000 . . gene_id "SS.822"; transcript_id "SS.822.1"; cov "1654.067664"; FPKM "80.891351"; TPM "172.973757"; +CM143127.1 StringTie exon 1900235 1903042 1000 . . gene_id "SS.822"; transcript_id "SS.822.1"; exon_number "1"; cov "1654.067627"; +CM143127.1 StringTie transcript 1904356 1908823 1000 . . gene_id "SS.823"; transcript_id "SS.823.1"; cov "326.102842"; FPKM "15.947896"; TPM "34.102132"; +CM143127.1 StringTie exon 1904356 1908823 1000 . . gene_id "SS.823"; transcript_id "SS.823.1"; exon_number "1"; cov "326.102844"; +CM143127.1 StringTie transcript 1904356 1908782 1000 + . gene_id "SS.824"; transcript_id "SS.824.1"; cov "124.222934"; FPKM "6.075060"; TPM "12.990586"; +CM143127.1 StringTie exon 1904356 1906521 1000 + . gene_id "SS.824"; transcript_id "SS.824.1"; exon_number "1"; cov "20.715631"; +CM143127.1 StringTie exon 1906663 1908782 1000 + . gene_id "SS.824"; transcript_id "SS.824.1"; exon_number "2"; cov "229.976151"; +CM143127.1 StringTie transcript 1920739 1923519 1000 . . gene_id "SS.825"; transcript_id "SS.825.1"; cov "3478.986336"; FPKM "170.138085"; TPM "363.814220"; +CM143127.1 StringTie exon 1920739 1923519 1000 . . gene_id "SS.825"; transcript_id "SS.825.1"; exon_number "1"; cov "3478.986328"; +CM143127.1 StringTie transcript 1924205 1924886 1000 . . gene_id "SS.826"; transcript_id "SS.826.1"; cov "917.042522"; FPKM "44.847505"; TPM "95.899517"; +CM143127.1 StringTie exon 1924205 1924886 1000 . . gene_id "SS.826"; transcript_id "SS.826.1"; exon_number "1"; cov "917.042542"; +CM143127.1 StringTie transcript 1925406 1930129 1000 . . gene_id "SS.827"; transcript_id "SS.827.1"; cov "325.062447"; FPKM "15.897016"; TPM "33.993333"; +CM143127.1 StringTie exon 1925406 1930129 1000 . . gene_id "SS.827"; transcript_id "SS.827.1"; exon_number "1"; cov "325.062439"; +CM143127.1 StringTie transcript 1937580 1938646 1000 + . gene_id "SS.828"; transcript_id "SS.828.1"; cov "16576.576205"; FPKM "810.669161"; TPM "1733.491758"; +CM143127.1 StringTie exon 1937580 1937631 1000 + . gene_id "SS.828"; transcript_id "SS.828.1"; exon_number "1"; cov "1682.932739"; +CM143127.1 StringTie exon 1938056 1938646 1000 + . gene_id "SS.828"; transcript_id "SS.828.1"; exon_number "2"; cov "17887.015625"; +CM143127.1 StringTie transcript 1941284 1944907 1000 . . gene_id "SS.829"; transcript_id "SS.829.1"; cov "2107.405905"; FPKM "103.061631"; TPM "220.381502"; +CM143127.1 StringTie exon 1941284 1944907 1000 . . gene_id "SS.829"; transcript_id "SS.829.1"; exon_number "1"; cov "2107.406006"; +CM143127.1 StringTie transcript 1945215 1953369 1000 + . gene_id "SS.830"; transcript_id "SS.830.1"; cov "590.122567"; FPKM "28.859649"; TPM "61.711936"; +CM143127.1 StringTie exon 1945215 1951395 1000 + . gene_id "SS.830"; transcript_id "SS.830.1"; exon_number "1"; cov "701.948730"; +CM143127.1 StringTie exon 1951486 1953369 1000 + . gene_id "SS.830"; transcript_id "SS.830.1"; exon_number "2"; cov "223.244965"; +CM143127.1 StringTie transcript 1955750 1959474 1000 . . gene_id "SS.831"; transcript_id "SS.831.1"; cov "991.110537"; FPKM "48.469765"; TPM "103.645163"; +CM143127.1 StringTie exon 1955750 1959474 1000 . . gene_id "SS.831"; transcript_id "SS.831.1"; exon_number "1"; cov "991.110535"; +CM143127.1 StringTie transcript 1959729 1965850 1000 . . gene_id "SS.832"; transcript_id "SS.832.1"; cov "922.593270"; FPKM "45.118962"; TPM "96.479985"; +CM143127.1 StringTie exon 1959729 1965850 1000 . . gene_id "SS.832"; transcript_id "SS.832.1"; exon_number "1"; cov "922.593262"; +CM143127.1 StringTie transcript 1971116 1971806 1000 - . gene_id "SS.833"; transcript_id "SS.833.1"; cov "2410.363636"; FPKM "117.877627"; TPM "252.063239"; +CM143127.1 StringTie exon 1971116 1971617 1000 - . gene_id "SS.833"; transcript_id "SS.833.1"; exon_number "1"; cov "2694.417236"; +CM143127.1 StringTie exon 1971715 1971806 1000 - . gene_id "SS.833"; transcript_id "SS.833.1"; exon_number "2"; cov "860.418457"; +CM143127.1 StringTie transcript 1987347 1990368 1000 . . gene_id "SS.834"; transcript_id "SS.834.1"; cov "1569.656519"; FPKM "76.763266"; TPM "164.146480"; +CM143127.1 StringTie exon 1987347 1990368 1000 . . gene_id "SS.834"; transcript_id "SS.834.1"; exon_number "1"; cov "1569.656494"; +CM143127.1 StringTie transcript 1997562 1998617 1000 - . gene_id "SS.835"; transcript_id "SS.835.1"; cov "22567.778970"; FPKM "1103.665933"; TPM "2360.020450"; +CM143127.1 StringTie exon 1997562 1997971 1000 - . gene_id "SS.835"; transcript_id "SS.835.1"; exon_number "1"; cov "25416.669922"; +CM143127.1 StringTie exon 1998562 1998617 1000 - . gene_id "SS.835"; transcript_id "SS.835.1"; exon_number "2"; cov "1709.821411"; +CM143127.1 StringTie transcript 1999172 2007513 1000 . . gene_id "SS.836"; transcript_id "SS.836.1"; cov "1702.089307"; FPKM "83.239825"; TPM "177.995609"; +CM143127.1 StringTie exon 1999172 2007513 1000 . . gene_id "SS.836"; transcript_id "SS.836.1"; exon_number "1"; cov "1702.089355"; +CM143127.1 StringTie transcript 2009535 2010493 1000 . . gene_id "SS.837"; transcript_id "SS.837.1"; cov "2136.399374"; FPKM "104.479542"; TPM "223.413488"; +CM143127.1 StringTie exon 2009535 2010493 1000 . . gene_id "SS.837"; transcript_id "SS.837.1"; exon_number "1"; cov "2136.399414"; +CM143127.1 StringTie transcript 2012196 2016855 1000 . . gene_id "SS.838"; transcript_id "SS.838.1"; cov "543.874034"; FPKM "26.597887"; TPM "56.875506"; +CM143127.1 StringTie exon 2012196 2016855 1000 . . gene_id "SS.838"; transcript_id "SS.838.1"; exon_number "1"; cov "543.874023"; +CM143127.1 StringTie transcript 2017129 2018312 1000 + . gene_id "SS.839"; transcript_id "SS.839.1"; cov "1295.944696"; FPKM "63.377527"; TPM "135.523127"; +CM143127.1 StringTie exon 2017129 2017188 1000 + . gene_id "SS.839"; transcript_id "SS.839.1"; exon_number "1"; cov "367.166656"; +CM143127.1 StringTie exon 2017270 2018312 1000 + . gene_id "SS.839"; transcript_id "SS.839.1"; exon_number "2"; cov "1349.373901"; +CM143127.1 StringTie transcript 2041867 2042643 1000 . . gene_id "SS.840"; transcript_id "SS.840.1"; cov "15.985843"; FPKM "0.781780"; TPM "1.671716"; +CM143127.1 StringTie exon 2041867 2042643 1000 . . gene_id "SS.840"; transcript_id "SS.840.1"; exon_number "1"; cov "15.985843"; +CM143127.1 StringTie transcript 2018607 2020811 1000 - . gene_id "SS.841"; transcript_id "SS.841.1"; cov "676.480815"; FPKM "33.082956"; TPM "70.742830"; +CM143127.1 StringTie exon 2018607 2020439 1000 - . gene_id "SS.841"; transcript_id "SS.841.1"; exon_number "1"; cov "216.134201"; +CM143127.1 StringTie exon 2020534 2020811 1000 - . gene_id "SS.841"; transcript_id "SS.841.1"; exon_number "2"; cov "3711.787842"; +CM143127.1 StringTie transcript 2031840 2034824 1000 + . gene_id "SS.842"; transcript_id "SS.842.1"; cov "631.147110"; FPKM "30.865933"; TPM "66.002068"; +CM143127.1 StringTie exon 2031840 2032543 1000 + . gene_id "SS.842"; transcript_id "SS.842.1"; exon_number "1"; cov "26.225853"; +CM143127.1 StringTie exon 2032674 2034824 1000 + . gene_id "SS.842"; transcript_id "SS.842.1"; exon_number "2"; cov "829.131592"; +CM143127.1 StringTie transcript 2035164 2035963 1000 . . gene_id "SS.843"; transcript_id "SS.843.1"; cov "4840.325000"; FPKM "236.713671"; TPM "506.175907"; +CM143127.1 StringTie exon 2035164 2035963 1000 . . gene_id "SS.843"; transcript_id "SS.843.1"; exon_number "1"; cov "4840.325195"; +CM143127.1 StringTie transcript 2036377 2041356 1000 . . gene_id "SS.844"; transcript_id "SS.844.1"; cov "199.337751"; FPKM "9.748513"; TPM "20.845701"; +CM143127.1 StringTie exon 2036377 2041356 1000 . . gene_id "SS.844"; transcript_id "SS.844.1"; exon_number "1"; cov "199.337753"; +CM143127.1 StringTie transcript 2044068 2046323 1000 . . gene_id "SS.845"; transcript_id "SS.845.1"; cov "2263.562500"; FPKM "110.698391"; TPM "236.711543"; +CM143127.1 StringTie exon 2044068 2046323 1000 . . gene_id "SS.845"; transcript_id "SS.845.1"; exon_number "1"; cov "2263.562500"; +CM143127.1 StringTie transcript 2046682 2048818 1000 . . gene_id "SS.846"; transcript_id "SS.846.1"; cov "249.194197"; FPKM "12.186717"; TPM "26.059428"; +CM143127.1 StringTie exon 2046682 2048818 1000 . . gene_id "SS.846"; transcript_id "SS.846.1"; exon_number "1"; cov "249.194199"; +CM143127.1 StringTie transcript 2049157 2052441 1000 . . gene_id "SS.847"; transcript_id "SS.847.1"; cov "260.156260"; FPKM "12.722812"; TPM "27.205783"; +CM143127.1 StringTie exon 2049157 2052441 1000 . . gene_id "SS.847"; transcript_id "SS.847.1"; exon_number "1"; cov "260.156250"; +CM143127.1 StringTie transcript 2049157 2054649 1000 + . gene_id "SS.848"; transcript_id "SS.848.1"; cov "58.434440"; FPKM "2.857707"; TPM "6.110769"; +CM143127.1 StringTie exon 2049157 2053441 1000 + . gene_id "SS.848"; transcript_id "SS.848.1"; exon_number "1"; cov "62.169353"; +CM143127.1 StringTie exon 2053510 2053783 1000 + . gene_id "SS.848"; transcript_id "SS.848.1"; exon_number "2"; cov "38.233578"; +CM143127.1 StringTie exon 2053858 2054649 1000 + . gene_id "SS.848"; transcript_id "SS.848.1"; exon_number "3"; cov "45.215908"; +CM143127.1 StringTie transcript 2055002 2058167 1000 - . gene_id "SS.849"; transcript_id "SS.849.1"; cov "357.350491"; FPKM "17.476047"; TPM "37.369848"; +CM143127.1 StringTie exon 2055002 2058043 1000 - . gene_id "SS.849"; transcript_id "SS.849.1"; exon_number "1"; cov "361.582520"; +CM143127.1 StringTie exon 2058130 2058167 1000 - . gene_id "SS.849"; transcript_id "SS.849.1"; exon_number "2"; cov "18.566141"; +CM143127.1 StringTie transcript 2055002 2058167 1000 - . gene_id "SS.849"; transcript_id "SS.849.2"; cov "234.840940"; FPKM "11.484779"; TPM "24.558439"; +CM143127.1 StringTie exon 2055002 2058059 1000 - . gene_id "SS.849"; transcript_id "SS.849.2"; exon_number "1"; cov "237.606949"; +CM143127.1 StringTie exon 2058130 2058167 1000 - . gene_id "SS.849"; transcript_id "SS.849.2"; exon_number "2"; cov "12.249647"; +CM143127.1 StringTie transcript 2058495 2060379 1000 + . gene_id "SS.850"; transcript_id "SS.850.1"; cov "857.094718"; FPKM "41.915788"; TPM "89.630489"; +CM143127.1 StringTie exon 2058495 2059675 1000 + . gene_id "SS.850"; transcript_id "SS.850.1"; exon_number "1"; cov "131.595261"; +CM143127.1 StringTie exon 2059798 2059936 1000 + . gene_id "SS.850"; transcript_id "SS.850.1"; exon_number "2"; cov "2760.740967"; +CM143127.1 StringTie exon 2060053 2060379 1000 + . gene_id "SS.850"; transcript_id "SS.850.1"; exon_number "3"; cov "2668.128418"; +CM143127.1 StringTie transcript 2061498 2064840 1000 - . gene_id "SS.851"; transcript_id "SS.851.1"; cov "392.715087"; FPKM "19.205535"; TPM "41.068093"; +CM143127.1 StringTie exon 2061498 2062173 1000 - . gene_id "SS.851"; transcript_id "SS.851.1"; exon_number "1"; cov "33.061550"; +CM143127.1 StringTie exon 2062620 2064840 1000 - . gene_id "SS.851"; transcript_id "SS.851.1"; exon_number "2"; cov "502.181915"; +CM143127.1 StringTie transcript 2066912 2067704 1000 . . gene_id "SS.852"; transcript_id "SS.852.1"; cov "3301.060530"; FPKM "161.436713"; TPM "345.207668"; +CM143127.1 StringTie exon 2066912 2067704 1000 . . gene_id "SS.852"; transcript_id "SS.852.1"; exon_number "1"; cov "3301.060547"; +CM143127.1 StringTie transcript 2085959 2087599 1000 . . gene_id "SS.853"; transcript_id "SS.853.1"; cov "1938.815356"; FPKM "94.816794"; TPM "202.751183"; +CM143127.1 StringTie exon 2085959 2087599 1000 . . gene_id "SS.853"; transcript_id "SS.853.1"; exon_number "1"; cov "1938.815308"; +CM143127.1 StringTie transcript 2087940 2089423 1000 + . gene_id "SS.854"; transcript_id "SS.854.1"; cov "1665.445059"; FPKM "81.447757"; TPM "174.163545"; +CM143127.1 StringTie exon 2087940 2088035 1000 + . gene_id "SS.854"; transcript_id "SS.854.1"; exon_number "1"; cov "367.927094"; +CM143127.1 StringTie exon 2088255 2089423 1000 + . gene_id "SS.854"; transcript_id "SS.854.1"; exon_number "2"; cov "1771.999146"; +CM143127.1 StringTie transcript 2142170 2143405 1000 . . gene_id "SS.855"; transcript_id "SS.855.1"; cov "486.839806"; FPKM "23.808657"; TPM "50.911164"; +CM143127.1 StringTie exon 2142170 2143405 1000 . . gene_id "SS.855"; transcript_id "SS.855.1"; exon_number "1"; cov "486.839813"; +CM143127.1 StringTie transcript 2143774 2145458 1000 . . gene_id "SS.856"; transcript_id "SS.856.1"; cov "493.303264"; FPKM "24.124749"; TPM "51.587079"; +CM143127.1 StringTie exon 2143774 2145458 1000 . . gene_id "SS.856"; transcript_id "SS.856.1"; exon_number "1"; cov "493.303253"; +CM143127.1 StringTie transcript 2146376 2149994 1000 . . gene_id "SS.857"; transcript_id "SS.857.1"; cov "371.648245"; FPKM "18.175271"; TPM "38.865032"; +CM143127.1 StringTie exon 2146376 2149994 1000 . . gene_id "SS.857"; transcript_id "SS.857.1"; exon_number "1"; cov "371.648254"; +CM143127.1 StringTie transcript 2097849 2108017 1000 . . gene_id "SS.858"; transcript_id "SS.858.1"; cov "1097.718556"; FPKM "53.683376"; TPM "114.793673"; +CM143127.1 StringTie exon 2097849 2108017 1000 . . gene_id "SS.858"; transcript_id "SS.858.1"; exon_number "1"; cov "1097.718506"; +CM143127.1 StringTie transcript 2108761 2110900 1000 . . gene_id "SS.859"; transcript_id "SS.859.1"; cov "2194.240187"; FPKM "107.308218"; TPM "229.462178"; +CM143127.1 StringTie exon 2108761 2110900 1000 . . gene_id "SS.859"; transcript_id "SS.859.1"; exon_number "1"; cov "2194.240234"; +CM143127.1 StringTie transcript 2118377 2121027 1000 - . gene_id "SS.860"; transcript_id "SS.860.1"; cov "368.433850"; FPKM "18.018073"; TPM "38.528888"; +CM143127.1 StringTie exon 2118377 2119916 1000 - . gene_id "SS.860"; transcript_id "SS.860.1"; exon_number "1"; cov "351.578583"; +CM143127.1 StringTie exon 2120051 2121027 1000 - . gene_id "SS.860"; transcript_id "SS.860.1"; exon_number "2"; cov "395.002045"; +CM143127.1 StringTie transcript 2125708 2128066 1000 . . gene_id "SS.861"; transcript_id "SS.861.1"; cov "1737.332768"; FPKM "84.963389"; TPM "181.681187"; +CM143127.1 StringTie exon 2125708 2128066 1000 . . gene_id "SS.861"; transcript_id "SS.861.1"; exon_number "1"; cov "1737.332764"; +CM143127.1 StringTie transcript 2128794 2134856 1000 . . gene_id "SS.862"; transcript_id "SS.862.1"; cov "178.445324"; FPKM "8.726779"; TPM "18.660880"; +CM143127.1 StringTie exon 2128794 2134856 1000 . . gene_id "SS.862"; transcript_id "SS.862.1"; exon_number "1"; cov "178.445328"; +CM143127.1 StringTie transcript 2135088 2141622 1000 . . gene_id "SS.863"; transcript_id "SS.863.1"; cov "389.800421"; FPKM "19.062994"; TPM "40.763292"; +CM143127.1 StringTie exon 2135088 2141622 1000 . . gene_id "SS.863"; transcript_id "SS.863.1"; exon_number "1"; cov "389.800415"; +CM143127.1 StringTie transcript 2135138 2141622 1000 - . gene_id "SS.864"; transcript_id "SS.864.1"; cov "112.415231"; FPKM "5.497611"; TPM "11.755798"; +CM143127.1 StringTie exon 2135138 2138094 1000 - . gene_id "SS.864"; transcript_id "SS.864.1"; exon_number "1"; cov "94.253326"; +CM143127.1 StringTie exon 2138609 2141622 1000 - . gene_id "SS.864"; transcript_id "SS.864.1"; exon_number "2"; cov "130.233658"; +CM143127.1 StringTie transcript 2150918 2153296 1000 . . gene_id "SS.865"; transcript_id "SS.865.1"; cov "16628.085750"; FPKM "813.188210"; TPM "1738.878357"; +CM143127.1 StringTie exon 2150918 2153296 1000 . . gene_id "SS.865"; transcript_id "SS.865.1"; exon_number "1"; cov "16628.085938"; +CM143127.1 StringTie transcript 2153896 2155205 1000 . . gene_id "SS.866"; transcript_id "SS.866.1"; cov "386.358779"; FPKM "18.894683"; TPM "40.403383"; +CM143127.1 StringTie exon 2153896 2155205 1000 . . gene_id "SS.866"; transcript_id "SS.866.1"; exon_number "1"; cov "386.358765"; +CM143127.1 StringTie transcript 2155501 2159305 1000 . . gene_id "SS.867"; transcript_id "SS.867.1"; cov "160.558739"; FPKM "7.852045"; TPM "16.790394"; +CM143127.1 StringTie exon 2155501 2159305 1000 . . gene_id "SS.867"; transcript_id "SS.867.1"; exon_number "1"; cov "160.558731"; +CM143127.1 StringTie transcript 2159463 2179389 1000 . . gene_id "SS.868"; transcript_id "SS.868.1"; cov "83.261448"; FPKM "4.071859"; TPM "8.707047"; +CM143127.1 StringTie exon 2159463 2179389 1000 . . gene_id "SS.868"; transcript_id "SS.868.1"; exon_number "1"; cov "83.261452"; +CM143127.1 StringTie transcript 2164332 2179389 1000 - . gene_id "SS.869"; transcript_id "SS.869.1"; cov "26.598405"; FPKM "1.300782"; TPM "2.781522"; +CM143127.1 StringTie exon 2164332 2165890 1000 - . gene_id "SS.869"; transcript_id "SS.869.1"; exon_number "1"; cov "50.028294"; +CM143127.1 StringTie exon 2168091 2179389 1000 - . gene_id "SS.869"; transcript_id "SS.869.1"; exon_number "2"; cov "23.365623"; +CM143127.1 StringTie transcript 2179770 2184839 1000 + . gene_id "SS.870"; transcript_id "SS.870.1"; cov "254.535679"; FPKM "12.447940"; TPM "26.618012"; +CM143127.1 StringTie exon 2179770 2180589 1000 + . gene_id "SS.870"; transcript_id "SS.870.1"; exon_number "1"; cov "127.331711"; +CM143127.1 StringTie exon 2180657 2184839 1000 + . gene_id "SS.870"; transcript_id "SS.870.1"; exon_number "2"; cov "279.471680"; +CM143127.1 StringTie transcript 2185107 2191129 1000 - . gene_id "SS.871"; transcript_id "SS.871.1"; cov "975.963062"; FPKM "47.728985"; TPM "102.061119"; +CM143127.1 StringTie exon 2185107 2188808 1000 - . gene_id "SS.871"; transcript_id "SS.871.1"; exon_number "1"; cov "1309.397095"; +CM143127.1 StringTie exon 2188876 2191129 1000 - . gene_id "SS.871"; transcript_id "SS.871.1"; exon_number "2"; cov "428.326538"; +CM143127.1 StringTie transcript 2191925 2198464 1000 . . gene_id "SS.872"; transcript_id "SS.872.1"; cov "266.933180"; FPKM "13.054234"; TPM "27.914478"; +CM143127.1 StringTie exon 2191925 2198464 1000 . . gene_id "SS.872"; transcript_id "SS.872.1"; exon_number "1"; cov "266.933167"; +CM143127.1 StringTie transcript 2198692 2200706 1000 . . gene_id "SS.873"; transcript_id "SS.873.1"; cov "757.572705"; FPKM "37.048714"; TPM "79.222997"; +CM143127.1 StringTie exon 2198692 2200706 1000 . . gene_id "SS.873"; transcript_id "SS.873.1"; exon_number "1"; cov "757.572693"; +CM143127.1 StringTie transcript 2200947 2201747 1000 . . gene_id "SS.874"; transcript_id "SS.874.1"; cov "2100.968789"; FPKM "102.746827"; TPM "219.708342"; +CM143127.1 StringTie exon 2200947 2201747 1000 . . gene_id "SS.874"; transcript_id "SS.874.1"; exon_number "1"; cov "2100.968750"; +CM143127.1 StringTie transcript 2202056 2207729 1000 . . gene_id "SS.875"; transcript_id "SS.875.1"; cov "600.019034"; FPKM "29.343630"; TPM "62.746857"; +CM143127.1 StringTie exon 2202056 2207729 1000 . . gene_id "SS.875"; transcript_id "SS.875.1"; exon_number "1"; cov "600.019043"; +CM143127.1 StringTie transcript 2209898 2211139 1000 . . gene_id "SS.876"; transcript_id "SS.876.1"; cov "1680.143317"; FPKM "82.166568"; TPM "175.700612"; +CM143127.1 StringTie exon 2209898 2211139 1000 . . gene_id "SS.876"; transcript_id "SS.876.1"; exon_number "1"; cov "1680.143311"; +CM143127.1 StringTie transcript 2212463 2214900 1000 . . gene_id "SS.877"; transcript_id "SS.877.1"; cov "3901.112797"; FPKM "190.781968"; TPM "407.958000"; +CM143127.1 StringTie exon 2212463 2214900 1000 . . gene_id "SS.877"; transcript_id "SS.877.1"; exon_number "1"; cov "3901.112793"; +CM143127.1 StringTie transcript 2216354 2217299 1000 . . gene_id "SS.878"; transcript_id "SS.878.1"; cov "4470.299154"; FPKM "218.617742"; TPM "467.480537"; +CM143127.1 StringTie exon 2216354 2217299 1000 . . gene_id "SS.878"; transcript_id "SS.878.1"; exon_number "1"; cov "4470.299316"; +CM143127.1 StringTie transcript 2218960 2224951 1000 . . gene_id "SS.879"; transcript_id "SS.879.1"; cov "987.582777"; FPKM "48.297241"; TPM "103.276249"; +CM143127.1 StringTie exon 2218960 2224951 1000 . . gene_id "SS.879"; transcript_id "SS.879.1"; exon_number "1"; cov "987.582764"; +CM143127.1 StringTie transcript 2225280 2226823 1000 . . gene_id "SS.880"; transcript_id "SS.880.1"; cov "4668.347150"; FPKM "228.303180"; TPM "488.191362"; +CM143127.1 StringTie exon 2225280 2226823 1000 . . gene_id "SS.880"; transcript_id "SS.880.1"; exon_number "1"; cov "4668.347168"; +CM143127.1 StringTie transcript 2227147 2228517 1000 . . gene_id "SS.881"; transcript_id "SS.881.1"; cov "2523.746171"; FPKM "123.422543"; TPM "263.920193"; +CM143127.1 StringTie exon 2227147 2228517 1000 . . gene_id "SS.881"; transcript_id "SS.881.1"; exon_number "1"; cov "2523.746094"; +CM143127.1 StringTie transcript 2229043 2230855 1000 . . gene_id "SS.882"; transcript_id "SS.882.1"; cov "642.841699"; FPKM "31.437851"; TPM "67.225027"; +CM143127.1 StringTie exon 2229043 2230855 1000 . . gene_id "SS.882"; transcript_id "SS.882.1"; exon_number "1"; cov "642.841675"; +CM143127.1 StringTie transcript 2231214 2235085 1000 . . gene_id "SS.883"; transcript_id "SS.883.1"; cov "429.637655"; FPKM "21.011214"; TPM "44.929262"; +CM143127.1 StringTie exon 2231214 2235085 1000 . . gene_id "SS.883"; transcript_id "SS.883.1"; exon_number "1"; cov "429.637665"; +CM143127.1 StringTie transcript 2237797 2242015 1000 . . gene_id "SS.884"; transcript_id "SS.884.1"; cov "11078.781702"; FPKM "541.802273"; TPM "1158.561124"; +CM143127.1 StringTie exon 2237797 2242015 1000 . . gene_id "SS.884"; transcript_id "SS.884.1"; exon_number "1"; cov "11078.781250"; +CM143127.1 StringTie transcript 2243014 2244085 1000 . . gene_id "SS.885"; transcript_id "SS.885.1"; cov "55.283582"; FPKM "2.703616"; TPM "5.781268"; +CM143127.1 StringTie exon 2243014 2244085 1000 . . gene_id "SS.885"; transcript_id "SS.885.1"; exon_number "1"; cov "55.283581"; +CM143127.1 StringTie transcript 2244314 2249732 1000 . . gene_id "SS.886"; transcript_id "SS.886.1"; cov "382.326444"; FPKM "18.697483"; TPM "39.981703"; +CM143127.1 StringTie exon 2244314 2249732 1000 . . gene_id "SS.886"; transcript_id "SS.886.1"; exon_number "1"; cov "382.326447"; +CM143127.1 StringTie transcript 2249966 2255183 1000 . . gene_id "SS.887"; transcript_id "SS.887.1"; cov "1899.632235"; FPKM "92.900563"; TPM "198.653617"; +CM143127.1 StringTie exon 2249966 2255183 1000 . . gene_id "SS.887"; transcript_id "SS.887.1"; exon_number "1"; cov "1899.632202"; +CM143127.1 StringTie transcript 2255526 2257938 1000 . . gene_id "SS.888"; transcript_id "SS.888.1"; cov "1617.001243"; FPKM "79.078636"; TPM "169.097544"; +CM143127.1 StringTie exon 2255526 2257938 1000 . . gene_id "SS.888"; transcript_id "SS.888.1"; exon_number "1"; cov "1617.001221"; +CM143127.1 StringTie transcript 2258641 2259988 1000 . . gene_id "SS.889"; transcript_id "SS.889.1"; cov "5834.973294"; FPKM "285.356448"; TPM "610.191030"; +CM143127.1 StringTie exon 2258641 2259988 1000 . . gene_id "SS.889"; transcript_id "SS.889.1"; exon_number "1"; cov "5834.973145"; +CM143127.1 StringTie transcript 2261052 2263442 1000 . . gene_id "SS.890"; transcript_id "SS.890.1"; cov "2744.602258"; FPKM "134.223399"; TPM "287.016169"; +CM143127.1 StringTie exon 2261052 2263442 1000 . . gene_id "SS.890"; transcript_id "SS.890.1"; exon_number "1"; cov "2744.602295"; +CM143127.1 StringTie transcript 2264192 2265276 1000 . . gene_id "SS.891"; transcript_id "SS.891.1"; cov "1324.535484"; FPKM "64.775745"; TPM "138.513003"; +CM143127.1 StringTie exon 2264192 2265276 1000 . . gene_id "SS.891"; transcript_id "SS.891.1"; exon_number "1"; cov "1324.535522"; +CM143127.1 StringTie transcript 2265927 2266323 1000 . . gene_id "SS.892"; transcript_id "SS.892.1"; cov "5.362720"; FPKM "0.262261"; TPM "0.560805"; +CM143127.1 StringTie exon 2265927 2266323 1000 . . gene_id "SS.892"; transcript_id "SS.892.1"; exon_number "1"; cov "5.362720"; +CM143127.1 StringTie transcript 2266724 2268858 1000 . . gene_id "SS.893"; transcript_id "SS.893.1"; cov "173.597658"; FPKM "8.489707"; TPM "18.153936"; +CM143127.1 StringTie exon 2266724 2268858 1000 . . gene_id "SS.893"; transcript_id "SS.893.1"; exon_number "1"; cov "173.597656"; +CM143127.1 StringTie transcript 2269207 2270829 1000 . . gene_id "SS.894"; transcript_id "SS.894.1"; cov "603.157116"; FPKM "29.497097"; TPM "63.075021"; +CM143127.1 StringTie exon 2269207 2270829 1000 . . gene_id "SS.894"; transcript_id "SS.894.1"; exon_number "1"; cov "603.157104"; +CM143127.1 StringTie transcript 2271064 2273818 1000 . . gene_id "SS.895"; transcript_id "SS.895.1"; cov "132.524138"; FPKM "6.481027"; TPM "13.858682"; +CM143127.1 StringTie exon 2271064 2273818 1000 . . gene_id "SS.895"; transcript_id "SS.895.1"; exon_number "1"; cov "132.524139"; +CM143127.1 StringTie transcript 2317746 2326178 1000 . . gene_id "SS.896"; transcript_id "SS.896.1"; cov "508.422507"; FPKM "24.864148"; TPM "53.168170"; +CM143127.1 StringTie exon 2317746 2326178 1000 . . gene_id "SS.896"; transcript_id "SS.896.1"; exon_number "1"; cov "508.422516"; +CM143127.1 StringTie transcript 2274846 2276107 1000 . . gene_id "SS.897"; transcript_id "SS.897.1"; cov "7060.357369"; FPKM "345.283243"; TPM "738.335296"; +CM143127.1 StringTie exon 2274846 2276107 1000 . . gene_id "SS.897"; transcript_id "SS.897.1"; exon_number "1"; cov "7060.357422"; +CM143127.1 StringTie transcript 2276509 2276976 1000 . . gene_id "SS.898"; transcript_id "SS.898.1"; cov "5516.427350"; FPKM "269.778118"; TPM "576.879159"; +CM143127.1 StringTie exon 2276509 2276976 1000 . . gene_id "SS.898"; transcript_id "SS.898.1"; exon_number "1"; cov "5516.427246"; +CM143127.1 StringTie transcript 2278184 2287156 1000 . . gene_id "SS.899"; transcript_id "SS.899.1"; cov "678.760392"; FPKM "33.194437"; TPM "70.981217"; +CM143127.1 StringTie exon 2278184 2287156 1000 . . gene_id "SS.899"; transcript_id "SS.899.1"; exon_number "1"; cov "678.760376"; +CM143127.1 StringTie transcript 2278184 2300804 1000 + . gene_id "SS.900"; transcript_id "SS.900.1"; cov "171.266890"; FPKM "8.375722"; TPM "17.910197"; +CM143127.1 StringTie exon 2278184 2289446 1000 + . gene_id "SS.900"; transcript_id "SS.900.1"; exon_number "1"; cov "65.504349"; +CM143127.1 StringTie exon 2289531 2289609 1000 + . gene_id "SS.900"; transcript_id "SS.900.1"; exon_number "2"; cov "90.938622"; +CM143127.1 StringTie exon 2289697 2290281 1000 + . gene_id "SS.900"; transcript_id "SS.900.1"; exon_number "3"; cov "56.128052"; +CM143127.1 StringTie exon 2290352 2300804 1000 + . gene_id "SS.900"; transcript_id "SS.900.1"; exon_number "4"; cov "292.275757"; +CM143127.1 StringTie transcript 2278184 2300804 1000 + . gene_id "SS.900"; transcript_id "SS.900.2"; cov "139.246064"; FPKM "6.809759"; TPM "14.561626"; +CM143127.1 StringTie exon 2278184 2289446 1000 + . gene_id "SS.900"; transcript_id "SS.900.2"; exon_number "1"; cov "53.204868"; +CM143127.1 StringTie exon 2289531 2289757 1000 + . gene_id "SS.900"; transcript_id "SS.900.2"; exon_number "2"; cov "71.138535"; +CM143127.1 StringTie exon 2289849 2290144 1000 + . gene_id "SS.900"; transcript_id "SS.900.2"; exon_number "3"; cov "37.495960"; +CM143127.1 StringTie exon 2290219 2300804 1000 + . gene_id "SS.900"; transcript_id "SS.900.2"; exon_number "4"; cov "235.095337"; +CM143127.1 StringTie transcript 2287931 2300677 1000 + . gene_id "SS.900"; transcript_id "SS.900.3"; cov "144.071642"; FPKM "7.045752"; TPM "15.066260"; +CM143127.1 StringTie exon 2287931 2289446 1000 + . gene_id "SS.900"; transcript_id "SS.900.3"; exon_number "1"; cov "13.539207"; +CM143127.1 StringTie exon 2289526 2290144 1000 + . gene_id "SS.900"; transcript_id "SS.900.3"; exon_number "2"; cov "38.248653"; +CM143127.1 StringTie exon 2290219 2290281 1000 + . gene_id "SS.900"; transcript_id "SS.900.3"; exon_number "3"; cov "40.627239"; +CM143127.1 StringTie exon 2290352 2300677 1000 + . gene_id "SS.900"; transcript_id "SS.900.3"; exon_number "4"; cov "170.210373"; +CM143127.1 StringTie transcript 2287931 2300677 1000 + . gene_id "SS.900"; transcript_id "SS.900.4"; cov "137.574515"; FPKM "6.728013"; TPM "14.386824"; +CM143127.1 StringTie exon 2287931 2289446 1000 + . gene_id "SS.900"; transcript_id "SS.900.4"; exon_number "1"; cov "12.808279"; +CM143127.1 StringTie exon 2289526 2289609 1000 + . gene_id "SS.900"; transcript_id "SS.900.4"; exon_number "2"; cov "52.239037"; +CM143127.1 StringTie exon 2289697 2289757 1000 + . gene_id "SS.900"; transcript_id "SS.900.4"; exon_number "3"; cov "34.813309"; +CM143127.1 StringTie exon 2289849 2290144 1000 + . gene_id "SS.900"; transcript_id "SS.900.4"; exon_number "4"; cov "25.127392"; +CM143127.1 StringTie exon 2290219 2290281 1000 + . gene_id "SS.900"; transcript_id "SS.900.4"; exon_number "5"; cov "38.433933"; +CM143127.1 StringTie exon 2290352 2300677 1000 + . gene_id "SS.900"; transcript_id "SS.900.4"; exon_number "6"; cov "161.021393"; +CM143127.1 StringTie transcript 2287931 2300677 1000 + . gene_id "SS.900"; transcript_id "SS.900.5"; cov "80.174550"; FPKM "3.920896"; TPM "8.384236"; +CM143127.1 StringTie exon 2287931 2289757 1000 + . gene_id "SS.900"; transcript_id "SS.900.5"; exon_number "1"; cov "14.655457"; +CM143127.1 StringTie exon 2289849 2290144 1000 + . gene_id "SS.900"; transcript_id "SS.900.5"; exon_number "2"; cov "14.668236"; +CM143127.1 StringTie exon 2290219 2290281 1000 + . gene_id "SS.900"; transcript_id "SS.900.5"; exon_number "3"; cov "22.435995"; +CM143127.1 StringTie exon 2290352 2300677 1000 + . gene_id "SS.900"; transcript_id "SS.900.5"; exon_number "4"; cov "93.997017"; +CM143127.1 StringTie transcript 2290831 2291943 1000 . . gene_id "SS.901"; transcript_id "SS.901.1"; cov "3938.099730"; FPKM "192.590796"; TPM "411.825901"; +CM143127.1 StringTie exon 2290831 2291943 1000 . . gene_id "SS.901"; transcript_id "SS.901.1"; exon_number "1"; cov "3938.099609"; +CM143127.1 StringTie transcript 2292971 2300677 1000 . . gene_id "SS.902"; transcript_id "SS.902.1"; cov "661.717400"; FPKM "32.360958"; TPM "69.198949"; +CM143127.1 StringTie exon 2292971 2300677 1000 . . gene_id "SS.902"; transcript_id "SS.902.1"; exon_number "1"; cov "661.717407"; +CM143127.1 StringTie transcript 2301299 2302854 1000 + . gene_id "SS.903"; transcript_id "SS.903.1"; cov "161813.834459"; FPKM "7913.424570"; TPM "16921.645631"; +CM143127.1 StringTie exon 2301299 2301376 1000 + . gene_id "SS.903"; transcript_id "SS.903.1"; exon_number "1"; cov "18293.269531"; +CM143127.1 StringTie exon 2301453 2302854 1000 + . gene_id "SS.903"; transcript_id "SS.903.1"; exon_number "2"; cov "169798.578125"; +CM143127.1 StringTie transcript 2305923 2309865 1000 - . gene_id "SS.904"; transcript_id "SS.904.1"; cov "158.342838"; FPKM "7.743677"; TPM "16.558667"; +CM143127.1 StringTie exon 2305923 2307318 1000 - . gene_id "SS.904"; transcript_id "SS.904.1"; exon_number "1"; cov "289.735321"; +CM143127.1 StringTie exon 2307457 2309865 1000 - . gene_id "SS.904"; transcript_id "SS.904.1"; exon_number "2"; cov "82.201744"; +CM143127.1 StringTie transcript 2314060 2317411 1000 . . gene_id "SS.905"; transcript_id "SS.905.1"; cov "267.963007"; FPKM "13.104597"; TPM "28.022172"; +CM143127.1 StringTie exon 2314060 2317411 1000 . . gene_id "SS.905"; transcript_id "SS.905.1"; exon_number "1"; cov "267.963013"; +CM143127.1 StringTie transcript 2326517 2327601 1000 + . gene_id "SS.906"; transcript_id "SS.906.1"; cov "1766.024533"; FPKM "86.366546"; TPM "184.681621"; +CM143127.1 StringTie exon 2326517 2326599 1000 + . gene_id "SS.906"; transcript_id "SS.906.1"; exon_number "1"; cov "575.192749"; +CM143127.1 StringTie exon 2326829 2327601 1000 + . gene_id "SS.906"; transcript_id "SS.906.1"; exon_number "2"; cov "1893.888794"; +CM143127.1 StringTie transcript 2327923 2330121 1000 . . gene_id "SS.907"; transcript_id "SS.907.1"; cov "3237.543429"; FPKM "158.330441"; TPM "338.565382"; +CM143127.1 StringTie exon 2327923 2330121 1000 . . gene_id "SS.907"; transcript_id "SS.907.1"; exon_number "1"; cov "3237.543457"; +CM143127.1 StringTie transcript 2330343 2340876 1000 . . gene_id "SS.908"; transcript_id "SS.908.1"; cov "331.115436"; FPKM "16.193035"; TPM "34.626323"; +CM143127.1 StringTie exon 2330343 2340876 1000 . . gene_id "SS.908"; transcript_id "SS.908.1"; exon_number "1"; cov "331.115448"; +CM143127.1 StringTie transcript 2341178 2359285 1000 . . gene_id "SS.909"; transcript_id "SS.909.1"; cov "548.888005"; FPKM "26.843093"; TPM "57.399841"; +CM143127.1 StringTie exon 2341178 2359285 1000 . . gene_id "SS.909"; transcript_id "SS.909.1"; exon_number "1"; cov "548.888000"; +CM143127.1 StringTie transcript 2341178 2349595 1000 - . gene_id "SS.910"; transcript_id "SS.910.1"; cov "132.227383"; FPKM "6.466514"; TPM "13.827649"; +CM143127.1 StringTie exon 2341178 2342151 1000 - . gene_id "SS.910"; transcript_id "SS.910.1"; exon_number "1"; cov "611.453064"; +CM143127.1 StringTie exon 2342410 2345243 1000 - . gene_id "SS.910"; transcript_id "SS.910.1"; exon_number "2"; cov "126.084023"; +CM143127.1 StringTie exon 2345332 2349595 1000 - . gene_id "SS.910"; transcript_id "SS.910.1"; exon_number "3"; cov "26.843809"; +CM143127.1 StringTie transcript 2359676 2361924 1000 . . gene_id "SS.911"; transcript_id "SS.911.1"; cov "346.932859"; FPKM "16.966578"; TPM "36.280426"; +CM143127.1 StringTie exon 2359676 2361924 1000 . . gene_id "SS.911"; transcript_id "SS.911.1"; exon_number "1"; cov "346.932861"; +CM143127.1 StringTie transcript 2366198 2367316 1000 . . gene_id "SS.912"; transcript_id "SS.912.1"; cov "13311.847185"; FPKM "651.009223"; TPM "1392.083449"; +CM143127.1 StringTie exon 2366198 2367316 1000 . . gene_id "SS.912"; transcript_id "SS.912.1"; exon_number "1"; cov "13311.847656"; +CM143127.1 StringTie transcript 2367846 2370662 1000 . . gene_id "SS.913"; transcript_id "SS.913.1"; cov "926.007100"; FPKM "45.285914"; TPM "96.836986"; +CM143127.1 StringTie exon 2367846 2370662 1000 . . gene_id "SS.913"; transcript_id "SS.913.1"; exon_number "1"; cov "926.007080"; +CM143127.1 StringTie transcript 2374442 2378302 1000 - . gene_id "SS.914"; transcript_id "SS.914.1"; cov "1001.904800"; FPKM "48.997653"; TPM "104.773971"; +CM143127.1 StringTie exon 2374442 2378122 1000 - . gene_id "SS.914"; transcript_id "SS.914.1"; exon_number "1"; cov "1023.778564"; +CM143127.1 StringTie exon 2378213 2378302 1000 - . gene_id "SS.914"; transcript_id "SS.914.1"; exon_number "2"; cov "107.266670"; +CM143127.1 StringTie transcript 2378686 2381497 1000 . . gene_id "SS.915"; transcript_id "SS.915.1"; cov "3603.078592"; FPKM "176.206755"; TPM "376.791140"; +CM143127.1 StringTie exon 2378686 2381497 1000 . . gene_id "SS.915"; transcript_id "SS.915.1"; exon_number "1"; cov "3603.078613"; +CM143127.1 StringTie transcript 2382248 2383809 1000 . . gene_id "SS.916"; transcript_id "SS.916.1"; cov "918.989117"; FPKM "44.942703"; TPM "96.103082"; +CM143127.1 StringTie exon 2382248 2383809 1000 . . gene_id "SS.916"; transcript_id "SS.916.1"; exon_number "1"; cov "918.989136"; +CM143127.1 StringTie transcript 2384697 2385718 1000 . . gene_id "SS.917"; transcript_id "SS.917.1"; cov "928.950098"; FPKM "45.429840"; TPM "97.144749"; +CM143127.1 StringTie exon 2384697 2385718 1000 . . gene_id "SS.917"; transcript_id "SS.917.1"; exon_number "1"; cov "928.950073"; +CM143127.1 StringTie transcript 2390512 2391945 1000 . . gene_id "SS.918"; transcript_id "SS.918.1"; cov "3609.887029"; FPKM "176.539718"; TPM "377.503131"; +CM143127.1 StringTie exon 2390512 2391945 1000 . . gene_id "SS.918"; transcript_id "SS.918.1"; exon_number "1"; cov "3609.886963"; +CM143127.1 StringTie transcript 2394608 2396346 1000 + . gene_id "SS.919"; transcript_id "SS.919.1"; cov "273.262403"; FPKM "13.363761"; TPM "28.576355"; +CM143127.1 StringTie exon 2394608 2394696 1000 + . gene_id "SS.919"; transcript_id "SS.919.1"; exon_number "1"; cov "61.011234"; +CM143127.1 StringTie exon 2394763 2396346 1000 + . gene_id "SS.919"; transcript_id "SS.919.1"; exon_number "2"; cov "285.188141"; +CM143127.1 StringTie transcript 2401001 2401637 1000 . . gene_id "SS.920"; transcript_id "SS.920.1"; cov "17559.197802"; FPKM "858.723778"; TPM "1836.249192"; +CM143127.1 StringTie exon 2401001 2401637 1000 . . gene_id "SS.920"; transcript_id "SS.920.1"; exon_number "1"; cov "17559.197266"; +CM143127.1 StringTie transcript 2402280 2403868 1000 . . gene_id "SS.921"; transcript_id "SS.921.1"; cov "605.709251"; FPKM "29.621908"; TPM "63.341910"; +CM143127.1 StringTie exon 2402280 2403868 1000 . . gene_id "SS.921"; transcript_id "SS.921.1"; exon_number "1"; cov "605.709229"; +CM143127.1 StringTie transcript 2404926 2411525 1000 . . gene_id "SS.922"; transcript_id "SS.922.1"; cov "731.361894"; FPKM "35.766887"; TPM "76.482007"; +CM143127.1 StringTie exon 2404926 2411525 1000 . . gene_id "SS.922"; transcript_id "SS.922.1"; exon_number "1"; cov "731.361877"; +CM143127.1 StringTie transcript 2405859 2411525 1000 + . gene_id "SS.923"; transcript_id "SS.923.1"; cov "75.367527"; FPKM "3.685811"; TPM "7.881542"; +CM143127.1 StringTie exon 2405859 2407624 1000 + . gene_id "SS.923"; transcript_id "SS.923.1"; exon_number "1"; cov "55.875805"; +CM143127.1 StringTie exon 2407674 2411525 1000 + . gene_id "SS.923"; transcript_id "SS.923.1"; exon_number "2"; cov "84.303764"; +CM143127.1 StringTie transcript 2411882 2421848 1000 . . gene_id "SS.924"; transcript_id "SS.924.1"; cov "1305.213906"; FPKM "63.830833"; TPM "136.492453"; +CM143127.1 StringTie exon 2411882 2421848 1000 . . gene_id "SS.924"; transcript_id "SS.924.1"; exon_number "1"; cov "1305.213867"; +CM143127.1 StringTie transcript 2411882 2415756 1000 - . gene_id "SS.925"; transcript_id "SS.925.1"; cov "99.895725"; FPKM "4.885350"; TPM "10.446573"; +CM143127.1 StringTie exon 2411882 2415542 1000 - . gene_id "SS.925"; transcript_id "SS.925.1"; exon_number "1"; cov "102.992889"; +CM143127.1 StringTie exon 2415608 2415756 1000 - . gene_id "SS.925"; transcript_id "SS.925.1"; exon_number "2"; cov "23.796940"; +CM143127.1 StringTie transcript 2422113 2423046 1000 . . gene_id "SS.926"; transcript_id "SS.926.1"; cov "434.062467"; FPKM "21.227608"; TPM "45.391986"; +CM143127.1 StringTie exon 2422113 2423046 1000 . . gene_id "SS.926"; transcript_id "SS.926.1"; exon_number "1"; cov "434.062469"; +CM143127.1 StringTie transcript 2422113 2423046 1000 + . gene_id "SS.927"; transcript_id "SS.927.1"; cov "423.226913"; FPKM "20.697700"; TPM "44.258860"; +CM143127.1 StringTie exon 2422113 2422144 1000 + . gene_id "SS.927"; transcript_id "SS.927.1"; exon_number "1"; cov "12.234889"; +CM143127.1 StringTie exon 2422208 2423046 1000 + . gene_id "SS.927"; transcript_id "SS.927.1"; exon_number "2"; cov "438.902405"; +CM143127.1 StringTie transcript 2423609 2431584 1000 . . gene_id "SS.928"; transcript_id "SS.928.1"; cov "690.849549"; FPKM "33.785651"; TPM "72.245437"; +CM143127.1 StringTie exon 2423609 2431584 1000 . . gene_id "SS.928"; transcript_id "SS.928.1"; exon_number "1"; cov "690.849548"; +CM143127.1 StringTie transcript 2432634 2434283 1000 . . gene_id "SS.929"; transcript_id "SS.929.1"; cov "1757.189697"; FPKM "85.934482"; TPM "183.757720"; +CM143127.1 StringTie exon 2432634 2434283 1000 . . gene_id "SS.929"; transcript_id "SS.929.1"; exon_number "1"; cov "1757.189697"; +CM143127.1 StringTie transcript 2434644 2439001 1000 . . gene_id "SS.930"; transcript_id "SS.930.1"; cov "303.795089"; FPKM "14.856947"; TPM "31.769304"; +CM143127.1 StringTie exon 2434644 2439001 1000 . . gene_id "SS.930"; transcript_id "SS.930.1"; exon_number "1"; cov "303.795074"; +CM143127.1 StringTie transcript 2439481 2444912 1000 . . gene_id "SS.931"; transcript_id "SS.931.1"; cov "834.616716"; FPKM "40.816513"; TPM "87.279857"; +CM143127.1 StringTie exon 2439481 2444912 1000 . . gene_id "SS.931"; transcript_id "SS.931.1"; exon_number "1"; cov "834.616699"; +CM143127.1 StringTie transcript 2445715 2448315 1000 - . gene_id "SS.932"; transcript_id "SS.932.1"; cov "967.063260"; FPKM "47.293745"; TPM "101.130425"; +CM143127.1 StringTie exon 2445715 2447916 1000 - . gene_id "SS.932"; transcript_id "SS.932.1"; exon_number "1"; cov "1001.117859"; +CM143127.1 StringTie exon 2448030 2448058 1000 - . gene_id "SS.932"; transcript_id "SS.932.1"; exon_number "2"; cov "874.706543"; +CM143127.1 StringTie exon 2448153 2448315 1000 - . gene_id "SS.932"; transcript_id "SS.932.1"; exon_number "3"; cov "523.444519"; +CM143127.1 StringTie transcript 2445715 2448315 1000 - . gene_id "SS.932"; transcript_id "SS.932.2"; cov "116.165205"; FPKM "5.681001"; TPM "12.147950"; +CM143127.1 StringTie exon 2445715 2448058 1000 - . gene_id "SS.932"; transcript_id "SS.932.2"; exon_number "1"; cov "119.929024"; +CM143127.1 StringTie exon 2448153 2448315 1000 - . gene_id "SS.932"; transcript_id "SS.932.2"; exon_number "2"; cov "62.040146"; +CM143127.1 StringTie transcript 2448578 2451064 1000 . . gene_id "SS.933"; transcript_id "SS.933.1"; cov "659.790109"; FPKM "32.266705"; TPM "68.997403"; +CM143127.1 StringTie exon 2448578 2451064 1000 . . gene_id "SS.933"; transcript_id "SS.933.1"; exon_number "1"; cov "659.790100"; +CM143127.1 StringTie transcript 2451336 2453043 1000 . . gene_id "SS.934"; transcript_id "SS.934.1"; cov "1187.610070"; FPKM "58.079476"; TPM "124.194058"; +CM143127.1 StringTie exon 2451336 2453043 1000 . . gene_id "SS.934"; transcript_id "SS.934.1"; exon_number "1"; cov "1187.610107"; +CM143127.1 StringTie transcript 2453585 2456579 1000 . . gene_id "SS.935"; transcript_id "SS.935.1"; cov "388.198998"; FPKM "18.984678"; TPM "40.595824"; +CM143127.1 StringTie exon 2453585 2456579 1000 . . gene_id "SS.935"; transcript_id "SS.935.1"; exon_number "1"; cov "388.199005"; +CM143127.1 StringTie transcript 2459358 2462810 1000 . . gene_id "SS.936"; transcript_id "SS.936.1"; cov "290.718216"; FPKM "14.217429"; TPM "30.401793"; +CM143127.1 StringTie exon 2459358 2462810 1000 . . gene_id "SS.936"; transcript_id "SS.936.1"; exon_number "1"; cov "290.718231"; +CM143127.1 StringTie transcript 2464646 2469354 1000 . . gene_id "SS.937"; transcript_id "SS.937.1"; cov "3941.609259"; FPKM "192.762428"; TPM "412.192909"; +CM143127.1 StringTie exon 2464646 2469354 1000 . . gene_id "SS.937"; transcript_id "SS.937.1"; exon_number "1"; cov "3941.609375"; +CM143127.1 StringTie transcript 2470208 2482683 1000 . . gene_id "SS.938"; transcript_id "SS.938.1"; cov "347.138466"; FPKM "16.976633"; TPM "36.301928"; +CM143127.1 StringTie exon 2470208 2482683 1000 . . gene_id "SS.938"; transcript_id "SS.938.1"; exon_number "1"; cov "347.138458"; +CM143127.1 StringTie transcript 2485165 2486526 1000 . . gene_id "SS.939"; transcript_id "SS.939.1"; cov "866.303965"; FPKM "42.366162"; TPM "90.593544"; +CM143127.1 StringTie exon 2485165 2486526 1000 . . gene_id "SS.939"; transcript_id "SS.939.1"; exon_number "1"; cov "866.303955"; +CM143127.1 StringTie transcript 2486960 2487828 1000 + . gene_id "SS.940"; transcript_id "SS.940.1"; cov "11532.798780"; FPKM "564.005751"; TPM "1206.039859"; +CM143127.1 StringTie exon 2486960 2487039 1000 + . gene_id "SS.940"; transcript_id "SS.940.1"; exon_number "1"; cov "2570.812500"; +CM143127.1 StringTie exon 2487417 2487828 1000 + . gene_id "SS.940"; transcript_id "SS.940.1"; exon_number "2"; cov "13272.990234"; +CM143127.1 StringTie transcript 2490824 2491071 1000 . . gene_id "SS.941"; transcript_id "SS.941.1"; cov "8.645161"; FPKM "0.422787"; TPM "0.904066"; +CM143127.1 StringTie exon 2490824 2491071 1000 . . gene_id "SS.941"; transcript_id "SS.941.1"; exon_number "1"; cov "8.645162"; +CM143127.1 StringTie transcript 2529981 2530603 1000 . . gene_id "SS.942"; transcript_id "SS.942.1"; cov "4.922953"; FPKM "0.240755"; TPM "0.514817"; +CM143127.1 StringTie exon 2529981 2530603 1000 . . gene_id "SS.942"; transcript_id "SS.942.1"; exon_number "1"; cov "4.922954"; +CM143127.1 StringTie transcript 2491605 2498937 1000 . . gene_id "SS.943"; transcript_id "SS.943.1"; cov "267.257875"; FPKM "13.070113"; TPM "27.948433"; +CM143127.1 StringTie exon 2491605 2498937 1000 . . gene_id "SS.943"; transcript_id "SS.943.1"; exon_number "1"; cov "267.257874"; +CM143127.1 StringTie transcript 2499841 2501599 1000 . . gene_id "SS.944"; transcript_id "SS.944.1"; cov "8671.401364"; FPKM "424.070543"; TPM "906.809863"; +CM143127.1 StringTie exon 2499841 2501599 1000 . . gene_id "SS.944"; transcript_id "SS.944.1"; exon_number "1"; cov "8671.401367"; +CM143127.1 StringTie transcript 2502901 2504344 1000 . . gene_id "SS.945"; transcript_id "SS.945.1"; cov "1522.396814"; FPKM "74.452054"; TPM "159.204307"; +CM143127.1 StringTie exon 2502901 2504344 1000 . . gene_id "SS.945"; transcript_id "SS.945.1"; exon_number "1"; cov "1522.396851"; +CM143127.1 StringTie transcript 2504909 2505905 1000 . . gene_id "SS.946"; transcript_id "SS.946.1"; cov "99240.970913"; FPKM "4853.330002"; TPM "10378.102388"; +CM143127.1 StringTie exon 2504909 2505905 1000 . . gene_id "SS.946"; transcript_id "SS.946.1"; exon_number "1"; cov "99240.968750"; +CM143127.1 StringTie transcript 2506328 2510378 1000 . . gene_id "SS.947"; transcript_id "SS.947.1"; cov "814.560355"; FPKM "39.835666"; TPM "85.182467"; +CM143127.1 StringTie exon 2506328 2510378 1000 . . gene_id "SS.947"; transcript_id "SS.947.1"; exon_number "1"; cov "814.560364"; +CM143127.1 StringTie transcript 2510693 2519737 1000 . . gene_id "SS.948"; transcript_id "SS.948.1"; cov "527.359646"; FPKM "25.790259"; TPM "55.148517"; +CM143127.1 StringTie exon 2510693 2519737 1000 . . gene_id "SS.948"; transcript_id "SS.948.1"; exon_number "1"; cov "527.359619"; +CM143127.1 StringTie transcript 2520175 2522103 1000 . . gene_id "SS.949"; transcript_id "SS.949.1"; cov "546.655262"; FPKM "26.733902"; TPM "57.166352"; +CM143127.1 StringTie exon 2520175 2522103 1000 . . gene_id "SS.949"; transcript_id "SS.949.1"; exon_number "1"; cov "546.655273"; +CM143127.1 StringTie transcript 2522382 2528530 1000 - . gene_id "SS.950"; transcript_id "SS.950.1"; cov "190.257995"; FPKM "9.304472"; TPM "19.896187"; +CM143127.1 StringTie exon 2522382 2528372 1000 - . gene_id "SS.950"; transcript_id "SS.950.1"; exon_number "1"; cov "192.193451"; +CM143127.1 StringTie exon 2528456 2528530 1000 - . gene_id "SS.950"; transcript_id "SS.950.1"; exon_number "2"; cov "35.653332"; +CM143127.1 StringTie transcript 2532701 2533942 1000 . . gene_id "SS.951"; transcript_id "SS.951.1"; cov "541.582931"; FPKM "26.485842"; TPM "56.635914"; +CM143127.1 StringTie exon 2532701 2533942 1000 . . gene_id "SS.951"; transcript_id "SS.951.1"; exon_number "1"; cov "541.582947"; +CM143127.1 StringTie transcript 2535690 2537670 1000 + . gene_id "SS.952"; transcript_id "SS.952.1"; cov "14314.175556"; FPKM "700.027590"; TPM "1496.901715"; +CM143127.1 StringTie exon 2535690 2536223 1000 + . gene_id "SS.952"; transcript_id "SS.952.1"; exon_number "1"; cov "11973.842773"; +CM143127.1 StringTie exon 2536405 2537670 1000 + . gene_id "SS.952"; transcript_id "SS.952.1"; exon_number "2"; cov "15301.330078"; +CM143127.1 StringTie transcript 2541597 2542067 1000 . . gene_id "SS.953"; transcript_id "SS.953.1"; cov "7894.106157"; FPKM "386.057310"; TPM "825.524390"; +CM143127.1 StringTie exon 2541597 2542067 1000 . . gene_id "SS.953"; transcript_id "SS.953.1"; exon_number "1"; cov "7894.105957"; +CM143127.1 StringTie transcript 2543308 2544215 1000 - . gene_id "SS.954"; transcript_id "SS.954.1"; cov "3345.580605"; FPKM "163.613945"; TPM "349.863345"; +CM143127.1 StringTie exon 2543308 2543857 1000 - . gene_id "SS.954"; transcript_id "SS.954.1"; exon_number "1"; cov "4436.730957"; +CM143127.1 StringTie exon 2543972 2544215 1000 - . gene_id "SS.954"; transcript_id "SS.954.1"; exon_number "2"; cov "886.020508"; +CM143127.1 StringTie transcript 2549777 2565639 1000 . . gene_id "SS.955"; transcript_id "SS.955.1"; cov "336.429364"; FPKM "16.452910"; TPM "35.182026"; +CM143127.1 StringTie exon 2549777 2565639 1000 . . gene_id "SS.955"; transcript_id "SS.955.1"; exon_number "1"; cov "336.429352"; +CM143127.1 StringTie transcript 2565917 2571719 1000 . . gene_id "SS.956"; transcript_id "SS.956.1"; cov "213.382561"; FPKM "10.435367"; TPM "22.314434"; +CM143127.1 StringTie exon 2565917 2571719 1000 . . gene_id "SS.956"; transcript_id "SS.956.1"; exon_number "1"; cov "213.382568"; +CM143127.1 StringTie transcript 2572037 2574454 1000 . . gene_id "SS.957"; transcript_id "SS.957.1"; cov "1107.445823"; FPKM "54.159084"; TPM "115.810900"; +CM143127.1 StringTie exon 2572037 2574454 1000 . . gene_id "SS.957"; transcript_id "SS.957.1"; exon_number "1"; cov "1107.445801"; +CM143127.1 StringTie transcript 2576267 2583223 1000 - . gene_id "SS.958"; transcript_id "SS.958.1"; cov "179.120371"; FPKM "8.759792"; TPM "18.731473"; +CM143127.1 StringTie exon 2576267 2579665 1000 - . gene_id "SS.958"; transcript_id "SS.958.1"; exon_number "1"; cov "274.510162"; +CM143127.1 StringTie exon 2579748 2579798 1000 - . gene_id "SS.958"; transcript_id "SS.958.1"; exon_number "2"; cov "113.719391"; +CM143127.1 StringTie exon 2579879 2580294 1000 - . gene_id "SS.958"; transcript_id "SS.958.1"; exon_number "3"; cov "19.397470"; +CM143127.1 StringTie exon 2580368 2580565 1000 - . gene_id "SS.958"; transcript_id "SS.958.1"; exon_number "4"; cov "24.599957"; +CM143127.1 StringTie exon 2580667 2580762 1000 - . gene_id "SS.958"; transcript_id "SS.958.1"; exon_number "5"; cov "18.027096"; +CM143127.1 StringTie exon 2580830 2583223 1000 - . gene_id "SS.958"; transcript_id "SS.958.1"; exon_number "6"; cov "92.073723"; +CM143127.1 StringTie transcript 2576267 2583223 1000 - . gene_id "SS.958"; transcript_id "SS.958.2"; cov "143.731700"; FPKM "7.029127"; TPM "15.030710"; +CM143127.1 StringTie exon 2576267 2580294 1000 - . gene_id "SS.958"; transcript_id "SS.958.2"; exon_number "1"; cov "196.821732"; +CM143127.1 StringTie exon 2580368 2580762 1000 - . gene_id "SS.958"; transcript_id "SS.958.2"; exon_number "2"; cov "18.039513"; +CM143127.1 StringTie exon 2580830 2583223 1000 - . gene_id "SS.958"; transcript_id "SS.958.2"; exon_number "3"; cov "75.144302"; +CM143127.1 StringTie transcript 2580948 2583223 1000 . . gene_id "SS.959"; transcript_id "SS.959.1"; cov "737.402460"; FPKM "36.062298"; TPM "77.113698"; +CM143127.1 StringTie exon 2580948 2583223 1000 . . gene_id "SS.959"; transcript_id "SS.959.1"; exon_number "1"; cov "737.402466"; +CM143127.1 StringTie transcript 2583555 2585131 1000 . . gene_id "SS.960"; transcript_id "SS.960.1"; cov "446.586557"; FPKM "21.840092"; TPM "46.701690"; +CM143127.1 StringTie exon 2583555 2585131 1000 . . gene_id "SS.960"; transcript_id "SS.960.1"; exon_number "1"; cov "446.586548"; +CM143127.1 StringTie transcript 2587699 2588313 1000 . . gene_id "SS.961"; transcript_id "SS.961.1"; cov "8329.588618"; FPKM "407.354362"; TPM "871.064871"; +CM143127.1 StringTie exon 2587699 2588313 1000 . . gene_id "SS.961"; transcript_id "SS.961.1"; exon_number "1"; cov "8329.588867"; +CM143127.1 StringTie transcript 2588525 2589983 1000 . . gene_id "SS.962"; transcript_id "SS.962.1"; cov "1073.790953"; FPKM "52.513209"; TPM "112.291449"; +CM143127.1 StringTie exon 2588525 2589983 1000 . . gene_id "SS.962"; transcript_id "SS.962.1"; exon_number "1"; cov "1073.790894"; +CM143127.1 StringTie transcript 2594515 2597114 1000 . . gene_id "SS.963"; transcript_id "SS.963.1"; cov "2931.004615"; FPKM "143.339313"; TPM "306.509154"; +CM143127.1 StringTie exon 2594515 2597114 1000 . . gene_id "SS.963"; transcript_id "SS.963.1"; exon_number "1"; cov "2931.004639"; +CM143127.1 StringTie transcript 2597418 2597983 1000 . . gene_id "SS.964"; transcript_id "SS.964.1"; cov "3701.998233"; FPKM "181.044370"; TPM "387.135639"; +CM143127.1 StringTie exon 2597418 2597983 1000 . . gene_id "SS.964"; transcript_id "SS.964.1"; exon_number "1"; cov "3701.998291"; +CM143127.1 StringTie transcript 2600074 2600781 1000 . . gene_id "SS.965"; transcript_id "SS.965.1"; cov "267.906625"; FPKM "13.101839"; TPM "28.016276"; +CM143127.1 StringTie exon 2600074 2600781 1000 . . gene_id "SS.965"; transcript_id "SS.965.1"; exon_number "1"; cov "267.906616"; +CM143127.1 StringTie transcript 2601570 2603750 1000 . . gene_id "SS.966"; transcript_id "SS.966.1"; cov "448.524530"; FPKM "21.934868"; TPM "46.904353"; +CM143127.1 StringTie exon 2601570 2603750 1000 . . gene_id "SS.966"; transcript_id "SS.966.1"; exon_number "1"; cov "448.524536"; +CM143127.1 StringTie transcript 2604084 2606492 1000 . . gene_id "SS.967"; transcript_id "SS.967.1"; cov "408.170195"; FPKM "19.961359"; TPM "42.684307"; +CM143127.1 StringTie exon 2604084 2606492 1000 . . gene_id "SS.967"; transcript_id "SS.967.1"; exon_number "1"; cov "408.170197"; +CM143127.1 StringTie transcript 2606692 2609474 1000 . . gene_id "SS.968"; transcript_id "SS.968.1"; cov "438.465325"; FPKM "21.442927"; TPM "45.852414"; +CM143127.1 StringTie exon 2606692 2609474 1000 . . gene_id "SS.968"; transcript_id "SS.968.1"; exon_number "1"; cov "438.465332"; +CM143127.1 StringTie transcript 2609709 2612726 1000 . . gene_id "SS.969"; transcript_id "SS.969.1"; cov "328.717694"; FPKM "16.075774"; TPM "34.375579"; +CM143127.1 StringTie exon 2609709 2612726 1000 . . gene_id "SS.969"; transcript_id "SS.969.1"; exon_number "1"; cov "328.717682"; +CM143127.1 StringTie transcript 2613466 2615698 1000 . . gene_id "SS.970"; transcript_id "SS.970.1"; cov "581.128974"; FPKM "28.419822"; TPM "60.771433"; +CM143127.1 StringTie exon 2613466 2615698 1000 . . gene_id "SS.970"; transcript_id "SS.970.1"; exon_number "1"; cov "581.128967"; +CM143127.1 StringTie transcript 2615906 2623528 1000 . . gene_id "SS.971"; transcript_id "SS.971.1"; cov "222.255411"; FPKM "10.869290"; TPM "23.242310"; +CM143127.1 StringTie exon 2615906 2623528 1000 . . gene_id "SS.971"; transcript_id "SS.971.1"; exon_number "1"; cov "222.255417"; +CM143127.1 StringTie transcript 2628072 2630236 1000 . . gene_id "SS.972"; transcript_id "SS.972.1"; cov "2443.481755"; FPKM "119.497252"; TPM "255.526559"; +CM143127.1 StringTie exon 2628072 2630236 1000 . . gene_id "SS.972"; transcript_id "SS.972.1"; exon_number "1"; cov "2443.481689"; +CM143127.1 StringTie transcript 2630678 2632128 1000 . . gene_id "SS.973"; transcript_id "SS.973.1"; cov "2403.731909"; FPKM "117.553306"; TPM "251.369728"; +CM143127.1 StringTie exon 2630678 2632128 1000 . . gene_id "SS.973"; transcript_id "SS.973.1"; exon_number "1"; cov "2403.731934"; +CM143127.1 StringTie transcript 2632631 2634128 1000 - . gene_id "SS.974"; transcript_id "SS.974.1"; cov "10956.117647"; FPKM "535.803449"; TPM "1145.733558"; +CM143127.1 StringTie exon 2632631 2633335 1000 - . gene_id "SS.974"; transcript_id "SS.974.1"; exon_number "1"; cov "11546.598633"; +CM143127.1 StringTie exon 2634086 2634128 1000 - . gene_id "SS.974"; transcript_id "SS.974.1"; exon_number "2"; cov "1274.976685"; +CM143127.1 StringTie transcript 2635105 2635759 1000 . . gene_id "SS.975"; transcript_id "SS.975.1"; cov "22.470229"; FPKM "1.098895"; TPM "2.349819"; +CM143127.1 StringTie exon 2635105 2635759 1000 . . gene_id "SS.975"; transcript_id "SS.975.1"; exon_number "1"; cov "22.470228"; +CM143127.1 StringTie transcript 2635980 2645635 1000 . . gene_id "SS.976"; transcript_id "SS.976.1"; cov "2928.640638"; FPKM "143.223704"; TPM "306.261941"; +CM143127.1 StringTie exon 2635980 2645635 1000 . . gene_id "SS.976"; transcript_id "SS.976.1"; exon_number "1"; cov "2928.640625"; +CM143127.1 StringTie transcript 2647697 2650819 1000 . . gene_id "SS.977"; transcript_id "SS.977.1"; cov "607.916427"; FPKM "29.729849"; TPM "63.572725"; +CM143127.1 StringTie exon 2647697 2650819 1000 . . gene_id "SS.977"; transcript_id "SS.977.1"; exon_number "1"; cov "607.916443"; +CM143127.1 StringTie transcript 2651125 2654217 1000 . . gene_id "SS.978"; transcript_id "SS.978.1"; cov "567.013579"; FPKM "27.729515"; TPM "59.295318"; +CM143127.1 StringTie exon 2651125 2654217 1000 . . gene_id "SS.978"; transcript_id "SS.978.1"; exon_number "1"; cov "567.013550"; +CM143127.1 StringTie transcript 2654987 2656902 1000 . . gene_id "SS.979"; transcript_id "SS.979.1"; cov "2568.401879"; FPKM "125.606408"; TPM "268.590053"; +CM143127.1 StringTie exon 2654987 2656902 1000 . . gene_id "SS.979"; transcript_id "SS.979.1"; exon_number "1"; cov "2568.401855"; +CM143127.1 StringTie transcript 2657127 2659512 1000 . . gene_id "SS.980"; transcript_id "SS.980.1"; cov "182.757754"; FPKM "8.937676"; TPM "19.111851"; +CM143127.1 StringTie exon 2657127 2659512 1000 . . gene_id "SS.980"; transcript_id "SS.980.1"; exon_number "1"; cov "182.757751"; +CM143127.1 StringTie transcript 2659750 2662649 1000 . . gene_id "SS.981"; transcript_id "SS.981.1"; cov "303.467241"; FPKM "14.840914"; TPM "31.735019"; +CM143127.1 StringTie exon 2659750 2662649 1000 . . gene_id "SS.981"; transcript_id "SS.981.1"; exon_number "1"; cov "303.467255"; +CM143127.1 StringTie transcript 2662935 2664129 1000 . . gene_id "SS.982"; transcript_id "SS.982.1"; cov "459.787448"; FPKM "22.485675"; TPM "48.082170"; +CM143127.1 StringTie exon 2662935 2664129 1000 . . gene_id "SS.982"; transcript_id "SS.982.1"; exon_number "1"; cov "459.787445"; +CM143127.1 StringTie transcript 2665499 2667932 1000 . . gene_id "SS.983"; transcript_id "SS.983.1"; cov "2867.101068"; FPKM "140.214142"; TPM "299.826454"; +CM143127.1 StringTie exon 2665499 2667932 1000 . . gene_id "SS.983"; transcript_id "SS.983.1"; exon_number "1"; cov "2867.101074"; +CM143127.1 StringTie transcript 2671963 2673860 1000 . . gene_id "SS.984"; transcript_id "SS.984.1"; cov "6425.084299"; FPKM "314.215531"; TPM "671.901757"; +CM143127.1 StringTie exon 2671963 2673860 1000 . . gene_id "SS.984"; transcript_id "SS.984.1"; exon_number "1"; cov "6425.084473"; +CM143127.1 StringTie transcript 2676448 2678856 1000 . . gene_id "SS.985"; transcript_id "SS.985.1"; cov "1351.064342"; FPKM "66.073125"; TPM "141.287252"; +CM143127.1 StringTie exon 2676448 2678856 1000 . . gene_id "SS.985"; transcript_id "SS.985.1"; exon_number "1"; cov "1351.064331"; +CM143127.1 StringTie transcript 2716260 2720449 1000 . . gene_id "SS.986"; transcript_id "SS.986.1"; cov "192.094033"; FPKM "9.394263"; TPM "20.088191"; +CM143127.1 StringTie exon 2716260 2720449 1000 . . gene_id "SS.986"; transcript_id "SS.986.1"; exon_number "1"; cov "192.094040"; +CM143127.1 StringTie transcript 2679754 2680798 1000 . . gene_id "SS.987"; transcript_id "SS.987.1"; cov "5413.231579"; FPKM "264.731381"; TPM "566.087484"; +CM143127.1 StringTie exon 2679754 2680798 1000 . . gene_id "SS.987"; transcript_id "SS.987.1"; exon_number "1"; cov "5413.231445"; +CM143127.1 StringTie transcript 2689462 2690795 1000 . . gene_id "SS.988"; transcript_id "SS.988.1"; cov "3435.408546"; FPKM "168.006935"; TPM "359.257082"; +CM143127.1 StringTie exon 2689462 2690795 1000 . . gene_id "SS.988"; transcript_id "SS.988.1"; exon_number "1"; cov "3435.408447"; +CM143127.1 StringTie transcript 2691122 2695040 1000 . . gene_id "SS.989"; transcript_id "SS.989.1"; cov "581.196989"; FPKM "28.423148"; TPM "60.778545"; +CM143127.1 StringTie exon 2691122 2695040 1000 . . gene_id "SS.989"; transcript_id "SS.989.1"; exon_number "1"; cov "581.196960"; +CM143127.1 StringTie transcript 2701941 2703298 1000 - . gene_id "SS.990"; transcript_id "SS.990.1"; cov "289.314286"; FPKM "14.148770"; TPM "30.254977"; +CM143127.1 StringTie exon 2701941 2702345 1000 - . gene_id "SS.990"; transcript_id "SS.990.1"; exon_number "1"; cov "286.807404"; +CM143127.1 StringTie exon 2702409 2703298 1000 - . gene_id "SS.990"; transcript_id "SS.990.1"; exon_number "2"; cov "290.455048"; +CM143127.1 StringTie transcript 2705424 2707545 1000 - . gene_id "SS.991"; transcript_id "SS.991.1"; cov "6678.569879"; FPKM "326.612117"; TPM "698.409955"; +CM143127.1 StringTie exon 2705424 2706815 1000 - . gene_id "SS.991"; transcript_id "SS.991.1"; exon_number "1"; cov "7307.577637"; +CM143127.1 StringTie exon 2707371 2707545 1000 - . gene_id "SS.991"; transcript_id "SS.991.1"; exon_number "2"; cov "1675.262817"; +CM143127.1 StringTie transcript 2708042 2708793 1000 . . gene_id "SS.992"; transcript_id "SS.992.1"; cov "425.187500"; FPKM "20.793582"; TPM "44.463888"; +CM143127.1 StringTie exon 2708042 2708793 1000 . . gene_id "SS.992"; transcript_id "SS.992.1"; exon_number "1"; cov "425.187500"; +CM143127.1 StringTie transcript 2712788 2715573 1000 . . gene_id "SS.993"; transcript_id "SS.993.1"; cov "257.203921"; FPKM "12.578429"; TPM "26.897043"; +CM143127.1 StringTie exon 2712788 2715573 1000 . . gene_id "SS.993"; transcript_id "SS.993.1"; exon_number "1"; cov "257.203918"; +CM143127.1 StringTie transcript 2720755 2725173 1000 . . gene_id "SS.994"; transcript_id "SS.994.1"; cov "256.888889"; FPKM "12.563023"; TPM "26.864098"; +CM143127.1 StringTie exon 2720755 2725173 1000 . . gene_id "SS.994"; transcript_id "SS.994.1"; exon_number "1"; cov "256.888885"; +CM143127.1 StringTie transcript 2725433 2726847 1000 + . gene_id "SS.995"; transcript_id "SS.995.1"; cov "1118.128517"; FPKM "54.681515"; TPM "116.928040"; +CM143127.1 StringTie exon 2725433 2725535 1000 + . gene_id "SS.995"; transcript_id "SS.995.1"; exon_number "1"; cov "324.019409"; +CM143127.1 StringTie exon 2725636 2726847 1000 + . gene_id "SS.995"; transcript_id "SS.995.1"; exon_number "2"; cov "1185.614746"; +CM143127.1 StringTie transcript 2727134 2729166 1000 . . gene_id "SS.996"; transcript_id "SS.996.1"; cov "28.910477"; FPKM "1.413852"; TPM "3.023307"; +CM143127.1 StringTie exon 2727134 2729166 1000 . . gene_id "SS.996"; transcript_id "SS.996.1"; exon_number "1"; cov "28.910477"; +CM143127.1 StringTie transcript 2729810 2732164 1000 . . gene_id "SS.997"; transcript_id "SS.997.1"; cov "675.430573"; FPKM "33.031594"; TPM "70.633001"; +CM143127.1 StringTie exon 2729810 2732164 1000 . . gene_id "SS.997"; transcript_id "SS.997.1"; exon_number "1"; cov "675.430603"; +CM143127.1 StringTie transcript 2732420 2733461 1000 - . gene_id "SS.998"; transcript_id "SS.998.1"; cov "18700.781609"; FPKM "914.552363"; TPM "1955.630064"; +CM143127.1 StringTie exon 2732420 2732913 1000 - . gene_id "SS.998"; transcript_id "SS.998.1"; exon_number "1"; cov "19549.974609"; +CM143127.1 StringTie exon 2733434 2733461 1000 - . gene_id "SS.998"; transcript_id "SS.998.1"; exon_number "2"; cov "3718.607178"; +CM143127.1 StringTie transcript 2734148 2736558 1000 . . gene_id "SS.999"; transcript_id "SS.999.1"; cov "432.632932"; FPKM "21.157697"; TPM "45.242492"; +CM143127.1 StringTie exon 2734148 2736558 1000 . . gene_id "SS.999"; transcript_id "SS.999.1"; exon_number "1"; cov "432.632935"; +CM143127.1 StringTie transcript 2738669 2741214 1000 . . gene_id "SS.1000"; transcript_id "SS.1000.1"; cov "555.507463"; FPKM "27.166814"; TPM "58.092069"; +CM143127.1 StringTie exon 2738669 2741214 1000 . . gene_id "SS.1000"; transcript_id "SS.1000.1"; exon_number "1"; cov "555.507446"; +CM143127.1 StringTie transcript 2741633 2746201 1000 . . gene_id "SS.1001"; transcript_id "SS.1001.1"; cov "597.747647"; FPKM "29.232549"; TPM "62.509327"; +CM143127.1 StringTie exon 2741633 2746201 1000 . . gene_id "SS.1001"; transcript_id "SS.1001.1"; exon_number "1"; cov "597.747620"; +CM143127.1 StringTie transcript 2746856 2755755 1000 . . gene_id "SS.1002"; transcript_id "SS.1002.1"; cov "723.249326"; FPKM "35.370146"; TPM "75.633637"; +CM143127.1 StringTie exon 2746856 2755755 1000 . . gene_id "SS.1002"; transcript_id "SS.1002.1"; exon_number "1"; cov "723.249329"; +CM143127.1 StringTie transcript 2757702 2760310 1000 . . gene_id "SS.1003"; transcript_id "SS.1003.1"; cov "2448.516290"; FPKM "119.743463"; TPM "256.053045"; +CM143127.1 StringTie exon 2757702 2760310 1000 . . gene_id "SS.1003"; transcript_id "SS.1003.1"; exon_number "1"; cov "2448.516357"; +CM143127.1 StringTie transcript 2761070 2770373 1000 . . gene_id "SS.1004"; transcript_id "SS.1004.1"; cov "431.272786"; FPKM "21.091180"; TPM "45.100255"; +CM143127.1 StringTie exon 2761070 2770373 1000 . . gene_id "SS.1004"; transcript_id "SS.1004.1"; exon_number "1"; cov "431.272797"; +CM143127.1 StringTie transcript 2770731 2780720 1000 . . gene_id "SS.1005"; transcript_id "SS.1005.1"; cov "748.939640"; FPKM "36.626518"; TPM "78.320196"; +CM143127.1 StringTie exon 2770731 2780720 1000 . . gene_id "SS.1005"; transcript_id "SS.1005.1"; exon_number "1"; cov "748.939636"; +CM143127.1 StringTie transcript 2781015 2783852 1000 . . gene_id "SS.1006"; transcript_id "SS.1006.1"; cov "547.780479"; FPKM "26.788930"; TPM "57.284021"; +CM143127.1 StringTie exon 2781015 2783852 1000 . . gene_id "SS.1006"; transcript_id "SS.1006.1"; exon_number "1"; cov "547.780457"; +CM143127.1 StringTie transcript 2784217 2785215 1000 . . gene_id "SS.1007"; transcript_id "SS.1007.1"; cov "477.634635"; FPKM "23.358483"; TPM "49.948535"; +CM143127.1 StringTie exon 2784217 2785215 1000 . . gene_id "SS.1007"; transcript_id "SS.1007.1"; exon_number "1"; cov "477.634644"; +CM143127.1 StringTie transcript 2785579 2787460 1000 . . gene_id "SS.1008"; transcript_id "SS.1008.1"; cov "458.679065"; FPKM "22.431470"; TPM "47.966261"; +CM143127.1 StringTie exon 2785579 2787460 1000 . . gene_id "SS.1008"; transcript_id "SS.1008.1"; exon_number "1"; cov "458.679077"; +CM143127.1 StringTie transcript 2787785 2791184 1000 . . gene_id "SS.1009"; transcript_id "SS.1009.1"; cov "1541.159118"; FPKM "75.369615"; TPM "161.166371"; +CM143127.1 StringTie exon 2787785 2791184 1000 . . gene_id "SS.1009"; transcript_id "SS.1009.1"; exon_number "1"; cov "1541.159058"; +CM143127.1 StringTie transcript 2791436 2796216 1000 . . gene_id "SS.1010"; transcript_id "SS.1010.1"; cov "201.498013"; FPKM "9.854159"; TPM "21.071610"; +CM143127.1 StringTie exon 2791436 2796216 1000 . . gene_id "SS.1010"; transcript_id "SS.1010.1"; exon_number "1"; cov "201.498016"; +CM143127.1 StringTie transcript 2801369 2802490 1000 . . gene_id "SS.1011"; transcript_id "SS.1011.1"; cov "21038.670232"; FPKM "1028.885636"; TPM "2200.114245"; +CM143127.1 StringTie exon 2801369 2802490 1000 . . gene_id "SS.1011"; transcript_id "SS.1011.1"; exon_number "1"; cov "21038.669922"; +CM143127.1 StringTie transcript 2802697 2807646 1000 . . gene_id "SS.1012"; transcript_id "SS.1012.1"; cov "1324.525253"; FPKM "64.775244"; TPM "138.511933"; +CM143127.1 StringTie exon 2802697 2807646 1000 . . gene_id "SS.1012"; transcript_id "SS.1012.1"; exon_number "1"; cov "1324.525269"; +CM143127.1 StringTie transcript 2808904 2826028 1000 . . gene_id "SS.1013"; transcript_id "SS.1013.1"; cov "798.169343"; FPKM "39.034072"; TPM "83.468381"; +CM143127.1 StringTie exon 2808904 2826028 1000 . . gene_id "SS.1013"; transcript_id "SS.1013.1"; exon_number "1"; cov "798.169373"; +CM143127.1 StringTie transcript 2826778 2827339 1000 . . gene_id "SS.1014"; transcript_id "SS.1014.1"; cov "1652.946619"; FPKM "80.836527"; TPM "172.856524"; +CM143127.1 StringTie exon 2826778 2827339 1000 . . gene_id "SS.1014"; transcript_id "SS.1014.1"; exon_number "1"; cov "1652.946655"; +CM143127.1 StringTie transcript 2852099 2857150 1000 . . gene_id "SS.1015"; transcript_id "SS.1015.1"; cov "413.872328"; FPKM "20.240219"; TPM "43.280606"; +CM143127.1 StringTie exon 2852099 2857150 1000 . . gene_id "SS.1015"; transcript_id "SS.1015.1"; exon_number "1"; cov "413.872314"; +CM143127.1 StringTie transcript 2857460 2859308 1000 . . gene_id "SS.1016"; transcript_id "SS.1016.1"; cov "237.204976"; FPKM "11.600391"; TPM "24.805657"; +CM143127.1 StringTie exon 2857460 2859308 1000 . . gene_id "SS.1016"; transcript_id "SS.1016.1"; exon_number "1"; cov "237.204971"; +CM143127.1 StringTie transcript 2827691 2828807 1000 . . gene_id "SS.1017"; transcript_id "SS.1017.1"; cov "328.434199"; FPKM "16.061910"; TPM "34.345933"; +CM143127.1 StringTie exon 2827691 2828807 1000 . . gene_id "SS.1017"; transcript_id "SS.1017.1"; exon_number "1"; cov "328.434204"; +CM143127.1 StringTie transcript 2829295 2830813 1000 . . gene_id "SS.1018"; transcript_id "SS.1018.1"; cov "5582.492429"; FPKM "273.008998"; TPM "583.787900"; +CM143127.1 StringTie exon 2829295 2830813 1000 . . gene_id "SS.1018"; transcript_id "SS.1018.1"; exon_number "1"; cov "5582.492188"; +CM143127.1 StringTie transcript 2831239 2832957 1000 . . gene_id "SS.1019"; transcript_id "SS.1019.1"; cov "3427.392088"; FPKM "167.614894"; TPM "358.418763"; +CM143127.1 StringTie exon 2831239 2832957 1000 . . gene_id "SS.1019"; transcript_id "SS.1019.1"; exon_number "1"; cov "3427.392090"; +CM143127.1 StringTie transcript 2835911 2838002 1000 . . gene_id "SS.1020"; transcript_id "SS.1020.1"; cov "8095.674952"; FPKM "395.914931"; TPM "846.603402"; +CM143127.1 StringTie exon 2835911 2838002 1000 . . gene_id "SS.1020"; transcript_id "SS.1020.1"; exon_number "1"; cov "8095.674805"; +CM143127.1 StringTie transcript 2839800 2845046 1000 - . gene_id "SS.1021"; transcript_id "SS.1021.1"; cov "201.115285"; FPKM "9.835442"; TPM "21.031586"; +CM143127.1 StringTie exon 2839800 2842165 1000 - . gene_id "SS.1021"; transcript_id "SS.1021.1"; exon_number "1"; cov "207.064911"; +CM143127.1 StringTie exon 2842247 2845046 1000 - . gene_id "SS.1021"; transcript_id "SS.1021.1"; exon_number "2"; cov "196.087860"; +CM143127.1 StringTie transcript 2846498 2848041 1000 . . gene_id "SS.1022"; transcript_id "SS.1022.1"; cov "1342.600712"; FPKM "65.659216"; TPM "140.402170"; +CM143127.1 StringTie exon 2846498 2848041 1000 . . gene_id "SS.1022"; transcript_id "SS.1022.1"; exon_number "1"; cov "1342.600708"; +CM143127.1 StringTie transcript 2848340 2848979 1000 . . gene_id "SS.1023"; transcript_id "SS.1023.1"; cov "2655.662500"; FPKM "129.873845"; TPM "277.715313"; +CM143127.1 StringTie exon 2848340 2848979 1000 . . gene_id "SS.1023"; transcript_id "SS.1023.1"; exon_number "1"; cov "2655.662598"; +CM143127.1 StringTie transcript 2849381 2851542 1000 . . gene_id "SS.1024"; transcript_id "SS.1024.1"; cov "2098.553191"; FPKM "102.628693"; TPM "219.455732"; +CM143127.1 StringTie exon 2849381 2851542 1000 . . gene_id "SS.1024"; transcript_id "SS.1024.1"; exon_number "1"; cov "2098.553223"; +CM143127.1 StringTie transcript 2879158 2882492 1000 . . gene_id "SS.1025"; transcript_id "SS.1025.1"; cov "96.711544"; FPKM "4.729630"; TPM "10.113588"; +CM143127.1 StringTie exon 2879158 2882492 1000 . . gene_id "SS.1025"; transcript_id "SS.1025.1"; exon_number "1"; cov "96.711548"; +CM143127.1 StringTie transcript 2883391 2884195 1000 . . gene_id "SS.1026"; transcript_id "SS.1026.1"; cov "20.600000"; FPKM "1.007433"; TPM "2.154240"; +CM143127.1 StringTie exon 2883391 2884195 1000 . . gene_id "SS.1026"; transcript_id "SS.1026.1"; exon_number "1"; cov "20.600000"; +CM143127.1 StringTie transcript 2859579 2869816 1000 . . gene_id "SS.1027"; transcript_id "SS.1027.1"; cov "242.883864"; FPKM "11.878114"; TPM "25.399526"; +CM143127.1 StringTie exon 2859579 2869816 1000 . . gene_id "SS.1027"; transcript_id "SS.1027.1"; exon_number "1"; cov "242.883865"; +CM143127.1 StringTie transcript 2870038 2870716 1000 . . gene_id "SS.1028"; transcript_id "SS.1028.1"; cov "208.608247"; FPKM "10.201882"; TPM "21.815161"; +CM143127.1 StringTie exon 2870038 2870716 1000 . . gene_id "SS.1028"; transcript_id "SS.1028.1"; exon_number "1"; cov "208.608246"; +CM143127.1 StringTie transcript 2870995 2871924 1000 . . gene_id "SS.1029"; transcript_id "SS.1029.1"; cov "411.500000"; FPKM "20.124202"; TPM "43.032521"; +CM143127.1 StringTie exon 2870995 2871924 1000 . . gene_id "SS.1029"; transcript_id "SS.1029.1"; exon_number "1"; cov "411.500000"; +CM143127.1 StringTie transcript 2872233 2874786 1000 . . gene_id "SS.1030"; transcript_id "SS.1030.1"; cov "10760.337510"; FPKM "526.228919"; TPM "1125.259894"; +CM143127.1 StringTie exon 2872233 2874786 1000 . . gene_id "SS.1030"; transcript_id "SS.1030.1"; exon_number "1"; cov "10760.337891"; +CM143127.1 StringTie transcript 2876623 2878702 1000 . . gene_id "SS.1031"; transcript_id "SS.1031.1"; cov "38.659615"; FPKM "1.890629"; TPM "4.042821"; +CM143127.1 StringTie exon 2876623 2878702 1000 . . gene_id "SS.1031"; transcript_id "SS.1031.1"; exon_number "1"; cov "38.659615"; +CM143127.1 StringTie transcript 2885657 2886914 1000 . . gene_id "SS.1032"; transcript_id "SS.1032.1"; cov "410.642289"; FPKM "20.082256"; TPM "42.942826"; +CM143127.1 StringTie exon 2885657 2886914 1000 . . gene_id "SS.1032"; transcript_id "SS.1032.1"; exon_number "1"; cov "410.642303"; +CM143127.1 StringTie transcript 2892170 2893220 1000 + . gene_id "SS.1033"; transcript_id "SS.1033.1"; cov "7200.712766"; FPKM "352.147253"; TPM "753.012931"; +CM143127.1 StringTie exon 2892170 2892673 1000 + . gene_id "SS.1033"; transcript_id "SS.1033.1"; exon_number "1"; cov "7733.391113"; +CM143127.1 StringTie exon 2893161 2893220 1000 + . gene_id "SS.1033"; transcript_id "SS.1033.1"; exon_number "2"; cov "2726.216553"; +CM143127.1 StringTie transcript 2893602 2894523 1000 - . gene_id "SS.1034"; transcript_id "SS.1034.1"; cov "4495.865489"; FPKM "219.868051"; TPM "470.154130"; +CM143127.1 StringTie exon 2893602 2894187 1000 - . gene_id "SS.1034"; transcript_id "SS.1034.1"; exon_number "1"; cov "5523.462402"; +CM143127.1 StringTie exon 2894374 2894523 1000 - . gene_id "SS.1034"; transcript_id "SS.1034.1"; exon_number "2"; cov "481.386658"; +CM143127.1 StringTie transcript 2895003 2896001 1000 . . gene_id "SS.1035"; transcript_id "SS.1035.1"; cov "3953.273273"; FPKM "193.332850"; TPM "413.412670"; +CM143127.1 StringTie exon 2895003 2896001 1000 . . gene_id "SS.1035"; transcript_id "SS.1035.1"; exon_number "1"; cov "3953.273193"; +CM143127.1 StringTie transcript 2898906 2900002 1000 . . gene_id "SS.1036"; transcript_id "SS.1036.1"; cov "2271.335460"; FPKM "111.078524"; TPM "237.524399"; +CM143127.1 StringTie exon 2898906 2900002 1000 . . gene_id "SS.1036"; transcript_id "SS.1036.1"; exon_number "1"; cov "2271.335449"; +CM143127.1 StringTie transcript 2900343 2901410 1000 . . gene_id "SS.1037"; transcript_id "SS.1037.1"; cov "1684.893258"; FPKM "82.398861"; TPM "176.197336"; +CM143127.1 StringTie exon 2900343 2901410 1000 . . gene_id "SS.1037"; transcript_id "SS.1037.1"; exon_number "1"; cov "1684.893311"; +CM143127.1 StringTie transcript 2901741 2907718 1000 . . gene_id "SS.1038"; transcript_id "SS.1038.1"; cov "250.832051"; FPKM "12.266816"; TPM "26.230706"; +CM143127.1 StringTie exon 2901741 2907718 1000 . . gene_id "SS.1038"; transcript_id "SS.1038.1"; exon_number "1"; cov "250.832047"; +CM143127.1 StringTie transcript 2908708 2909362 1000 . . gene_id "SS.1039"; transcript_id "SS.1039.1"; cov "1619.207634"; FPKM "79.186539"; TPM "169.328277"; +CM143127.1 StringTie exon 2908708 2909362 1000 . . gene_id "SS.1039"; transcript_id "SS.1039.1"; exon_number "1"; cov "1619.207642"; +CM143127.1 StringTie transcript 2909846 2913660 1000 . . gene_id "SS.1040"; transcript_id "SS.1040.1"; cov "281.388991"; FPKM "13.761188"; TPM "29.426191"; +CM143127.1 StringTie exon 2909846 2913660 1000 . . gene_id "SS.1040"; transcript_id "SS.1040.1"; exon_number "1"; cov "281.388977"; +CM143127.1 StringTie transcript 2915159 2916108 1000 . . gene_id "SS.1041"; transcript_id "SS.1041.1"; cov "586.949474"; FPKM "28.704470"; TPM "61.380110"; +CM143127.1 StringTie exon 2915159 2916108 1000 . . gene_id "SS.1041"; transcript_id "SS.1041.1"; exon_number "1"; cov "586.949463"; +CM143127.1 StringTie transcript 2923643 2924689 1000 - . gene_id "SS.1042"; transcript_id "SS.1042.1"; cov "16727.068093"; FPKM "818.028891"; TPM "1749.229413"; +CM143127.1 StringTie exon 2923643 2924106 1000 - . gene_id "SS.1042"; transcript_id "SS.1042.1"; exon_number "1"; cov "18391.138672"; +CM143127.1 StringTie exon 2924640 2924689 1000 - . gene_id "SS.1042"; transcript_id "SS.1042.1"; exon_number "2"; cov "1284.500000"; +CM143127.1 StringTie transcript 2925003 2927370 1000 - . gene_id "SS.1043"; transcript_id "SS.1043.1"; cov "5350.567972"; FPKM "261.666848"; TPM "559.534452"; +CM143127.1 StringTie exon 2925003 2926299 1000 - . gene_id "SS.1043"; transcript_id "SS.1043.1"; exon_number "1"; cov "5728.066895"; +CM143127.1 StringTie exon 2927268 2927370 1000 - . gene_id "SS.1043"; transcript_id "SS.1043.1"; exon_number "2"; cov "597.011292"; +CM143127.1 StringTie transcript 2925003 2927370 1000 - . gene_id "SS.1043"; transcript_id "SS.1043.2"; cov "1037.038539"; FPKM "50.715851"; TPM "108.448074"; +CM143127.1 StringTie exon 2925003 2926299 1000 - . gene_id "SS.1043"; transcript_id "SS.1043.2"; exon_number "1"; cov "1584.579590"; +CM143127.1 StringTie exon 2926473 2927370 1000 - . gene_id "SS.1043"; transcript_id "SS.1043.2"; exon_number "2"; cov "246.213638"; +CM143127.1 StringTie transcript 2927765 2929446 1000 . . gene_id "SS.1044"; transcript_id "SS.1044.1"; cov "508.410820"; FPKM "24.863577"; TPM "53.166948"; +CM143127.1 StringTie exon 2927765 2929446 1000 . . gene_id "SS.1044"; transcript_id "SS.1044.1"; exon_number "1"; cov "508.410828"; +CM143127.1 StringTie transcript 2929814 2931005 1000 . . gene_id "SS.1045"; transcript_id "SS.1045.1"; cov "733.763423"; FPKM "35.884333"; TPM "76.733146"; +CM143127.1 StringTie exon 2929814 2931005 1000 . . gene_id "SS.1045"; transcript_id "SS.1045.1"; exon_number "1"; cov "733.763428"; +CM143127.1 StringTie transcript 2931567 2934475 1000 . . gene_id "SS.1046"; transcript_id "SS.1046.1"; cov "178.453077"; FPKM "8.727158"; TPM "18.661691"; +CM143127.1 StringTie exon 2931567 2934475 1000 . . gene_id "SS.1046"; transcript_id "SS.1046.1"; exon_number "1"; cov "178.453079"; +CM143127.1 StringTie transcript 2952268 2953873 1000 . . gene_id "SS.1047"; transcript_id "SS.1047.1"; cov "164.851183"; FPKM "8.061965"; TPM "17.239276"; +CM143127.1 StringTie exon 2952268 2953873 1000 . . gene_id "SS.1047"; transcript_id "SS.1047.1"; exon_number "1"; cov "164.851181"; +CM143127.1 StringTie transcript 2954257 2954960 1000 . . gene_id "SS.1048"; transcript_id "SS.1048.1"; cov "276.828125"; FPKM "13.538141"; TPM "28.949239"; +CM143127.1 StringTie exon 2954257 2954960 1000 . . gene_id "SS.1048"; transcript_id "SS.1048.1"; exon_number "1"; cov "276.828125"; +CM143127.1 StringTie transcript 2960456 2962793 1000 . . gene_id "SS.1049"; transcript_id "SS.1049.1"; cov "59.953519"; FPKM "2.931997"; TPM "6.269626"; +CM143127.1 StringTie exon 2960456 2962793 1000 . . gene_id "SS.1049"; transcript_id "SS.1049.1"; exon_number "1"; cov "59.953518"; +CM143127.1 StringTie transcript 2935803 2937185 1000 + . gene_id "SS.1050"; transcript_id "SS.1050.1"; cov "23758.863075"; FPKM "1161.915305"; TPM "2484.577804"; +CM143127.1 StringTie exon 2935803 2935914 1000 + . gene_id "SS.1050"; transcript_id "SS.1050.1"; exon_number "1"; cov "9354.080078"; +CM143127.1 StringTie exon 2936407 2937185 1000 + . gene_id "SS.1050"; transcript_id "SS.1050.1"; exon_number "2"; cov "25829.896484"; +CM143127.1 StringTie transcript 2938433 2939529 1000 . . gene_id "SS.1051"; transcript_id "SS.1051.1"; cov "4791.948952"; FPKM "234.347865"; TPM "501.116992"; +CM143127.1 StringTie exon 2938433 2939529 1000 . . gene_id "SS.1051"; transcript_id "SS.1051.1"; exon_number "1"; cov "4791.948730"; +CM143127.1 StringTie transcript 2941228 2943031 1000 . . gene_id "SS.1052"; transcript_id "SS.1052.1"; cov "3668.054324"; FPKM "179.384360"; TPM "383.585962"; +CM143127.1 StringTie exon 2941228 2943031 1000 . . gene_id "SS.1052"; transcript_id "SS.1052.1"; exon_number "1"; cov "3668.054443"; +CM143127.1 StringTie transcript 2949024 2951809 1000 - . gene_id "SS.1053"; transcript_id "SS.1053.1"; cov "1309.130257"; FPKM "64.022360"; TPM "136.902005"; +CM143127.1 StringTie exon 2949024 2951622 1000 - . gene_id "SS.1053"; transcript_id "SS.1053.1"; exon_number "1"; cov "1347.483276"; +CM143127.1 StringTie exon 2951722 2951809 1000 - . gene_id "SS.1053"; transcript_id "SS.1053.1"; exon_number "2"; cov "176.409088"; +CM143127.1 StringTie transcript 2963028 2964491 1000 . . gene_id "SS.1054"; transcript_id "SS.1054.1"; cov "51.771858"; FPKM "2.531877"; TPM "5.414030"; +CM143127.1 StringTie exon 2963028 2964491 1000 . . gene_id "SS.1054"; transcript_id "SS.1054.1"; exon_number "1"; cov "51.771858"; +CM143127.1 StringTie transcript 2967739 2969364 1000 . . gene_id "SS.1055"; transcript_id "SS.1055.1"; cov "12519.768758"; FPKM "612.273024"; TPM "1309.252024"; +CM143127.1 StringTie exon 2967739 2969364 1000 . . gene_id "SS.1055"; transcript_id "SS.1055.1"; exon_number "1"; cov "12519.768555"; +CM143127.1 StringTie transcript 2970319 2973069 1000 - . gene_id "SS.1056"; transcript_id "SS.1056.1"; cov "2627.321121"; FPKM "128.487824"; TPM "274.751520"; +CM143127.1 StringTie exon 2970319 2972943 1000 - . gene_id "SS.1056"; transcript_id "SS.1056.1"; exon_number "1"; cov "2672.233154"; +CM143127.1 StringTie exon 2973020 2973069 1000 - . gene_id "SS.1056"; transcript_id "SS.1056.1"; exon_number "2"; cov "269.440002"; +CM143127.1 StringTie transcript 2985241 2986588 1000 . . gene_id "SS.1057"; transcript_id "SS.1057.1"; cov "984.057122"; FPKM "48.124821"; TPM "102.907554"; +CM143127.1 StringTie exon 2985241 2986588 1000 . . gene_id "SS.1057"; transcript_id "SS.1057.1"; exon_number "1"; cov "984.057129"; +CM143127.1 StringTie transcript 3038931 3039562 1000 . . gene_id "SS.1058"; transcript_id "SS.1058.1"; cov "11.449367"; FPKM "0.559926"; TPM "1.197315"; +CM143127.1 StringTie exon 3038931 3039562 1000 . . gene_id "SS.1058"; transcript_id "SS.1058.1"; exon_number "1"; cov "11.449368"; +CM143127.1 StringTie transcript 3039919 3043170 1000 . . gene_id "SS.1059"; transcript_id "SS.1059.1"; cov "367.997232"; FPKM "17.996720"; TPM "38.483228"; +CM143127.1 StringTie exon 3039919 3043170 1000 . . gene_id "SS.1059"; transcript_id "SS.1059.1"; exon_number "1"; cov "367.997223"; +CM143127.1 StringTie transcript 2996151 2997334 1000 . . gene_id "SS.1060"; transcript_id "SS.1060.1"; cov "1104.642736"; FPKM "54.022000"; TPM "115.517768"; +CM143127.1 StringTie exon 2996151 2997334 1000 . . gene_id "SS.1060"; transcript_id "SS.1060.1"; exon_number "1"; cov "1104.642700"; +CM143127.1 StringTie transcript 2998078 3000015 1000 . . gene_id "SS.1061"; transcript_id "SS.1061.1"; cov "1606.389577"; FPKM "78.559678"; TPM "167.987832"; +CM143127.1 StringTie exon 2998078 3000015 1000 . . gene_id "SS.1061"; transcript_id "SS.1061.1"; exon_number "1"; cov "1606.389526"; +CM143127.1 StringTie transcript 3000260 3003861 1000 + . gene_id "SS.1062"; transcript_id "SS.1062.1"; cov "836.380508"; FPKM "40.902770"; TPM "87.464305"; +CM143127.1 StringTie exon 3000260 3000657 1000 + . gene_id "SS.1062"; transcript_id "SS.1062.1"; exon_number "1"; cov "501.193481"; +CM143127.1 StringTie exon 3000720 3003861 1000 + . gene_id "SS.1062"; transcript_id "SS.1062.1"; exon_number "2"; cov "878.838928"; +CM143127.1 StringTie transcript 3004355 3005488 1000 . . gene_id "SS.1063"; transcript_id "SS.1063.1"; cov "2074.417989"; FPKM "101.448373"; TPM "216.931798"; +CM143127.1 StringTie exon 3004355 3005488 1000 . . gene_id "SS.1063"; transcript_id "SS.1063.1"; exon_number "1"; cov "2074.417969"; +CM143127.1 StringTie transcript 3005928 3013601 1000 . . gene_id "SS.1064"; transcript_id "SS.1064.1"; cov "983.074407"; FPKM "48.076762"; TPM "102.804787"; +CM143127.1 StringTie exon 3005928 3013601 1000 . . gene_id "SS.1064"; transcript_id "SS.1064.1"; exon_number "1"; cov "983.074402"; +CM143127.1 StringTie transcript 3015066 3016763 1000 . . gene_id "SS.1065"; transcript_id "SS.1065.1"; cov "628.809776"; FPKM "30.751627"; TPM "65.757642"; +CM143127.1 StringTie exon 3015066 3016763 1000 . . gene_id "SS.1065"; transcript_id "SS.1065.1"; exon_number "1"; cov "628.809753"; +CM143127.1 StringTie transcript 3017009 3024473 1000 . . gene_id "SS.1066"; transcript_id "SS.1066.1"; cov "193.861755"; FPKM "9.480712"; TPM "20.273050"; +CM143127.1 StringTie exon 3017009 3024473 1000 . . gene_id "SS.1066"; transcript_id "SS.1066.1"; exon_number "1"; cov "193.861755"; +CM143127.1 StringTie transcript 3024733 3027507 1000 . . gene_id "SS.1067"; transcript_id "SS.1067.1"; cov "146.718198"; FPKM "7.175180"; TPM "15.343023"; +CM143127.1 StringTie exon 3024733 3027507 1000 . . gene_id "SS.1067"; transcript_id "SS.1067.1"; exon_number "1"; cov "146.718201"; +CM143127.1 StringTie transcript 3028811 3031543 1000 + . gene_id "SS.1068"; transcript_id "SS.1068.1"; cov "401.200080"; FPKM "19.620489"; TPM "41.955409"; +CM143127.1 StringTie exon 3028811 3028914 1000 + . gene_id "SS.1068"; transcript_id "SS.1068.1"; exon_number "1"; cov "117.961540"; +CM143127.1 StringTie exon 3029149 3031543 1000 + . gene_id "SS.1068"; transcript_id "SS.1068.1"; exon_number "2"; cov "413.499359"; +CM143127.1 StringTie transcript 3031764 3033442 1000 . . gene_id "SS.1069"; transcript_id "SS.1069.1"; cov "4479.104229"; FPKM "219.048350"; TPM "468.401325"; +CM143127.1 StringTie exon 3031764 3033442 1000 . . gene_id "SS.1069"; transcript_id "SS.1069.1"; exon_number "1"; cov "4479.104004"; +CM143127.1 StringTie transcript 3034367 3035459 1000 + . gene_id "SS.1070"; transcript_id "SS.1070.1"; cov "24491.311912"; FPKM "1197.735349"; TPM "2561.173478"; +CM143127.1 StringTie exon 3034367 3034418 1000 + . gene_id "SS.1070"; transcript_id "SS.1070.1"; exon_number "1"; cov "3642.596191"; +CM143127.1 StringTie exon 3034874 3035459 1000 + . gene_id "SS.1070"; transcript_id "SS.1070.1"; exon_number "2"; cov "26341.369141"; +CM143127.1 StringTie transcript 3037616 3038196 1000 . . gene_id "SS.1071"; transcript_id "SS.1071.1"; cov "1096.655766"; FPKM "53.631401"; TPM "114.682532"; +CM143127.1 StringTie exon 3037616 3038196 1000 . . gene_id "SS.1071"; transcript_id "SS.1071.1"; exon_number "1"; cov "1096.655762"; +CM143127.1 StringTie transcript 3044717 3046696 1000 . . gene_id "SS.1072"; transcript_id "SS.1072.1"; cov "10199.149495"; FPKM "498.784300"; TPM "1066.573783"; +CM143127.1 StringTie exon 3044717 3046696 1000 . . gene_id "SS.1072"; transcript_id "SS.1072.1"; exon_number "1"; cov "10199.149414"; +CM143127.1 StringTie transcript 3064598 3065379 1000 . . gene_id "SS.1073"; transcript_id "SS.1073.1"; cov "14.998721"; FPKM "0.733505"; TPM "1.568488"; +CM143127.1 StringTie exon 3064598 3065379 1000 . . gene_id "SS.1073"; transcript_id "SS.1073.1"; exon_number "1"; cov "14.998721"; +CM143127.1 StringTie transcript 3049230 3064254 1000 . . gene_id "SS.1074"; transcript_id "SS.1074.1"; cov "702.539700"; FPKM "34.357352"; TPM "73.467932"; +CM143127.1 StringTie exon 3049230 3064254 1000 . . gene_id "SS.1074"; transcript_id "SS.1074.1"; exon_number "1"; cov "702.539673"; +CM143127.1 StringTie transcript 3066799 3070390 1000 . . gene_id "SS.1075"; transcript_id "SS.1075.1"; cov "173.949332"; FPKM "8.506905"; TPM "18.190713"; +CM143127.1 StringTie exon 3066799 3070390 1000 . . gene_id "SS.1075"; transcript_id "SS.1075.1"; exon_number "1"; cov "173.949326"; +CM143127.1 StringTie transcript 3070844 3077074 1000 . . gene_id "SS.1076"; transcript_id "SS.1076.1"; cov "294.901942"; FPKM "14.422032"; TPM "30.839305"; +CM143127.1 StringTie exon 3070844 3077074 1000 . . gene_id "SS.1076"; transcript_id "SS.1076.1"; exon_number "1"; cov "294.901947"; +CM143127.1 StringTie transcript 3077468 3084347 1000 . . gene_id "SS.1077"; transcript_id "SS.1077.1"; cov "804.737355"; FPKM "39.355277"; TPM "84.155229"; +CM143127.1 StringTie exon 3077468 3084347 1000 . . gene_id "SS.1077"; transcript_id "SS.1077.1"; exon_number "1"; cov "804.737366"; +CM143127.1 StringTie transcript 3085107 3085962 1000 - . gene_id "SS.1078"; transcript_id "SS.1078.1"; cov "893.561238"; FPKM "43.699165"; TPM "93.443967"; +CM143127.1 StringTie exon 3085107 3085539 1000 - . gene_id "SS.1078"; transcript_id "SS.1078.1"; exon_number "1"; cov "1029.050781"; +CM143127.1 StringTie exon 3085653 3085962 1000 - . gene_id "SS.1078"; transcript_id "SS.1078.1"; exon_number "2"; cov "704.312927"; +CM143127.1 StringTie transcript 3086223 3088011 1000 . . gene_id "SS.1079"; transcript_id "SS.1079.1"; cov "650.762996"; FPKM "31.825239"; TPM "68.053395"; +CM143127.1 StringTie exon 3086223 3088011 1000 . . gene_id "SS.1079"; transcript_id "SS.1079.1"; exon_number "1"; cov "650.763000"; +CM143127.1 StringTie transcript 3088692 3089541 1000 . . gene_id "SS.1080"; transcript_id "SS.1080.1"; cov "1758.202353"; FPKM "85.984006"; TPM "183.863619"; +CM143127.1 StringTie exon 3088692 3089541 1000 . . gene_id "SS.1080"; transcript_id "SS.1080.1"; exon_number "1"; cov "1758.202393"; +CM143127.1 StringTie transcript 3089884 3091183 1000 - . gene_id "SS.1081"; transcript_id "SS.1081.1"; cov "25225.698734"; FPKM "1233.650169"; TPM "2637.971816"; +CM143127.1 StringTie exon 3089884 3090563 1000 - . gene_id "SS.1081"; transcript_id "SS.1081.1"; exon_number "1"; cov "29213.349609"; +CM143127.1 StringTie exon 3091074 3091183 1000 - . gene_id "SS.1081"; transcript_id "SS.1081.1"; exon_number "2"; cov "574.763611"; +CM143127.1 StringTie transcript 3093833 3097878 1000 . . gene_id "SS.1082"; transcript_id "SS.1082.1"; cov "797.648047"; FPKM "39.008578"; TPM "83.413867"; +CM143127.1 StringTie exon 3093833 3097878 1000 . . gene_id "SS.1082"; transcript_id "SS.1082.1"; exon_number "1"; cov "797.648071"; +CM143127.1 StringTie transcript 3098244 3100580 1000 . . gene_id "SS.1083"; transcript_id "SS.1083.1"; cov "701.135216"; FPKM "34.288667"; TPM "73.321059"; +CM143127.1 StringTie exon 3098244 3100580 1000 . . gene_id "SS.1083"; transcript_id "SS.1083.1"; exon_number "1"; cov "701.135193"; +CM143127.1 StringTie transcript 3100819 3102831 1000 . . gene_id "SS.1084"; transcript_id "SS.1084.1"; cov "307.117735"; FPKM "15.019439"; TPM "32.116769"; +CM143127.1 StringTie exon 3100819 3102831 1000 . . gene_id "SS.1084"; transcript_id "SS.1084.1"; exon_number "1"; cov "307.117737"; +CM143127.1 StringTie transcript 3103154 3106102 1000 - . gene_id "SS.1085"; transcript_id "SS.1085.1"; cov "1549.142211"; FPKM "75.760024"; TPM "162.001201"; +CM143127.1 StringTie exon 3103154 3105970 1000 - . gene_id "SS.1085"; transcript_id "SS.1085.1"; exon_number "1"; cov "1572.698242"; +CM143127.1 StringTie exon 3106044 3106102 1000 - . gene_id "SS.1085"; transcript_id "SS.1085.1"; exon_number "2"; cov "424.440674"; +CM143127.1 StringTie transcript 3106358 3107519 1000 . . gene_id "SS.1086"; transcript_id "SS.1086.1"; cov "1878.402754"; FPKM "91.862346"; TPM "196.433549"; +CM143127.1 StringTie exon 3106358 3107519 1000 . . gene_id "SS.1086"; transcript_id "SS.1086.1"; exon_number "1"; cov "1878.402710"; +CM143127.1 StringTie transcript 3115611 3117803 1000 . . gene_id "SS.1087"; transcript_id "SS.1087.1"; cov "153.430917"; FPKM "7.503462"; TPM "16.045004"; +CM143127.1 StringTie exon 3115611 3117803 1000 . . gene_id "SS.1087"; transcript_id "SS.1087.1"; exon_number "1"; cov "153.430923"; +CM143127.1 StringTie transcript 3118304 3119012 1000 . . gene_id "SS.1088"; transcript_id "SS.1088.1"; cov "6811.617772"; FPKM "333.118757"; TPM "712.323409"; +CM143127.1 StringTie exon 3118304 3119012 1000 . . gene_id "SS.1088"; transcript_id "SS.1088.1"; exon_number "1"; cov "6811.617676"; +CM143127.1 StringTie transcript 3119474 3121273 1000 . . gene_id "SS.1089"; transcript_id "SS.1089.1"; cov "624.938889"; FPKM "30.562324"; TPM "65.352845"; +CM143127.1 StringTie exon 3119474 3121273 1000 . . gene_id "SS.1089"; transcript_id "SS.1089.1"; exon_number "1"; cov "624.938904"; +CM143127.1 StringTie transcript 3121721 3124618 1000 . . gene_id "SS.1090"; transcript_id "SS.1090.1"; cov "357.310904"; FPKM "17.474111"; TPM "37.365708"; +CM143127.1 StringTie exon 3121721 3124618 1000 . . gene_id "SS.1090"; transcript_id "SS.1090.1"; exon_number "1"; cov "357.310913"; +CM143127.1 StringTie transcript 3124946 3130440 1000 . . gene_id "SS.1091"; transcript_id "SS.1091.1"; cov "488.719199"; FPKM "23.900568"; TPM "51.107701"; +CM143127.1 StringTie exon 3124946 3130440 1000 . . gene_id "SS.1091"; transcript_id "SS.1091.1"; exon_number "1"; cov "488.719208"; +CM143127.1 StringTie transcript 3134269 3139159 1000 . . gene_id "SS.1092"; transcript_id "SS.1092.1"; cov "1318.234512"; FPKM "64.467599"; TPM "137.854080"; +CM143127.1 StringTie exon 3134269 3139159 1000 . . gene_id "SS.1092"; transcript_id "SS.1092.1"; exon_number "1"; cov "1318.234497"; +CM143127.1 StringTie transcript 3140869 3142030 1000 . . gene_id "SS.1093"; transcript_id "SS.1093.1"; cov "871.606713"; FPKM "42.625490"; TPM "91.148078"; +CM143127.1 StringTie exon 3140869 3142030 1000 . . gene_id "SS.1093"; transcript_id "SS.1093.1"; exon_number "1"; cov "871.606689"; +CM143127.1 StringTie transcript 3142408 3145821 1000 + . gene_id "SS.1094"; transcript_id "SS.1094.1"; cov "807.503242"; FPKM "39.490542"; TPM "84.444471"; +CM143127.1 StringTie exon 3142408 3142651 1000 + . gene_id "SS.1094"; transcript_id "SS.1094.1"; exon_number "1"; cov "109.905739"; +CM143127.1 StringTie exon 3142827 3145821 1000 + . gene_id "SS.1094"; transcript_id "SS.1094.1"; exon_number "2"; cov "864.335876"; +CM143127.1 StringTie transcript 3150945 3152192 1000 . . gene_id "SS.1095"; transcript_id "SS.1095.1"; cov "1923.971154"; FPKM "94.090846"; TPM "201.198854"; +CM143127.1 StringTie exon 3150945 3152192 1000 . . gene_id "SS.1095"; transcript_id "SS.1095.1"; exon_number "1"; cov "1923.971191"; +CM143127.1 StringTie transcript 3152671 3161297 1000 . . gene_id "SS.1096"; transcript_id "SS.1096.1"; cov "243.509795"; FPKM "11.908725"; TPM "25.464982"; +CM143127.1 StringTie exon 3152671 3161297 1000 . . gene_id "SS.1096"; transcript_id "SS.1096.1"; exon_number "1"; cov "243.509796"; +CM143127.1 StringTie transcript 3161728 3162317 1000 . . gene_id "SS.1097"; transcript_id "SS.1097.1"; cov "162.889831"; FPKM "7.966046"; TPM "17.034168"; +CM143127.1 StringTie exon 3161728 3162317 1000 . . gene_id "SS.1097"; transcript_id "SS.1097.1"; exon_number "1"; cov "162.889832"; +CM143127.1 StringTie transcript 3162769 3163887 1000 . . gene_id "SS.1098"; transcript_id "SS.1098.1"; cov "345.049151"; FPKM "16.874456"; TPM "36.083438"; +CM143127.1 StringTie exon 3162769 3163887 1000 . . gene_id "SS.1098"; transcript_id "SS.1098.1"; exon_number "1"; cov "345.049164"; +CM143127.1 StringTie transcript 3164188 3173789 1000 . . gene_id "SS.1099"; transcript_id "SS.1099.1"; cov "353.848209"; FPKM "17.304770"; TPM "37.003597"; +CM143127.1 StringTie exon 3164188 3173789 1000 . . gene_id "SS.1099"; transcript_id "SS.1099.1"; exon_number "1"; cov "353.848206"; +CM143127.1 StringTie transcript 3174356 3183021 1000 . . gene_id "SS.1100"; transcript_id "SS.1100.1"; cov "373.812428"; FPKM "18.281110"; TPM "39.091351"; +CM143127.1 StringTie exon 3174356 3183021 1000 . . gene_id "SS.1100"; transcript_id "SS.1100.1"; exon_number "1"; cov "373.812439"; +CM143127.1 StringTie transcript 3182259 3183021 1000 - . gene_id "SS.1101"; transcript_id "SS.1101.1"; cov "260.135048"; FPKM "12.721774"; TPM "27.203565"; +CM143127.1 StringTie exon 3182259 3182787 1000 - . gene_id "SS.1101"; transcript_id "SS.1101.1"; exon_number "1"; cov "300.336609"; +CM143127.1 StringTie exon 3182873 3183021 1000 - . gene_id "SS.1101"; transcript_id "SS.1101.1"; exon_number "2"; cov "117.406044"; +CM143127.1 StringTie transcript 3183248 3184527 1000 . . gene_id "SS.1102"; transcript_id "SS.1102.1"; cov "786.066406"; FPKM "38.442184"; TPM "82.202719"; +CM143127.1 StringTie exon 3183248 3184527 1000 . . gene_id "SS.1102"; transcript_id "SS.1102.1"; exon_number "1"; cov "786.066406"; +CM143127.1 StringTie transcript 3184775 3185859 1000 . . gene_id "SS.1103"; transcript_id "SS.1103.1"; cov "690.942857"; FPKM "33.790215"; TPM "72.255195"; +CM143127.1 StringTie exon 3184775 3185859 1000 . . gene_id "SS.1103"; transcript_id "SS.1103.1"; exon_number "1"; cov "690.942871"; +CM143127.1 StringTie transcript 3189489 3195108 1000 . . gene_id "SS.1104"; transcript_id "SS.1104.1"; cov "870.582740"; FPKM "42.575413"; TPM "91.040996"; +CM143127.1 StringTie exon 3189489 3195108 1000 . . gene_id "SS.1104"; transcript_id "SS.1104.1"; exon_number "1"; cov "870.582764"; +CM143127.1 StringTie transcript 3195709 3201303 1000 . . gene_id "SS.1105"; transcript_id "SS.1105.1"; cov "688.485612"; FPKM "33.670044"; TPM "71.998229"; +CM143127.1 StringTie exon 3195709 3201303 1000 . . gene_id "SS.1105"; transcript_id "SS.1105.1"; exon_number "1"; cov "688.485596"; +CM143127.1 StringTie transcript 3201592 3207629 1000 . . gene_id "SS.1106"; transcript_id "SS.1106.1"; cov "254.605664"; FPKM "12.451363"; TPM "26.625330"; +CM143127.1 StringTie exon 3201592 3207629 1000 . . gene_id "SS.1106"; transcript_id "SS.1106.1"; exon_number "1"; cov "254.605667"; +CM143127.1 StringTie transcript 3208606 3210774 1000 . . gene_id "SS.1107"; transcript_id "SS.1107.1"; cov "190.909636"; FPKM "9.336340"; TPM "19.964333"; +CM143127.1 StringTie exon 3208606 3210774 1000 . . gene_id "SS.1107"; transcript_id "SS.1107.1"; exon_number "1"; cov "190.909637"; +CM143127.1 StringTie transcript 3211377 3212879 1000 - . gene_id "SS.1108"; transcript_id "SS.1108.1"; cov "929.413258"; FPKM "45.452490"; TPM "97.193184"; +CM143127.1 StringTie exon 3211377 3212526 1000 - . gene_id "SS.1108"; transcript_id "SS.1108.1"; exon_number "1"; cov "1070.551270"; +CM143127.1 StringTie exon 3212612 3212879 1000 - . gene_id "SS.1108"; transcript_id "SS.1108.1"; exon_number "2"; cov "323.783569"; +CM143127.1 StringTie transcript 3213500 3215539 1000 . . gene_id "SS.1109"; transcript_id "SS.1109.1"; cov "465.647059"; FPKM "22.772236"; TPM "48.694937"; +CM143127.1 StringTie exon 3213500 3215539 1000 . . gene_id "SS.1109"; transcript_id "SS.1109.1"; exon_number "1"; cov "465.647064"; +CM143127.1 StringTie transcript 3217349 3218942 1000 - . gene_id "SS.1110"; transcript_id "SS.1110.1"; cov "25026.430743"; FPKM "1223.905067"; TPM "2617.133410"; +CM143127.1 StringTie exon 3217349 3218225 1000 - . gene_id "SS.1110"; transcript_id "SS.1110.1"; exon_number "1"; cov "33715.011719"; +CM143127.1 StringTie exon 3218636 3218942 1000 - . gene_id "SS.1110"; transcript_id "SS.1110.1"; exon_number "2"; cov "205.954391"; +CM143127.1 StringTie transcript 3219345 3220345 1000 - . gene_id "SS.1111"; transcript_id "SS.1111.1"; cov "2248.585294"; FPKM "109.965938"; TPM "235.145305"; +CM143127.1 StringTie exon 3219345 3219896 1000 - . gene_id "SS.1111"; transcript_id "SS.1111.1"; exon_number "1"; cov "2642.753662"; +CM143127.1 StringTie exon 3220099 3220117 1000 - . gene_id "SS.1111"; transcript_id "SS.1111.1"; exon_number "2"; cov "1387.157837"; +CM143127.1 StringTie exon 3220237 3220345 1000 - . gene_id "SS.1111"; transcript_id "SS.1111.1"; exon_number "3"; cov "402.587158"; +CM143127.1 StringTie transcript 3223734 3226453 1000 + . gene_id "SS.1112"; transcript_id "SS.1112.1"; cov "175.557990"; FPKM "8.585576"; TPM "18.358938"; +CM143127.1 StringTie exon 3223734 3223922 1000 + . gene_id "SS.1112"; transcript_id "SS.1112.1"; exon_number "1"; cov "358.052917"; +CM143127.1 StringTie exon 3223996 3226453 1000 + . gene_id "SS.1112"; transcript_id "SS.1112.1"; exon_number "2"; cov "161.525635"; +CM143127.1 StringTie transcript 3226877 3230960 1000 . . gene_id "SS.1113"; transcript_id "SS.1113.1"; cov "1541.272282"; FPKM "75.375149"; TPM "161.178205"; +CM143127.1 StringTie exon 3226877 3230960 1000 . . gene_id "SS.1113"; transcript_id "SS.1113.1"; exon_number "1"; cov "1541.272339"; +CM143127.1 StringTie transcript 3231331 3233839 1000 . . gene_id "SS.1114"; transcript_id "SS.1114.1"; cov "353.317258"; FPKM "17.278804"; TPM "36.948073"; +CM143127.1 StringTie exon 3231331 3233839 1000 . . gene_id "SS.1114"; transcript_id "SS.1114.1"; exon_number "1"; cov "353.317261"; +CM143127.1 StringTie transcript 3234548 3237056 1000 . . gene_id "SS.1115"; transcript_id "SS.1115.1"; cov "485.450379"; FPKM "23.740708"; TPM "50.765865"; +CM143127.1 StringTie exon 3234548 3237056 1000 . . gene_id "SS.1115"; transcript_id "SS.1115.1"; exon_number "1"; cov "485.450378"; +CM143127.1 StringTie transcript 3237263 3243712 1000 . . gene_id "SS.1116"; transcript_id "SS.1116.1"; cov "475.396744"; FPKM "23.249040"; TPM "49.714508"; +CM143127.1 StringTie exon 3237263 3243712 1000 . . gene_id "SS.1116"; transcript_id "SS.1116.1"; exon_number "1"; cov "475.396759"; +CM143127.1 StringTie transcript 3249986 3252319 1000 . . gene_id "SS.1117"; transcript_id "SS.1117.1"; cov "1377.231791"; FPKM "67.352831"; TPM "144.023707"; +CM143127.1 StringTie exon 3249986 3252319 1000 . . gene_id "SS.1117"; transcript_id "SS.1117.1"; exon_number "1"; cov "1377.231812"; +CM143127.1 StringTie transcript 3252607 3254275 1000 . . gene_id "SS.1118"; transcript_id "SS.1118.1"; cov "6480.602756"; FPKM "316.930634"; TPM "677.707587"; +CM143127.1 StringTie exon 3252607 3254275 1000 . . gene_id "SS.1118"; transcript_id "SS.1118.1"; exon_number "1"; cov "6480.602539"; +CM143127.1 StringTie transcript 3254765 3259073 1000 . . gene_id "SS.1119"; transcript_id "SS.1119.1"; cov "773.150151"; FPKM "37.810521"; TPM "80.852005"; +CM143127.1 StringTie exon 3254765 3259073 1000 . . gene_id "SS.1119"; transcript_id "SS.1119.1"; exon_number "1"; cov "773.150146"; +CM143127.1 StringTie transcript 3260033 3262867 1000 . . gene_id "SS.1120"; transcript_id "SS.1120.1"; cov "1306.868783"; FPKM "63.911764"; TPM "136.665511"; +CM143127.1 StringTie exon 3260033 3262867 1000 . . gene_id "SS.1120"; transcript_id "SS.1120.1"; exon_number "1"; cov "1306.868774"; +CM143127.1 StringTie transcript 3322880 3323246 1000 . . gene_id "SS.1121"; transcript_id "SS.1121.1"; cov "23.223433"; FPKM "1.135730"; TPM "2.428585"; +CM143127.1 StringTie exon 3322880 3323246 1000 . . gene_id "SS.1121"; transcript_id "SS.1121.1"; exon_number "1"; cov "23.223433"; +CM143127.1 StringTie transcript 3269267 3272200 1000 . . gene_id "SS.1122"; transcript_id "SS.1122.1"; cov "1272.065781"; FPKM "62.209740"; TPM "133.025995"; +CM143127.1 StringTie exon 3269267 3272200 1000 . . gene_id "SS.1122"; transcript_id "SS.1122.1"; exon_number "1"; cov "1272.065796"; +CM143127.1 StringTie transcript 3272422 3276778 1000 . . gene_id "SS.1123"; transcript_id "SS.1123.1"; cov "228.190039"; FPKM "11.159520"; TPM "23.862922"; +CM143127.1 StringTie exon 3272422 3276778 1000 . . gene_id "SS.1123"; transcript_id "SS.1123.1"; exon_number "1"; cov "228.190033"; +CM143127.1 StringTie transcript 3277353 3280014 1000 . . gene_id "SS.1124"; transcript_id "SS.1124.1"; cov "449.388430"; FPKM "21.977116"; TPM "46.994695"; +CM143127.1 StringTie exon 3277353 3280014 1000 . . gene_id "SS.1124"; transcript_id "SS.1124.1"; exon_number "1"; cov "449.388428"; +CM143127.1 StringTie transcript 3281050 3282435 1000 + . gene_id "SS.1125"; transcript_id "SS.1125.1"; cov "3961.673122"; FPKM "193.743641"; TPM "414.291083"; +CM143127.1 StringTie exon 3281050 3281201 1000 + . gene_id "SS.1125"; transcript_id "SS.1125.1"; exon_number "1"; cov "1064.039429"; +CM143127.1 StringTie exon 3281297 3282435 1000 + . gene_id "SS.1125"; transcript_id "SS.1125.1"; exon_number "2"; cov "4348.363281"; +CM143127.1 StringTie transcript 3284634 3288277 1000 . . gene_id "SS.1126"; transcript_id "SS.1126.1"; cov "258.354007"; FPKM "12.634673"; TPM "27.017313"; +CM143127.1 StringTie exon 3284634 3288277 1000 . . gene_id "SS.1126"; transcript_id "SS.1126.1"; exon_number "1"; cov "258.354004"; +CM143127.1 StringTie transcript 3291167 3294312 1000 + . gene_id "SS.1127"; transcript_id "SS.1127.1"; cov "264.756686"; FPKM "12.947793"; TPM "27.686871"; +CM143127.1 StringTie exon 3291167 3291254 1000 + . gene_id "SS.1127"; transcript_id "SS.1127.1"; exon_number "1"; cov "61.625000"; +CM143127.1 StringTie exon 3291335 3294312 1000 + . gene_id "SS.1127"; transcript_id "SS.1127.1"; exon_number "2"; cov "270.759247"; +CM143127.1 StringTie transcript 3294635 3296978 1000 . . gene_id "SS.1128"; transcript_id "SS.1128.1"; cov "2720.406570"; FPKM "133.040121"; TPM "284.485910"; +CM143127.1 StringTie exon 3294635 3296978 1000 . . gene_id "SS.1128"; transcript_id "SS.1128.1"; exon_number "1"; cov "2720.406494"; +CM143127.1 StringTie transcript 3297425 3298535 1000 . . gene_id "SS.1129"; transcript_id "SS.1129.1"; cov "7336.717372"; FPKM "358.798490"; TPM "767.235582"; +CM143127.1 StringTie exon 3297425 3298535 1000 . . gene_id "SS.1129"; transcript_id "SS.1129.1"; exon_number "1"; cov "7336.717285"; +CM143127.1 StringTie transcript 3298976 3301916 1000 . . gene_id "SS.1130"; transcript_id "SS.1130.1"; cov "962.264196"; FPKM "47.059049"; TPM "100.628564"; +CM143127.1 StringTie exon 3298976 3301916 1000 . . gene_id "SS.1130"; transcript_id "SS.1130.1"; exon_number "1"; cov "962.264221"; +CM143127.1 StringTie transcript 3302520 3303185 1000 - . gene_id "SS.1131"; transcript_id "SS.1131.1"; cov "1814.811847"; FPKM "88.752465"; TPM "189.783544"; +CM143127.1 StringTie exon 3302520 3302958 1000 - . gene_id "SS.1131"; transcript_id "SS.1131.1"; exon_number "1"; cov "2093.817871"; +CM143127.1 StringTie exon 3303051 3303185 1000 - . gene_id "SS.1131"; transcript_id "SS.1131.1"; exon_number "2"; cov "907.525940"; +CM143127.1 StringTie transcript 3303457 3307651 1000 + . gene_id "SS.1132"; transcript_id "SS.1132.1"; cov "545.067218"; FPKM "26.656239"; TPM "57.000283"; +CM143127.1 StringTie exon 3303457 3305417 1000 + . gene_id "SS.1132"; transcript_id "SS.1132.1"; exon_number "1"; cov "293.330414"; +CM143127.1 StringTie exon 3305747 3305888 1000 + . gene_id "SS.1132"; transcript_id "SS.1132.1"; exon_number "2"; cov "659.380005"; +CM143127.1 StringTie exon 3306266 3307651 1000 + . gene_id "SS.1132"; transcript_id "SS.1132.1"; exon_number "3"; cov "889.528564"; +CM143127.1 StringTie transcript 3303457 3307651 1000 + . gene_id "SS.1132"; transcript_id "SS.1132.2"; cov "136.946377"; FPKM "6.697294"; TPM "14.321137"; +CM143127.1 StringTie exon 3303457 3305417 1000 + . gene_id "SS.1132"; transcript_id "SS.1132.2"; exon_number "1"; cov "70.525764"; +CM143127.1 StringTie exon 3305514 3305888 1000 + . gene_id "SS.1132"; transcript_id "SS.1132.2"; exon_number "2"; cov "199.970764"; +CM143127.1 StringTie exon 3306266 3307651 1000 + . gene_id "SS.1132"; transcript_id "SS.1132.2"; exon_number "3"; cov "213.870377"; +CM143127.1 StringTie transcript 3310624 3311759 1000 . . gene_id "SS.1133"; transcript_id "SS.1133.1"; cov "1412.261444"; FPKM "69.065939"; TPM "147.686925"; +CM143127.1 StringTie exon 3310624 3311759 1000 . . gene_id "SS.1133"; transcript_id "SS.1133.1"; exon_number "1"; cov "1412.261475"; +CM143127.1 StringTie transcript 3312101 3313948 1000 . . gene_id "SS.1134"; transcript_id "SS.1134.1"; cov "293.530844"; FPKM "14.354979"; TPM "30.695923"; +CM143127.1 StringTie exon 3312101 3313948 1000 . . gene_id "SS.1134"; transcript_id "SS.1134.1"; exon_number "1"; cov "293.530853"; +CM143127.1 StringTie transcript 3314169 3318816 1000 . . gene_id "SS.1135"; transcript_id "SS.1135.1"; cov "1184.740103"; FPKM "57.939122"; TPM "123.893932"; +CM143127.1 StringTie exon 3314169 3318816 1000 . . gene_id "SS.1135"; transcript_id "SS.1135.1"; exon_number "1"; cov "1184.740112"; +CM143127.1 StringTie transcript 3319094 3320084 1000 . . gene_id "SS.1136"; transcript_id "SS.1136.1"; cov "1306.053481"; FPKM "63.871892"; TPM "136.580251"; +CM143127.1 StringTie exon 3319094 3320084 1000 . . gene_id "SS.1136"; transcript_id "SS.1136.1"; exon_number "1"; cov "1306.053467"; +CM143127.1 StringTie transcript 3322001 3322602 1000 . . gene_id "SS.1137"; transcript_id "SS.1137.1"; cov "5.370432"; FPKM "0.262638"; TPM "0.561612"; +CM143127.1 StringTie exon 3322001 3322602 1000 . . gene_id "SS.1137"; transcript_id "SS.1137.1"; exon_number "1"; cov "5.370432"; +CM143127.1 StringTie transcript 3323774 3330592 1000 . . gene_id "SS.1138"; transcript_id "SS.1138.1"; cov "312.086816"; FPKM "15.262450"; TPM "32.636409"; +CM143127.1 StringTie exon 3323774 3330592 1000 . . gene_id "SS.1138"; transcript_id "SS.1138.1"; exon_number "1"; cov "312.086823"; +CM143127.1 StringTie transcript 3330825 3331863 1000 . . gene_id "SS.1139"; transcript_id "SS.1139.1"; cov "183.632339"; FPKM "8.980448"; TPM "19.203311"; +CM143127.1 StringTie exon 3330825 3331863 1000 . . gene_id "SS.1139"; transcript_id "SS.1139.1"; exon_number "1"; cov "183.632339"; +CM143127.1 StringTie transcript 3338236 3341599 1000 . . gene_id "SS.1140"; transcript_id "SS.1140.1"; cov "1342.425386"; FPKM "65.650641"; TPM "140.383835"; +CM143127.1 StringTie exon 3338236 3341599 1000 . . gene_id "SS.1140"; transcript_id "SS.1140.1"; exon_number "1"; cov "1342.425415"; +CM143127.1 StringTie transcript 3345564 3347052 1000 . . gene_id "SS.1141"; transcript_id "SS.1141.1"; cov "1603.914036"; FPKM "78.438613"; TPM "167.728952"; +CM143127.1 StringTie exon 3345564 3347052 1000 . . gene_id "SS.1141"; transcript_id "SS.1141.1"; exon_number "1"; cov "1603.914062"; +CM143127.1 StringTie transcript 3347470 3348126 1000 . . gene_id "SS.1142"; transcript_id "SS.1142.1"; cov "1267.578387"; FPKM "61.990286"; TPM "132.556727"; +CM143127.1 StringTie exon 3347470 3348126 1000 . . gene_id "SS.1142"; transcript_id "SS.1142.1"; exon_number "1"; cov "1267.578369"; +CM143127.1 StringTie transcript 3348557 3350560 1000 . . gene_id "SS.1143"; transcript_id "SS.1143.1"; cov "2430.887226"; FPKM "118.881323"; TPM "254.209489"; +CM143127.1 StringTie exon 3348557 3350560 1000 . . gene_id "SS.1143"; transcript_id "SS.1143.1"; exon_number "1"; cov "2430.887207"; +CM143127.1 StringTie transcript 3357675 3359038 1000 . . gene_id "SS.1144"; transcript_id "SS.1144.1"; cov "1991.951613"; FPKM "97.415396"; TPM "208.307895"; +CM143127.1 StringTie exon 3357675 3359038 1000 . . gene_id "SS.1144"; transcript_id "SS.1144.1"; exon_number "1"; cov "1991.951660"; +CM143127.1 StringTie transcript 3359289 3361607 1000 . . gene_id "SS.1145"; transcript_id "SS.1145.1"; cov "2431.695990"; FPKM "118.920875"; TPM "254.294066"; +CM143127.1 StringTie exon 3359289 3361607 1000 . . gene_id "SS.1145"; transcript_id "SS.1145.1"; exon_number "1"; cov "2431.696045"; +CM143127.1 StringTie transcript 3362202 3364962 1000 . . gene_id "SS.1146"; transcript_id "SS.1146.1"; cov "888.680551"; FPKM "43.460477"; TPM "92.933570"; +CM143127.1 StringTie exon 3362202 3364962 1000 . . gene_id "SS.1146"; transcript_id "SS.1146.1"; exon_number "1"; cov "888.680542"; +CM143127.1 StringTie transcript 3365985 3369519 1000 . . gene_id "SS.1147"; transcript_id "SS.1147.1"; cov "5449.009335"; FPKM "266.481074"; TPM "569.828935"; +CM143127.1 StringTie exon 3365985 3369519 1000 . . gene_id "SS.1147"; transcript_id "SS.1147.1"; exon_number "1"; cov "5449.009277"; +CM143127.1 StringTie transcript 3380726 3382193 1000 . . gene_id "SS.1148"; transcript_id "SS.1148.1"; cov "81.669619"; FPKM "3.994012"; TPM "8.540582"; +CM143127.1 StringTie exon 3380726 3382193 1000 . . gene_id "SS.1148"; transcript_id "SS.1148.1"; exon_number "1"; cov "81.669617"; +CM143127.1 StringTie transcript 3375552 3380241 1000 . . gene_id "SS.1149"; transcript_id "SS.1149.1"; cov "1099.437633"; FPKM "53.767447"; TPM "114.973445"; +CM143127.1 StringTie exon 3375552 3380241 1000 . . gene_id "SS.1149"; transcript_id "SS.1149.1"; exon_number "1"; cov "1099.437622"; +CM143127.1 StringTie transcript 3382837 3388663 1000 . . gene_id "SS.1150"; transcript_id "SS.1150.1"; cov "429.383388"; FPKM "20.998780"; TPM "44.902672"; +CM143127.1 StringTie exon 3382837 3388663 1000 . . gene_id "SS.1150"; transcript_id "SS.1150.1"; exon_number "1"; cov "429.383392"; +CM143127.1 StringTie transcript 3389048 3390521 1000 . . gene_id "SS.1151"; transcript_id "SS.1151.1"; cov "2723.402307"; FPKM "133.186626"; TPM "284.799189"; +CM143127.1 StringTie exon 3389048 3390521 1000 . . gene_id "SS.1151"; transcript_id "SS.1151.1"; exon_number "1"; cov "2723.402344"; +CM143127.1 StringTie transcript 3390752 3393467 1000 . . gene_id "SS.1152"; transcript_id "SS.1152.1"; cov "1081.976436"; FPKM "52.913516"; TPM "113.147444"; +CM143127.1 StringTie exon 3390752 3393467 1000 . . gene_id "SS.1152"; transcript_id "SS.1152.1"; exon_number "1"; cov "1081.976440"; +CM143127.1 StringTie transcript 3416571 3416963 1000 . . gene_id "SS.1153"; transcript_id "SS.1153.1"; cov "10.452926"; FPKM "0.511195"; TPM "1.093112"; +CM143127.1 StringTie exon 3416571 3416963 1000 . . gene_id "SS.1153"; transcript_id "SS.1153.1"; exon_number "1"; cov "10.452927"; +CM143127.1 StringTie transcript 3418783 3421126 1000 . . gene_id "SS.1154"; transcript_id "SS.1154.1"; cov "68.584898"; FPKM "3.354110"; TPM "7.172250"; +CM143127.1 StringTie exon 3418783 3421126 1000 . . gene_id "SS.1154"; transcript_id "SS.1154.1"; exon_number "1"; cov "68.584900"; +CM143127.1 StringTie transcript 3393785 3395905 1000 . . gene_id "SS.1155"; transcript_id "SS.1155.1"; cov "682.155116"; FPKM "33.360454"; TPM "71.336219"; +CM143127.1 StringTie exon 3393785 3395905 1000 . . gene_id "SS.1155"; transcript_id "SS.1155.1"; exon_number "1"; cov "682.155090"; +CM143127.1 StringTie transcript 3396295 3400627 1000 . . gene_id "SS.1156"; transcript_id "SS.1156.1"; cov "520.491576"; FPKM "25.454380"; TPM "54.430290"; +CM143127.1 StringTie exon 3396295 3400627 1000 . . gene_id "SS.1156"; transcript_id "SS.1156.1"; exon_number "1"; cov "520.491577"; +CM143127.1 StringTie transcript 3400907 3402333 1000 . . gene_id "SS.1157"; transcript_id "SS.1157.1"; cov "2915.051156"; FPKM "142.559118"; TPM "304.840824"; +CM143127.1 StringTie exon 3400907 3402333 1000 . . gene_id "SS.1157"; transcript_id "SS.1157.1"; exon_number "1"; cov "2915.051270"; +CM143127.1 StringTie transcript 3402674 3406260 1000 . . gene_id "SS.1158"; transcript_id "SS.1158.1"; cov "649.971564"; FPKM "31.786534"; TPM "67.970631"; +CM143127.1 StringTie exon 3402674 3406260 1000 . . gene_id "SS.1158"; transcript_id "SS.1158.1"; exon_number "1"; cov "649.971558"; +CM143127.1 StringTie transcript 3406524 3416087 1000 . . gene_id "SS.1159"; transcript_id "SS.1159.1"; cov "818.652969"; FPKM "40.035814"; TPM "85.610452"; +CM143127.1 StringTie exon 3406524 3416087 1000 . . gene_id "SS.1159"; transcript_id "SS.1159.1"; exon_number "1"; cov "818.652954"; +CM143127.1 StringTie transcript 3421523 3422371 1000 . . gene_id "SS.1160"; transcript_id "SS.1160.1"; cov "1570.488810"; FPKM "76.803969"; TPM "164.233517"; +CM143127.1 StringTie exon 3421523 3422371 1000 . . gene_id "SS.1160"; transcript_id "SS.1160.1"; exon_number "1"; cov "1570.488770"; +CM143127.1 StringTie transcript 3436737 3438857 1000 . . gene_id "SS.1161"; transcript_id "SS.1161.1"; cov "160.031117"; FPKM "7.826242"; TPM "16.735218"; +CM143127.1 StringTie exon 3436737 3438857 1000 . . gene_id "SS.1161"; transcript_id "SS.1161.1"; exon_number "1"; cov "160.031113"; +CM143127.1 StringTie transcript 3436737 3440786 1000 + . gene_id "SS.1162"; transcript_id "SS.1162.1"; cov "33.914832"; FPKM "1.658588"; TPM "3.546636"; +CM143127.1 StringTie exon 3436737 3438743 1000 + . gene_id "SS.1162"; transcript_id "SS.1162.1"; exon_number "1"; cov "48.117085"; +CM143127.1 StringTie exon 3438884 3440786 1000 + . gene_id "SS.1162"; transcript_id "SS.1162.1"; exon_number "2"; cov "18.936417"; +CM143127.1 StringTie transcript 3441415 3441679 1000 . . gene_id "SS.1163"; transcript_id "SS.1163.1"; cov "8.475472"; FPKM "0.414489"; TPM "0.886321"; +CM143127.1 StringTie exon 3441415 3441679 1000 . . gene_id "SS.1163"; transcript_id "SS.1163.1"; exon_number "1"; cov "8.475471"; +CM143127.1 StringTie transcript 3442175 3442449 1000 . . gene_id "SS.1164"; transcript_id "SS.1164.1"; cov "5.000000"; FPKM "0.244522"; TPM "0.522874"; +CM143127.1 StringTie exon 3442175 3442449 1000 . . gene_id "SS.1164"; transcript_id "SS.1164.1"; exon_number "1"; cov "5.000000"; +CM143127.1 StringTie transcript 3443086 3445268 1000 . . gene_id "SS.1165"; transcript_id "SS.1165.1"; cov "26.713697"; FPKM "1.306420"; TPM "2.793579"; +CM143127.1 StringTie exon 3443086 3445268 1000 . . gene_id "SS.1165"; transcript_id "SS.1165.1"; exon_number "1"; cov "26.713697"; +CM143127.1 StringTie transcript 3423819 3429763 1000 + . gene_id "SS.1166"; transcript_id "SS.1166.1"; cov "427.596011"; FPKM "20.911369"; TPM "44.715757"; +CM143127.1 StringTie exon 3423819 3425885 1000 + . gene_id "SS.1166"; transcript_id "SS.1166.1"; exon_number "1"; cov "274.373962"; +CM143127.1 StringTie exon 3426096 3429763 1000 + . gene_id "SS.1166"; transcript_id "SS.1166.1"; exon_number "2"; cov "513.940063"; +CM143127.1 StringTie transcript 3427904 3429763 1000 . . gene_id "SS.1167"; transcript_id "SS.1167.1"; cov "1862.143011"; FPKM "91.067172"; TPM "194.733190"; +CM143127.1 StringTie exon 3427904 3429763 1000 . . gene_id "SS.1167"; transcript_id "SS.1167.1"; exon_number "1"; cov "1862.143066"; +CM143127.1 StringTie transcript 3430078 3436327 1000 . . gene_id "SS.1168"; transcript_id "SS.1168.1"; cov "447.466720"; FPKM "21.883136"; TPM "46.793732"; +CM143127.1 StringTie exon 3430078 3436327 1000 . . gene_id "SS.1168"; transcript_id "SS.1168.1"; exon_number "1"; cov "447.466705"; +CM143127.1 StringTie transcript 3448349 3449845 1000 . . gene_id "SS.1169"; transcript_id "SS.1169.1"; cov "548.756179"; FPKM "26.836646"; TPM "57.386055"; +CM143127.1 StringTie exon 3448349 3449845 1000 . . gene_id "SS.1169"; transcript_id "SS.1169.1"; exon_number "1"; cov "548.756165"; +CM143127.1 StringTie transcript 3451285 3456329 1000 . . gene_id "SS.1170"; transcript_id "SS.1170.1"; cov "717.715956"; FPKM "35.099540"; TPM "75.054986"; +CM143127.1 StringTie exon 3451285 3456329 1000 . . gene_id "SS.1170"; transcript_id "SS.1170.1"; exon_number "1"; cov "717.715942"; +CM143127.1 StringTie transcript 3464825 3465087 1000 . . gene_id "SS.1171"; transcript_id "SS.1171.1"; cov "10.996198"; FPKM "0.537764"; TPM "1.149925"; +CM143127.1 StringTie exon 3464825 3465087 1000 . . gene_id "SS.1171"; transcript_id "SS.1171.1"; exon_number "1"; cov "10.996198"; +CM143127.1 StringTie transcript 3460828 3461203 1000 . . gene_id "SS.1172"; transcript_id "SS.1172.1"; cov "1442.939661"; FPKM "70.566242"; TPM "150.895093"; +CM143127.1 StringTie exon 3460828 3461203 1000 . . gene_id "SS.1172"; transcript_id "SS.1172.1"; exon_number "1"; cov "1442.939697"; +CM143127.1 StringTie transcript 3466078 3467739 1000 . . gene_id "SS.1173"; transcript_id "SS.1173.1"; cov "197.719013"; FPKM "9.669349"; TPM "20.676422"; +CM143127.1 StringTie exon 3466078 3467739 1000 . . gene_id "SS.1173"; transcript_id "SS.1173.1"; exon_number "1"; cov "197.719009"; +CM143127.1 StringTie transcript 3469754 3471018 1000 . . gene_id "SS.1174"; transcript_id "SS.1174.1"; cov "15.611858"; FPKM "0.763490"; TPM "1.632607"; +CM143127.1 StringTie exon 3469754 3471018 1000 . . gene_id "SS.1174"; transcript_id "SS.1174.1"; exon_number "1"; cov "15.611857"; +CM143127.1 StringTie transcript 3472204 3473118 1000 . . gene_id "SS.1175"; transcript_id "SS.1175.1"; cov "59.973770"; FPKM "2.932987"; TPM "6.271744"; +CM143127.1 StringTie exon 3472204 3473118 1000 . . gene_id "SS.1175"; transcript_id "SS.1175.1"; exon_number "1"; cov "59.973770"; +CM143127.1 StringTie transcript 3473680 3475032 1000 . . gene_id "SS.1176"; transcript_id "SS.1176.1"; cov "30.818182"; FPKM "1.507148"; TPM "3.222805"; +CM143127.1 StringTie exon 3473680 3475032 1000 . . gene_id "SS.1176"; transcript_id "SS.1176.1"; exon_number "1"; cov "30.818182"; +CM143127.1 StringTie transcript 3477002 3477237 1000 . . gene_id "SS.1177"; transcript_id "SS.1177.1"; cov "13.000000"; FPKM "0.635758"; TPM "1.359472"; +CM143127.1 StringTie exon 3477002 3477237 1000 . . gene_id "SS.1177"; transcript_id "SS.1177.1"; exon_number "1"; cov "13.000000"; +CM143127.1 StringTie transcript 3481587 3483353 1000 . . gene_id "SS.1178"; transcript_id "SS.1178.1"; cov "7.541030"; FPKM "0.368790"; TPM "0.788602"; +CM143127.1 StringTie exon 3481587 3483353 1000 . . gene_id "SS.1178"; transcript_id "SS.1178.1"; exon_number "1"; cov "7.541030"; +CM143127.1 StringTie transcript 3484695 3485472 1000 . . gene_id "SS.1179"; transcript_id "SS.1179.1"; cov "9.584833"; FPKM "0.468741"; TPM "1.002332"; +CM143127.1 StringTie exon 3484695 3485472 1000 . . gene_id "SS.1179"; transcript_id "SS.1179.1"; exon_number "1"; cov "9.584833"; +CM143127.1 StringTie transcript 3485951 3486645 1000 . . gene_id "SS.1180"; transcript_id "SS.1180.1"; cov "17.599032"; FPKM "0.860672"; TPM "1.840415"; +CM143127.1 StringTie exon 3485951 3486645 1000 . . gene_id "SS.1180"; transcript_id "SS.1180.1"; exon_number "1"; cov "17.599031"; +CM143127.1 StringTie transcript 3486888 3487886 1000 . . gene_id "SS.1181"; transcript_id "SS.1181.1"; cov "13.564628"; FPKM "0.663371"; TPM "1.418518"; +CM143127.1 StringTie exon 3486888 3487886 1000 . . gene_id "SS.1181"; transcript_id "SS.1181.1"; exon_number "1"; cov "13.564628"; +CM143127.1 StringTie transcript 3496473 3497537 1000 . . gene_id "SS.1182"; transcript_id "SS.1182.1"; cov "4.966353"; FPKM "0.242877"; TPM "0.519355"; +CM143127.1 StringTie exon 3496473 3497537 1000 . . gene_id "SS.1182"; transcript_id "SS.1182.1"; exon_number "1"; cov "4.966353"; +CM143127.1 StringTie transcript 3488229 3489425 1000 . . gene_id "SS.1183"; transcript_id "SS.1183.1"; cov "16.649390"; FPKM "0.814230"; TPM "1.741106"; +CM143127.1 StringTie exon 3488229 3489425 1000 . . gene_id "SS.1183"; transcript_id "SS.1183.1"; exon_number "1"; cov "16.649391"; +CM143128.1 StringTie transcript 17920 19505 1000 . . gene_id "SS.1184"; transcript_id "SS.1184.1"; cov "31.718159"; FPKM "1.551161"; TPM "3.316919"; +CM143128.1 StringTie exon 17920 19505 1000 . . gene_id "SS.1184"; transcript_id "SS.1184.1"; exon_number "1"; cov "31.718159"; +CM143128.1 StringTie transcript 19913 22048 1000 . . gene_id "SS.1185"; transcript_id "SS.1185.1"; cov "5.453184"; FPKM "0.266685"; TPM "0.570265"; +CM143128.1 StringTie exon 19913 22048 1000 . . gene_id "SS.1185"; transcript_id "SS.1185.1"; exon_number "1"; cov "5.453184"; +CM143128.1 StringTie transcript 22490 22884 1000 . . gene_id "SS.1186"; transcript_id "SS.1186.1"; cov "15.481013"; FPKM "0.757091"; TPM "1.618923"; +CM143128.1 StringTie exon 22490 22884 1000 . . gene_id "SS.1186"; transcript_id "SS.1186.1"; exon_number "1"; cov "15.481012"; +CM143128.1 StringTie transcript 23299 23690 1000 . . gene_id "SS.1187"; transcript_id "SS.1187.1"; cov "41.178571"; FPKM "2.013817"; TPM "4.306240"; +CM143128.1 StringTie exon 23299 23690 1000 . . gene_id "SS.1187"; transcript_id "SS.1187.1"; exon_number "1"; cov "41.178570"; +CM143128.1 StringTie transcript 7890 10123 1000 . . gene_id "SS.1188"; transcript_id "SS.1188.1"; cov "355.036258"; FPKM "17.362870"; TPM "37.127837"; +CM143128.1 StringTie exon 7890 10123 1000 . . gene_id "SS.1188"; transcript_id "SS.1188.1"; exon_number "1"; cov "355.036255"; +CM143128.1 StringTie transcript 10664 16881 1000 . . gene_id "SS.1189"; transcript_id "SS.1189.1"; cov "88.563063"; FPKM "4.331132"; TPM "9.261463"; +CM143128.1 StringTie exon 10664 16881 1000 . . gene_id "SS.1189"; transcript_id "SS.1189.1"; exon_number "1"; cov "88.563065"; +CM143128.1 StringTie transcript 10664 16881 1000 - . gene_id "SS.1190"; transcript_id "SS.1190.1"; cov "24.976179"; FPKM "1.221448"; TPM "2.611878"; +CM143128.1 StringTie exon 10664 11184 1000 - . gene_id "SS.1190"; transcript_id "SS.1190.1"; exon_number "1"; cov "61.978577"; +CM143128.1 StringTie exon 11598 16881 1000 - . gene_id "SS.1190"; transcript_id "SS.1190.1"; exon_number "2"; cov "21.327761"; +CM143128.1 StringTie transcript 24227 25690 1000 . . gene_id "SS.1191"; transcript_id "SS.1191.1"; cov "18.946721"; FPKM "0.926580"; TPM "1.981349"; +CM143128.1 StringTie exon 24227 25690 1000 . . gene_id "SS.1191"; transcript_id "SS.1191.1"; exon_number "1"; cov "18.946722"; +CM143128.1 StringTie transcript 26410 27968 1000 . . gene_id "SS.1192"; transcript_id "SS.1192.1"; cov "11.549070"; FPKM "0.564801"; TPM "1.207741"; +CM143128.1 StringTie exon 26410 27968 1000 . . gene_id "SS.1192"; transcript_id "SS.1192.1"; exon_number "1"; cov "11.549070"; +CM143128.1 StringTie transcript 29473 30209 1000 . . gene_id "SS.1193"; transcript_id "SS.1193.1"; cov "8.213026"; FPKM "0.401654"; TPM "0.858875"; +CM143128.1 StringTie exon 29473 30209 1000 . . gene_id "SS.1193"; transcript_id "SS.1193.1"; exon_number "1"; cov "8.213026"; +CM143128.1 StringTie transcript 30448 31030 1000 . . gene_id "SS.1194"; transcript_id "SS.1194.1"; cov "13.092624"; FPKM "0.640288"; TPM "1.369158"; +CM143128.1 StringTie exon 30448 31030 1000 . . gene_id "SS.1194"; transcript_id "SS.1194.1"; exon_number "1"; cov "13.092625"; +CM143128.1 StringTie transcript 34165 34959 1000 . . gene_id "SS.1195"; transcript_id "SS.1195.1"; cov "231.408805"; FPKM "11.316932"; TPM "24.199524"; +CM143128.1 StringTie exon 34165 34959 1000 . . gene_id "SS.1195"; transcript_id "SS.1195.1"; exon_number "1"; cov "231.408798"; +CM143128.1 StringTie transcript 35777 43777 1000 . . gene_id "SS.1196"; transcript_id "SS.1196.1"; cov "487.129046"; FPKM "23.822802"; TPM "50.941411"; +CM143128.1 StringTie exon 35777 43777 1000 . . gene_id "SS.1196"; transcript_id "SS.1196.1"; exon_number "1"; cov "487.129059"; +CM143128.1 StringTie transcript 44292 53368 1000 . . gene_id "SS.1197"; transcript_id "SS.1197.1"; cov "489.357772"; FPKM "23.931797"; TPM "51.174480"; +CM143128.1 StringTie exon 44292 53368 1000 . . gene_id "SS.1197"; transcript_id "SS.1197.1"; exon_number "1"; cov "489.357758"; +CM143128.1 StringTie transcript 54769 57984 1000 . . gene_id "SS.1198"; transcript_id "SS.1198.1"; cov "512.174751"; FPKM "25.047650"; TPM "53.560560"; +CM143128.1 StringTie exon 54769 57984 1000 . . gene_id "SS.1198"; transcript_id "SS.1198.1"; exon_number "1"; cov "512.174744"; +CM143128.1 StringTie transcript 59922 61877 1000 . . gene_id "SS.1199"; transcript_id "SS.1199.1"; cov "3177.878323"; FPKM "155.412549"; TPM "332.325917"; +CM143128.1 StringTie exon 59922 61877 1000 . . gene_id "SS.1199"; transcript_id "SS.1199.1"; exon_number "1"; cov "3177.878418"; +CM143128.1 StringTie transcript 68740 70970 1000 . . gene_id "SS.1200"; transcript_id "SS.1200.1"; cov "442.675482"; FPKM "21.648823"; TPM "46.292690"; +CM143128.1 StringTie exon 68740 70970 1000 . . gene_id "SS.1200"; transcript_id "SS.1200.1"; exon_number "1"; cov "442.675476"; +CM143128.1 StringTie transcript 72171 81140 1000 . . gene_id "SS.1201"; transcript_id "SS.1201.1"; cov "475.061984"; FPKM "23.232669"; TPM "49.679501"; +CM143128.1 StringTie exon 72171 81140 1000 . . gene_id "SS.1201"; transcript_id "SS.1201.1"; exon_number "1"; cov "475.061981"; +CM143128.1 StringTie transcript 81742 88238 1000 . . gene_id "SS.1202"; transcript_id "SS.1202.1"; cov "73.292443"; FPKM "3.584330"; TPM "7.664541"; +CM143128.1 StringTie exon 81742 88238 1000 . . gene_id "SS.1202"; transcript_id "SS.1202.1"; exon_number "1"; cov "73.292442"; +CM143128.1 StringTie transcript 88619 90281 1000 . . gene_id "SS.1203"; transcript_id "SS.1203.1"; cov "97.818400"; FPKM "4.783760"; TPM "10.229337"; +CM143128.1 StringTie exon 88619 90281 1000 . . gene_id "SS.1203"; transcript_id "SS.1203.1"; exon_number "1"; cov "97.818398"; +CM143128.1 StringTie transcript 90498 90979 1000 . . gene_id "SS.1204"; transcript_id "SS.1204.1"; cov "35.248963"; FPKM "1.723833"; TPM "3.686152"; +CM143128.1 StringTie exon 90498 90979 1000 . . gene_id "SS.1204"; transcript_id "SS.1204.1"; exon_number "1"; cov "35.248962"; +CM143128.1 StringTie transcript 91292 91752 1000 . . gene_id "SS.1205"; transcript_id "SS.1205.1"; cov "29.414317"; FPKM "1.438492"; TPM "3.075996"; +CM143128.1 StringTie exon 91292 91752 1000 . . gene_id "SS.1205"; transcript_id "SS.1205.1"; exon_number "1"; cov "29.414316"; +CM143128.1 StringTie transcript 92448 93371 1000 . . gene_id "SS.1206"; transcript_id "SS.1206.1"; cov "2332.256494"; FPKM "114.057836"; TPM "243.895202"; +CM143128.1 StringTie exon 92448 93371 1000 . . gene_id "SS.1206"; transcript_id "SS.1206.1"; exon_number "1"; cov "2332.256592"; +CM143128.1 StringTie transcript 93605 95298 1000 . . gene_id "SS.1207"; transcript_id "SS.1207.1"; cov "302.762102"; FPKM "14.806429"; TPM "31.661279"; +CM143128.1 StringTie exon 93605 95298 1000 . . gene_id "SS.1207"; transcript_id "SS.1207.1"; exon_number "1"; cov "302.762115"; +CM143128.1 StringTie transcript 95650 96842 1000 - . gene_id "SS.1208"; transcript_id "SS.1208.1"; cov "827.806159"; FPKM "40.483446"; TPM "86.567644"; +CM143128.1 StringTie exon 95650 96653 1000 - . gene_id "SS.1208"; transcript_id "SS.1208.1"; exon_number "1"; cov "872.904358"; +CM143128.1 StringTie exon 96743 96842 1000 - . gene_id "SS.1208"; transcript_id "SS.1208.1"; exon_number "2"; cov "375.019989"; +CM143128.1 StringTie transcript 97592 100375 1000 . . gene_id "SS.1209"; transcript_id "SS.1209.1"; cov "272.813937"; FPKM "13.341829"; TPM "28.529457"; +CM143128.1 StringTie exon 97592 100375 1000 . . gene_id "SS.1209"; transcript_id "SS.1209.1"; exon_number "1"; cov "272.813934"; +CM143128.1 StringTie transcript 100615 106603 1000 . . gene_id "SS.1210"; transcript_id "SS.1210.1"; cov "211.316747"; FPKM "10.334340"; TPM "22.098402"; +CM143128.1 StringTie exon 100615 106603 1000 . . gene_id "SS.1210"; transcript_id "SS.1210.1"; exon_number "1"; cov "211.316742"; +CM143128.1 StringTie transcript 106864 110539 1000 . . gene_id "SS.1211"; transcript_id "SS.1211.1"; cov "241.248912"; FPKM "11.798157"; TPM "25.228551"; +CM143128.1 StringTie exon 106864 110539 1000 . . gene_id "SS.1211"; transcript_id "SS.1211.1"; exon_number "1"; cov "241.248917"; +CM143128.1 StringTie transcript 110803 117490 1000 . . gene_id "SS.1212"; transcript_id "SS.1212.1"; cov "498.457835"; FPKM "24.376831"; TPM "52.126117"; +CM143128.1 StringTie exon 110803 117490 1000 . . gene_id "SS.1212"; transcript_id "SS.1212.1"; exon_number "1"; cov "498.457825"; +CM143128.1 StringTie transcript 121130 122305 1000 . . gene_id "SS.1213"; transcript_id "SS.1213.1"; cov "9087.436224"; FPKM "444.416519"; TPM "950.316615"; +CM143128.1 StringTie exon 121130 122305 1000 . . gene_id "SS.1213"; transcript_id "SS.1213.1"; exon_number "1"; cov "9087.436523"; +CM143128.1 StringTie transcript 123020 131473 1000 . . gene_id "SS.1214"; transcript_id "SS.1214.1"; cov "231.702271"; FPKM "11.331284"; TPM "24.230213"; +CM143128.1 StringTie exon 123020 131473 1000 . . gene_id "SS.1214"; transcript_id "SS.1214.1"; exon_number "1"; cov "231.702271"; +CM143128.1 StringTie transcript 131808 135650 1000 . . gene_id "SS.1215"; transcript_id "SS.1215.1"; cov "948.817330"; FPKM "46.401437"; TPM "99.222361"; +CM143128.1 StringTie exon 131808 135650 1000 . . gene_id "SS.1215"; transcript_id "SS.1215.1"; exon_number "1"; cov "948.817322"; +CM143128.1 StringTie transcript 136004 140098 1000 . . gene_id "SS.1216"; transcript_id "SS.1216.1"; cov "683.948230"; FPKM "33.448146"; TPM "71.523734"; +CM143128.1 StringTie exon 136004 140098 1000 . . gene_id "SS.1216"; transcript_id "SS.1216.1"; exon_number "1"; cov "683.948242"; +CM143128.1 StringTie transcript 140454 153968 1000 + . gene_id "SS.1217"; transcript_id "SS.1217.1"; cov "181.713195"; FPKM "8.886593"; TPM "19.002617"; +CM143128.1 StringTie exon 140454 140520 1000 + . gene_id "SS.1217"; transcript_id "SS.1217.1"; exon_number "1"; cov "26.417910"; +CM143128.1 StringTie exon 140804 153968 1000 + . gene_id "SS.1217"; transcript_id "SS.1217.1"; exon_number "2"; cov "182.503525"; +CM143128.1 StringTie transcript 154197 155406 1000 . . gene_id "SS.1218"; transcript_id "SS.1218.1"; cov "199.922314"; FPKM "9.777101"; TPM "20.906831"; +CM143128.1 StringTie exon 154197 155406 1000 . . gene_id "SS.1218"; transcript_id "SS.1218.1"; exon_number "1"; cov "199.922318"; +CM143128.1 StringTie transcript 155809 158851 1000 . . gene_id "SS.1219"; transcript_id "SS.1219.1"; cov "1448.377259"; FPKM "70.832165"; TPM "151.463729"; +CM143128.1 StringTie exon 155809 158851 1000 . . gene_id "SS.1219"; transcript_id "SS.1219.1"; exon_number "1"; cov "1448.377319"; +CM143128.1 StringTie transcript 203413 203636 1000 . . gene_id "SS.1220"; transcript_id "SS.1220.1"; cov "7.000000"; FPKM "0.342331"; TPM "0.732023"; +CM143128.1 StringTie exon 203413 203636 1000 . . gene_id "SS.1220"; transcript_id "SS.1220.1"; exon_number "1"; cov "7.000000"; +CM143128.1 StringTie transcript 159226 162678 1000 . . gene_id "SS.1221"; transcript_id "SS.1221.1"; cov "61.218940"; FPKM "2.993882"; TPM "6.401957"; +CM143128.1 StringTie exon 159226 162678 1000 . . gene_id "SS.1221"; transcript_id "SS.1221.1"; exon_number "1"; cov "61.218941"; +CM143128.1 StringTie transcript 163299 165058 1000 . . gene_id "SS.1222"; transcript_id "SS.1222.1"; cov "8.131818"; FPKM "0.397682"; TPM "0.850383"; +CM143128.1 StringTie exon 163299 165058 1000 . . gene_id "SS.1222"; transcript_id "SS.1222.1"; exon_number "1"; cov "8.131818"; +CM143128.1 StringTie transcript 165390 168026 1000 . . gene_id "SS.1223"; transcript_id "SS.1223.1"; cov "666.629503"; FPKM "32.601182"; TPM "69.712632"; +CM143128.1 StringTie exon 165390 168026 1000 . . gene_id "SS.1223"; transcript_id "SS.1223.1"; exon_number "1"; cov "666.629517"; +CM143128.1 StringTie transcript 168318 171600 1000 . . gene_id "SS.1224"; transcript_id "SS.1224.1"; cov "1274.127932"; FPKM "62.310589"; TPM "133.241644"; +CM143128.1 StringTie exon 168318 171600 1000 . . gene_id "SS.1224"; transcript_id "SS.1224.1"; exon_number "1"; cov "1274.127930"; +CM143128.1 StringTie transcript 172127 172659 1000 . . gene_id "SS.1225"; transcript_id "SS.1225.1"; cov "111.636023"; FPKM "5.459504"; TPM "11.674312"; +CM143128.1 StringTie exon 172127 172659 1000 . . gene_id "SS.1225"; transcript_id "SS.1225.1"; exon_number "1"; cov "111.636024"; +CM143128.1 StringTie transcript 173146 175487 1000 . . gene_id "SS.1226"; transcript_id "SS.1226.1"; cov "15.447908"; FPKM "0.755472"; TPM "1.615462"; +CM143128.1 StringTie exon 173146 175487 1000 . . gene_id "SS.1226"; transcript_id "SS.1226.1"; exon_number "1"; cov "15.447907"; +CM143128.1 StringTie transcript 177096 178015 1000 . . gene_id "SS.1227"; transcript_id "SS.1227.1"; cov "5198.055435"; FPKM "254.208299"; TPM "543.585487"; +CM143128.1 StringTie exon 177096 178015 1000 . . gene_id "SS.1227"; transcript_id "SS.1227.1"; exon_number "1"; cov "5198.055664"; +CM143128.1 StringTie transcript 181652 184477 1000 - . gene_id "SS.1228"; transcript_id "SS.1228.1"; cov "267.732917"; FPKM "13.093344"; TPM "27.998110"; +CM143128.1 StringTie exon 181652 182158 1000 - . gene_id "SS.1228"; transcript_id "SS.1228.1"; exon_number "1"; cov "387.670990"; +CM143128.1 StringTie exon 182241 184477 1000 - . gene_id "SS.1228"; transcript_id "SS.1228.1"; exon_number "2"; cov "240.549820"; +CM143128.1 StringTie transcript 181652 184477 1000 - . gene_id "SS.1228"; transcript_id "SS.1228.2"; cov "113.658370"; FPKM "5.558406"; TPM "11.885799"; +CM143128.1 StringTie exon 181652 182158 1000 - . gene_id "SS.1228"; transcript_id "SS.1228.2"; exon_number "1"; cov "164.323105"; +CM143128.1 StringTie exon 182236 184477 1000 - . gene_id "SS.1228"; transcript_id "SS.1228.2"; exon_number "2"; cov "102.201180"; +CM143128.1 StringTie transcript 184976 186097 1000 . . gene_id "SS.1229"; transcript_id "SS.1229.1"; cov "1001.683601"; FPKM "48.986835"; TPM "104.750839"; +CM143128.1 StringTie exon 184976 186097 1000 . . gene_id "SS.1229"; transcript_id "SS.1229.1"; exon_number "1"; cov "1001.683594"; +CM143128.1 StringTie transcript 186768 188350 1000 + . gene_id "SS.1230"; transcript_id "SS.1230.1"; cov "6896.360027"; FPKM "337.263035"; TPM "721.185311"; +CM143128.1 StringTie exon 186768 186871 1000 + . gene_id "SS.1230"; transcript_id "SS.1230.1"; exon_number "1"; cov "1804.346191"; +CM143128.1 StringTie exon 186994 188350 1000 + . gene_id "SS.1230"; transcript_id "SS.1230.1"; exon_number "2"; cov "7286.610352"; +CM143128.1 StringTie transcript 188993 190316 1000 . . gene_id "SS.1231"; transcript_id "SS.1231.1"; cov "7486.156344"; FPKM "366.106728"; TPM "782.863129"; +CM143128.1 StringTie exon 188993 190316 1000 . . gene_id "SS.1231"; transcript_id "SS.1231.1"; exon_number "1"; cov "7486.156250"; +CM143128.1 StringTie transcript 199414 201155 1000 . . gene_id "SS.1232"; transcript_id "SS.1232.1"; cov "4080.219862"; FPKM "199.541110"; TPM "426.688082"; +CM143128.1 StringTie exon 199414 201155 1000 . . gene_id "SS.1232"; transcript_id "SS.1232.1"; exon_number "1"; cov "4080.219971"; +CM143128.1 StringTie transcript 201702 202782 1000 . . gene_id "SS.1233"; transcript_id "SS.1233.1"; cov "419.249769"; FPKM "20.503200"; TPM "43.842951"; +CM143128.1 StringTie exon 201702 202782 1000 . . gene_id "SS.1233"; transcript_id "SS.1233.1"; exon_number "1"; cov "419.249756"; +CM143128.1 StringTie transcript 204069 207411 1000 . . gene_id "SS.1234"; transcript_id "SS.1234.1"; cov "1021.695483"; FPKM "49.965506"; TPM "106.843577"; +CM143128.1 StringTie exon 204069 207411 1000 . . gene_id "SS.1234"; transcript_id "SS.1234.1"; exon_number "1"; cov "1021.695496"; +CM143128.1 StringTie transcript 207815 208495 1000 . . gene_id "SS.1235"; transcript_id "SS.1235.1"; cov "54.356828"; FPKM "2.658293"; TPM "5.684353"; +CM143128.1 StringTie exon 207815 208495 1000 . . gene_id "SS.1235"; transcript_id "SS.1235.1"; exon_number "1"; cov "54.356827"; +CM143128.1 StringTie transcript 210823 211477 1000 . . gene_id "SS.1236"; transcript_id "SS.1236.1"; cov "1402.932824"; FPKM "68.609727"; TPM "146.711387"; +CM143128.1 StringTie exon 210823 211477 1000 . . gene_id "SS.1236"; transcript_id "SS.1236.1"; exon_number "1"; cov "1402.932861"; +CM143128.1 StringTie transcript 211837 218853 1000 . . gene_id "SS.1237"; transcript_id "SS.1237.1"; cov "525.876870"; FPKM "25.717745"; TPM "54.993456"; +CM143128.1 StringTie exon 211837 218853 1000 . . gene_id "SS.1237"; transcript_id "SS.1237.1"; exon_number "1"; cov "525.876892"; +CM143128.1 StringTie transcript 220372 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.1"; cov "3105.860779"; FPKM "151.890567"; TPM "324.794698"; +CM143128.1 StringTie exon 220372 221992 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.1"; exon_number "1"; cov "3462.257324"; +CM143128.1 StringTie exon 222437 222658 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.1"; exon_number "2"; cov "5558.632812"; +CM143128.1 StringTie exon 222881 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.1"; exon_number "3"; cov "2626.478516"; +CM143128.1 StringTie transcript 220372 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.2"; cov "2087.439361"; FPKM "102.085177"; TPM "218.293505"; +CM143128.1 StringTie exon 220372 222214 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.2"; exon_number "1"; cov "2512.591309"; +CM143128.1 StringTie exon 222881 223324 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.2"; exon_number "2"; cov "3979.326416"; +CM143128.1 StringTie exon 223547 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.2"; exon_number "3"; cov "1118.153931"; +CM143128.1 StringTie transcript 220372 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.3"; cov "1881.897545"; FPKM "92.033257"; TPM "196.799016"; +CM143128.1 StringTie exon 220372 220767 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.3"; exon_number "1"; cov "1632.173340"; +CM143128.1 StringTie exon 220810 222436 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.3"; exon_number "2"; cov "2699.908936"; +CM143128.1 StringTie exon 223103 223324 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.3"; exon_number "3"; cov "2843.676270"; +CM143128.1 StringTie exon 223547 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.3"; exon_number "4"; cov "1018.895325"; +CM143128.1 StringTie transcript 220372 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.4"; cov "1951.295526"; FPKM "95.427131"; TPM "204.056294"; +CM143128.1 StringTie exon 220372 222658 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.4"; exon_number "1"; cov "2628.874756"; +CM143128.1 StringTie exon 223547 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.4"; exon_number "2"; cov "1026.147095"; +CM143128.1 StringTie transcript 220372 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.5"; cov "1330.236614"; FPKM "65.054556"; TPM "139.109197"; +CM143128.1 StringTie exon 220372 220809 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.5"; exon_number "1"; cov "1340.354736"; +CM143128.1 StringTie exon 220852 221992 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.5"; exon_number "2"; cov "1791.531616"; +CM143128.1 StringTie exon 223103 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.5"; exon_number "3"; cov "1079.755493"; +CM143128.1 StringTie transcript 220372 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.6"; cov "1970.805067"; FPKM "96.381235"; TPM "206.096500"; +CM143128.1 StringTie exon 220372 220809 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.6"; exon_number "1"; cov "1502.064453"; +CM143128.1 StringTie exon 220894 222880 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.6"; exon_number "2"; cov "2935.090576"; +CM143128.1 StringTie exon 223325 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.6"; exon_number "3"; cov "1068.998535"; +CM143128.1 StringTie transcript 220372 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.7"; cov "989.819814"; FPKM "48.406642"; TPM "103.510186"; +CM143128.1 StringTie exon 220372 220767 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.7"; exon_number "1"; cov "786.012329"; +CM143128.1 StringTie exon 220936 222214 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.7"; exon_number "2"; cov "1123.916626"; +CM143128.1 StringTie exon 222659 222880 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.7"; exon_number "3"; cov "4346.882812"; +CM143128.1 StringTie exon 223547 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.7"; exon_number "4"; cov "490.673553"; +CM143128.1 StringTie transcript 220372 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.8"; cov "619.395994"; FPKM "30.291251"; TPM "64.773198"; +CM143128.1 StringTie exon 220372 220809 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.8"; exon_number "1"; cov "672.445862"; +CM143128.1 StringTie exon 220894 222214 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.8"; exon_number "2"; cov "895.979492"; +CM143128.1 StringTie exon 223547 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.8"; exon_number "3"; cov "387.394440"; +CM143128.1 StringTie transcript 220372 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.9"; cov "604.542473"; FPKM "29.564847"; TPM "63.219894"; +CM143128.1 StringTie exon 220372 220809 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.9"; exon_number "1"; cov "520.283936"; +CM143128.1 StringTie exon 220978 222658 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.9"; exon_number "2"; cov "808.146667"; +CM143128.1 StringTie exon 222881 223324 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.9"; exon_number "3"; cov "1066.705200"; +CM143128.1 StringTie exon 223547 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.9"; exon_number "4"; cov "299.734314"; +CM143128.1 StringTie transcript 220372 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.10"; cov "362.840592"; FPKM "17.744538"; TPM "37.943974"; +CM143128.1 StringTie exon 220372 220809 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.10"; exon_number "1"; cov "401.891174"; +CM143128.1 StringTie exon 220978 222214 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.10"; exon_number "2"; cov "526.820862"; +CM143128.1 StringTie exon 223547 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.10"; exon_number "3"; cov "231.528519"; +CM143128.1 StringTie transcript 220372 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.11"; cov "316.463400"; FPKM "15.476484"; TPM "33.094089"; +CM143128.1 StringTie exon 220372 220809 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.11"; exon_number "1"; cov "328.232117"; +CM143128.1 StringTie exon 220978 221992 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.11"; exon_number "2"; cov "420.044617"; +CM143128.1 StringTie exon 223103 225221 1000 + . gene_id "SS.1238"; transcript_id "SS.1238.11"; exon_number "3"; cov "264.415436"; +CM143128.1 StringTie transcript 225944 227754 1000 . . gene_id "SS.1239"; transcript_id "SS.1239.1"; cov "60.925456"; FPKM "2.979529"; TPM "6.371266"; +CM143128.1 StringTie exon 225944 227754 1000 . . gene_id "SS.1239"; transcript_id "SS.1239.1"; exon_number "1"; cov "60.925457"; +CM143128.1 StringTie transcript 228291 229000 1000 . . gene_id "SS.1240"; transcript_id "SS.1240.1"; cov "62.873239"; FPKM "3.074784"; TPM "6.574955"; +CM143128.1 StringTie exon 228291 229000 1000 . . gene_id "SS.1240"; transcript_id "SS.1240.1"; exon_number "1"; cov "62.873238"; +CM143128.1 StringTie transcript 243066 244125 1000 . . gene_id "SS.1241"; transcript_id "SS.1241.1"; cov "892.547170"; FPKM "43.649573"; TPM "93.337921"; +CM143128.1 StringTie exon 243066 244125 1000 . . gene_id "SS.1241"; transcript_id "SS.1241.1"; exon_number "1"; cov "892.547180"; +CM143128.1 StringTie transcript 229601 230390 1000 . . gene_id "SS.1242"; transcript_id "SS.1242.1"; cov "2097.915190"; FPKM "102.597492"; TPM "219.389013"; +CM143128.1 StringTie exon 229601 230390 1000 . . gene_id "SS.1242"; transcript_id "SS.1242.1"; exon_number "1"; cov "2097.915283"; +CM143128.1 StringTie transcript 234524 235962 1000 . . gene_id "SS.1243"; transcript_id "SS.1243.1"; cov "1952.325921"; FPKM "95.477522"; TPM "204.164048"; +CM143128.1 StringTie exon 234524 235962 1000 . . gene_id "SS.1243"; transcript_id "SS.1243.1"; exon_number "1"; cov "1952.325928"; +CM143128.1 StringTie transcript 236203 236776 1000 . . gene_id "SS.1244"; transcript_id "SS.1244.1"; cov "2585.106272"; FPKM "126.423328"; TPM "270.336912"; +CM143128.1 StringTie exon 236203 236776 1000 . . gene_id "SS.1244"; transcript_id "SS.1244.1"; exon_number "1"; cov "2585.106201"; +CM143128.1 StringTie transcript 241320 242481 1000 - . gene_id "SS.1245"; transcript_id "SS.1245.1"; cov "23530.602254"; FPKM "1150.752324"; TPM "2460.707480"; +CM143128.1 StringTie exon 241320 241774 1000 - . gene_id "SS.1245"; transcript_id "SS.1245.1"; exon_number "1"; cov "30597.753906"; +CM143128.1 StringTie exon 242316 242481 1000 - . gene_id "SS.1245"; transcript_id "SS.1245.1"; exon_number "2"; cov "4159.795410"; +CM143128.1 StringTie transcript 245773 246746 1000 . . gene_id "SS.1246"; transcript_id "SS.1246.1"; cov "1901.282341"; FPKM "92.981261"; TPM "198.826177"; +CM143128.1 StringTie exon 245773 246746 1000 . . gene_id "SS.1246"; transcript_id "SS.1246.1"; exon_number "1"; cov "1901.282349"; +CM143128.1 StringTie transcript 247941 249388 1000 . . gene_id "SS.1247"; transcript_id "SS.1247.1"; cov "12033.267956"; FPKM "588.480946"; TPM "1258.376311"; +CM143128.1 StringTie exon 247941 249388 1000 . . gene_id "SS.1247"; transcript_id "SS.1247.1"; exon_number "1"; cov "12033.267578"; +CM143128.1 StringTie transcript 250049 251177 1000 - . gene_id "SS.1248"; transcript_id "SS.1248.1"; cov "3438.918854"; FPKM "168.178605"; TPM "359.624172"; +CM143128.1 StringTie exon 250049 250667 1000 - . gene_id "SS.1248"; transcript_id "SS.1248.1"; exon_number "1"; cov "4026.788330"; +CM143128.1 StringTie exon 250741 250835 1000 - . gene_id "SS.1248"; transcript_id "SS.1248.1"; exon_number "2"; cov "3066.442139"; +CM143128.1 StringTie exon 251054 251177 1000 - . gene_id "SS.1248"; transcript_id "SS.1248.1"; exon_number "3"; cov "789.677429"; +CM143128.1 StringTie transcript 251674 256429 1000 + . gene_id "SS.1249"; transcript_id "SS.1249.1"; cov "286.763357"; FPKM "14.024018"; TPM "29.988214"; +CM143128.1 StringTie exon 251674 251768 1000 + . gene_id "SS.1249"; transcript_id "SS.1249.1"; exon_number "1"; cov "569.178955"; +CM143128.1 StringTie exon 251902 256429 1000 + . gene_id "SS.1249"; transcript_id "SS.1249.1"; exon_number "2"; cov "280.838104"; +CM143128.1 StringTie transcript 257184 261019 1000 . . gene_id "SS.1250"; transcript_id "SS.1250.1"; cov "336.743483"; FPKM "16.468271"; TPM "35.214875"; +CM143128.1 StringTie exon 257184 261019 1000 . . gene_id "SS.1250"; transcript_id "SS.1250.1"; exon_number "1"; cov "336.743469"; +CM143128.1 StringTie transcript 261333 264029 1000 . . gene_id "SS.1251"; transcript_id "SS.1251.1"; cov "858.866148"; FPKM "42.002419"; TPM "89.815736"; +CM143128.1 StringTie exon 261333 264029 1000 . . gene_id "SS.1251"; transcript_id "SS.1251.1"; exon_number "1"; cov "858.866150"; +CM143128.1 StringTie transcript 264321 267378 1000 - . gene_id "SS.1252"; transcript_id "SS.1252.1"; cov "407.692255"; FPKM "19.937986"; TPM "42.634327"; +CM143128.1 StringTie exon 264321 267171 1000 - . gene_id "SS.1252"; transcript_id "SS.1252.1"; exon_number "1"; cov "410.753082"; +CM143128.1 StringTie exon 267325 267378 1000 - . gene_id "SS.1252"; transcript_id "SS.1252.1"; exon_number "2"; cov "246.092590"; +CM143128.1 StringTie transcript 268860 270009 1000 + . gene_id "SS.1253"; transcript_id "SS.1253.1"; cov "10541.292202"; FPKM "515.516618"; TPM "1102.353280"; +CM143128.1 StringTie exon 268860 269009 1000 + . gene_id "SS.1253"; transcript_id "SS.1253.1"; exon_number "1"; cov "4410.229980"; +CM143128.1 StringTie exon 269070 270009 1000 + . gene_id "SS.1253"; transcript_id "SS.1253.1"; exon_number "2"; cov "11519.653320"; +CM143128.1 StringTie transcript 270347 274620 1000 . . gene_id "SS.1254"; transcript_id "SS.1254.1"; cov "143.426766"; FPKM "7.014214"; TPM "14.998822"; +CM143128.1 StringTie exon 270347 274620 1000 . . gene_id "SS.1254"; transcript_id "SS.1254.1"; exon_number "1"; cov "143.426773"; +CM143128.1 StringTie transcript 300572 302896 1000 . . gene_id "SS.1255"; transcript_id "SS.1255.1"; cov "241.563011"; FPKM "11.813518"; TPM "25.261398"; +CM143128.1 StringTie exon 300572 302896 1000 . . gene_id "SS.1255"; transcript_id "SS.1255.1"; exon_number "1"; cov "241.563004"; +CM143128.1 StringTie transcript 275346 276829 1000 . . gene_id "SS.1256"; transcript_id "SS.1256.1"; cov "4307.667790"; FPKM "210.664337"; TPM "450.473398"; +CM143128.1 StringTie exon 275346 276829 1000 . . gene_id "SS.1256"; transcript_id "SS.1256.1"; exon_number "1"; cov "4307.667969"; +CM143128.1 StringTie transcript 281008 283181 1000 - . gene_id "SS.1257"; transcript_id "SS.1257.1"; cov "624.194760"; FPKM "30.525932"; TPM "65.275028"; +CM143128.1 StringTie exon 281008 281527 1000 - . gene_id "SS.1257"; transcript_id "SS.1257.1"; exon_number "1"; cov "1116.116333"; +CM143128.1 StringTie exon 281636 283181 1000 - . gene_id "SS.1257"; transcript_id "SS.1257.1"; exon_number "2"; cov "458.736023"; +CM143128.1 StringTie transcript 281008 283181 1000 - . gene_id "SS.1257"; transcript_id "SS.1257.2"; cov "68.673431"; FPKM "3.358440"; TPM "7.181509"; +CM143128.1 StringTie exon 281008 281527 1000 - . gene_id "SS.1257"; transcript_id "SS.1257.2"; exon_number "1"; cov "114.662529"; +CM143128.1 StringTie exon 281885 283181 1000 - . gene_id "SS.1257"; transcript_id "SS.1257.2"; exon_number "2"; cov "50.235241"; +CM143128.1 StringTie transcript 288394 294618 1000 . . gene_id "SS.1258"; transcript_id "SS.1258.1"; cov "177.438554"; FPKM "8.677544"; TPM "18.555597"; +CM143128.1 StringTie exon 288394 294618 1000 . . gene_id "SS.1258"; transcript_id "SS.1258.1"; exon_number "1"; cov "177.438553"; +CM143128.1 StringTie transcript 295329 297394 1000 . . gene_id "SS.1259"; transcript_id "SS.1259.1"; cov "165.591481"; FPKM "8.098168"; TPM "17.316692"; +CM143128.1 StringTie exon 295329 297394 1000 . . gene_id "SS.1259"; transcript_id "SS.1259.1"; exon_number "1"; cov "165.591476"; +CM143128.1 StringTie transcript 297627 299939 1000 . . gene_id "SS.1260"; transcript_id "SS.1260.1"; cov "202.637700"; FPKM "9.909895"; TPM "21.190792"; +CM143128.1 StringTie exon 297627 299939 1000 . . gene_id "SS.1260"; transcript_id "SS.1260.1"; exon_number "1"; cov "202.637695"; +CM143128.1 StringTie transcript 335500 335770 1000 . . gene_id "SS.1261"; transcript_id "SS.1261.1"; cov "5.147601"; FPKM "0.251741"; TPM "0.538309"; +CM143128.1 StringTie exon 335500 335770 1000 . . gene_id "SS.1261"; transcript_id "SS.1261.1"; exon_number "1"; cov "5.147602"; +CM143128.1 StringTie transcript 303172 306081 1000 . . gene_id "SS.1262"; transcript_id "SS.1262.1"; cov "324.013402"; FPKM "15.845713"; TPM "33.883629"; +CM143128.1 StringTie exon 303172 306081 1000 . . gene_id "SS.1262"; transcript_id "SS.1262.1"; exon_number "1"; cov "324.013397"; +CM143128.1 StringTie transcript 314137 314738 1000 - . gene_id "SS.1263"; transcript_id "SS.1263.1"; cov "2393.936543"; FPKM "117.074268"; TPM "250.345380"; +CM143128.1 StringTie exon 314137 314343 1000 - . gene_id "SS.1263"; transcript_id "SS.1263.1"; exon_number "1"; cov "2029.072510"; +CM143128.1 StringTie exon 314489 314738 1000 - . gene_id "SS.1263"; transcript_id "SS.1263.1"; exon_number "2"; cov "2696.043945"; +CM143128.1 StringTie transcript 317665 319608 1000 . . gene_id "SS.1264"; transcript_id "SS.1264.1"; cov "16670.802469"; FPKM "815.277249"; TPM "1743.345448"; +CM143128.1 StringTie exon 317665 319608 1000 . . gene_id "SS.1264"; transcript_id "SS.1264.1"; exon_number "1"; cov "16670.802734"; +CM143128.1 StringTie transcript 325889 335198 1000 - . gene_id "SS.1265"; transcript_id "SS.1265.1"; cov "243.256558"; FPKM "11.896340"; TPM "25.438500"; +CM143128.1 StringTie exon 325889 327290 1000 - . gene_id "SS.1265"; transcript_id "SS.1265.1"; exon_number "1"; cov "233.585587"; +CM143128.1 StringTie exon 327375 335198 1000 - . gene_id "SS.1265"; transcript_id "SS.1265.1"; exon_number "2"; cov "244.989517"; +CM143128.1 StringTie transcript 329757 335198 1000 . . gene_id "SS.1266"; transcript_id "SS.1266.1"; cov "473.578096"; FPKM "23.160100"; TPM "49.524324"; +CM143128.1 StringTie exon 329757 335198 1000 . . gene_id "SS.1266"; transcript_id "SS.1266.1"; exon_number "1"; cov "473.578094"; +CM143128.1 StringTie transcript 336792 337912 1000 + . gene_id "SS.1267"; transcript_id "SS.1267.1"; cov "29076.405996"; FPKM "1421.967080"; TPM "3040.658669"; +CM143128.1 StringTie exon 336792 336884 1000 + . gene_id "SS.1267"; transcript_id "SS.1267.1"; exon_number "1"; cov "588.815369"; +CM143128.1 StringTie exon 337467 337912 1000 + . gene_id "SS.1267"; transcript_id "SS.1267.1"; exon_number "2"; cov "35016.644531"; +CM143128.1 StringTie transcript 338368 346012 1000 . . gene_id "SS.1268"; transcript_id "SS.1268.1"; cov "618.451145"; FPKM "30.245044"; TPM "64.674390"; +CM143128.1 StringTie exon 338368 346012 1000 . . gene_id "SS.1268"; transcript_id "SS.1268.1"; exon_number "1"; cov "618.451172"; +CM143128.1 StringTie transcript 349774 350911 1000 . . gene_id "SS.1269"; transcript_id "SS.1269.1"; cov "352.019332"; FPKM "17.215329"; TPM "36.812343"; +CM143128.1 StringTie exon 349774 350911 1000 . . gene_id "SS.1269"; transcript_id "SS.1269.1"; exon_number "1"; cov "352.019318"; +CM143128.1 StringTie transcript 351221 354214 1000 . . gene_id "SS.1270"; transcript_id "SS.1270.1"; cov "802.238143"; FPKM "39.233055"; TPM "83.893875"; +CM143128.1 StringTie exon 351221 354214 1000 . . gene_id "SS.1270"; transcript_id "SS.1270.1"; exon_number "1"; cov "802.238159"; +CM143128.1 StringTie transcript 354430 357412 1000 . . gene_id "SS.1271"; transcript_id "SS.1271.1"; cov "430.152866"; FPKM "21.036411"; TPM "44.983140"; +CM143128.1 StringTie exon 354430 357412 1000 . . gene_id "SS.1271"; transcript_id "SS.1271.1"; exon_number "1"; cov "430.152863"; +CM143128.1 StringTie transcript 357869 363041 1000 . . gene_id "SS.1272"; transcript_id "SS.1272.1"; cov "282.678910"; FPKM "13.824271"; TPM "29.561084"; +CM143128.1 StringTie exon 357869 363041 1000 . . gene_id "SS.1272"; transcript_id "SS.1272.1"; exon_number "1"; cov "282.678925"; +CM143128.1 StringTie transcript 363297 366830 1000 . . gene_id "SS.1273"; transcript_id "SS.1273.1"; cov "246.948217"; FPKM "12.076879"; TPM "25.824555"; +CM143128.1 StringTie exon 363297 366830 1000 . . gene_id "SS.1273"; transcript_id "SS.1273.1"; exon_number "1"; cov "246.948212"; +CM143128.1 StringTie transcript 367318 368001 1000 . . gene_id "SS.1274"; transcript_id "SS.1274.1"; cov "18050.549708"; FPKM "882.753097"; TPM "1887.632208"; +CM143128.1 StringTie exon 367318 368001 1000 . . gene_id "SS.1274"; transcript_id "SS.1274.1"; exon_number "1"; cov "18050.548828"; +CM143128.1 StringTie transcript 368390 369802 1000 . . gene_id "SS.1275"; transcript_id "SS.1275.1"; cov "4861.685775"; FPKM "237.758309"; TPM "508.409705"; +CM143128.1 StringTie exon 368390 369802 1000 . . gene_id "SS.1275"; transcript_id "SS.1275.1"; exon_number "1"; cov "4861.685547"; +CM143128.1 StringTie transcript 374048 387825 1000 + . gene_id "SS.1276"; transcript_id "SS.1276.1"; cov "335.621450"; FPKM "16.413399"; TPM "35.097538"; +CM143128.1 StringTie exon 374048 386499 1000 + . gene_id "SS.1276"; transcript_id "SS.1276.1"; exon_number "1"; cov "208.724655"; +CM143128.1 StringTie exon 387045 387138 1000 + . gene_id "SS.1276"; transcript_id "SS.1276.1"; exon_number "2"; cov "2774.659668"; +CM143128.1 StringTie exon 387239 387825 1000 + . gene_id "SS.1276"; transcript_id "SS.1276.1"; exon_number "3"; cov "2636.897705"; +CM143128.1 StringTie transcript 396776 397270 1000 . . gene_id "SS.1277"; transcript_id "SS.1277.1"; cov "2868.541414"; FPKM "140.284582"; TPM "299.977078"; +CM143128.1 StringTie exon 396776 397270 1000 . . gene_id "SS.1277"; transcript_id "SS.1277.1"; exon_number "1"; cov "2868.541504"; +CM143128.1 StringTie transcript 398649 401063 1000 . . gene_id "SS.1278"; transcript_id "SS.1278.1"; cov "389.703106"; FPKM "19.058235"; TPM "40.753115"; +CM143128.1 StringTie exon 398649 401063 1000 . . gene_id "SS.1278"; transcript_id "SS.1278.1"; exon_number "1"; cov "389.703094"; +CM143128.1 StringTie transcript 401378 404185 1000 . . gene_id "SS.1279"; transcript_id "SS.1279.1"; cov "1350.057781"; FPKM "66.023900"; TPM "141.181991"; +CM143128.1 StringTie exon 401378 404185 1000 . . gene_id "SS.1279"; transcript_id "SS.1279.1"; exon_number "1"; cov "1350.057739"; +CM143128.1 StringTie transcript 401378 405235 1000 - . gene_id "SS.1280"; transcript_id "SS.1280.1"; cov "144.705361"; FPKM "7.076743"; TPM "15.132531"; +CM143128.1 StringTie exon 401378 404905 1000 - . gene_id "SS.1280"; transcript_id "SS.1280.1"; exon_number "1"; cov "142.986053"; +CM143128.1 StringTie exon 404989 405057 1000 - . gene_id "SS.1280"; transcript_id "SS.1280.1"; exon_number "2"; cov "277.884064"; +CM143128.1 StringTie exon 405143 405235 1000 - . gene_id "SS.1280"; transcript_id "SS.1280.1"; exon_number "3"; cov "111.118279"; +CM143128.1 StringTie transcript 405588 409670 1000 + . gene_id "SS.1281"; transcript_id "SS.1281.1"; cov "355.474866"; FPKM "17.384320"; TPM "37.173705"; +CM143128.1 StringTie exon 405588 407663 1000 + . gene_id "SS.1281"; transcript_id "SS.1281.1"; exon_number "1"; cov "641.804932"; +CM143128.1 StringTie exon 407730 408325 1000 + . gene_id "SS.1281"; transcript_id "SS.1281.1"; exon_number "2"; cov "44.315437"; +CM143128.1 StringTie exon 408424 409670 1000 + . gene_id "SS.1281"; transcript_id "SS.1281.1"; exon_number "3"; cov "27.511627"; +CM143128.1 StringTie transcript 409840 411310 1000 - . gene_id "SS.1282"; transcript_id "SS.1282.1"; cov "1959.500000"; FPKM "95.828367"; TPM "204.914275"; +CM143128.1 StringTie exon 409840 411087 1000 - . gene_id "SS.1282"; transcript_id "SS.1282.1"; exon_number "1"; cov "2124.080078"; +CM143128.1 StringTie exon 411169 411310 1000 - . gene_id "SS.1282"; transcript_id "SS.1282.1"; exon_number "2"; cov "513.049316"; +CM143128.1 StringTie transcript 411836 413533 1000 . . gene_id "SS.1283"; transcript_id "SS.1283.1"; cov "942.960542"; FPKM "46.115013"; TPM "98.609888"; +CM143128.1 StringTie exon 411836 413533 1000 . . gene_id "SS.1283"; transcript_id "SS.1283.1"; exon_number "1"; cov "942.960571"; +CM143128.1 StringTie transcript 415414 423885 1000 . . gene_id "SS.1284"; transcript_id "SS.1284.1"; cov "1489.945231"; FPKM "72.865026"; TPM "155.810690"; +CM143128.1 StringTie exon 415414 423885 1000 . . gene_id "SS.1284"; transcript_id "SS.1284.1"; exon_number "1"; cov "1489.945190"; +CM143128.1 StringTie transcript 424228 426422 1000 . . gene_id "SS.1285"; transcript_id "SS.1285.1"; cov "866.256492"; FPKM "42.363840"; TPM "90.588579"; +CM143128.1 StringTie exon 424228 426422 1000 . . gene_id "SS.1285"; transcript_id "SS.1285.1"; exon_number "1"; cov "866.256470"; +CM143128.1 StringTie transcript 426685 430060 1000 . . gene_id "SS.1286"; transcript_id "SS.1286.1"; cov "1063.196979"; FPKM "51.995116"; TPM "111.183587"; +CM143128.1 StringTie exon 426685 430060 1000 . . gene_id "SS.1286"; transcript_id "SS.1286.1"; exon_number "1"; cov "1063.197021"; +CM143128.1 StringTie transcript 430278 435209 1000 . . gene_id "SS.1287"; transcript_id "SS.1287.1"; cov "213.021492"; FPKM "10.417709"; TPM "22.276675"; +CM143128.1 StringTie exon 430278 435209 1000 . . gene_id "SS.1287"; transcript_id "SS.1287.1"; exon_number "1"; cov "213.021500"; +CM143128.1 StringTie transcript 435520 437490 1000 . . gene_id "SS.1288"; transcript_id "SS.1288.1"; cov "1193.148656"; FPKM "58.350338"; TPM "124.773254"; +CM143128.1 StringTie exon 435520 437490 1000 . . gene_id "SS.1288"; transcript_id "SS.1288.1"; exon_number "1"; cov "1193.148682"; +CM143128.1 StringTie transcript 437853 439875 1000 + . gene_id "SS.1289"; transcript_id "SS.1289.1"; cov "456.825000"; FPKM "22.340798"; TPM "47.772372"; +CM143128.1 StringTie exon 437853 437998 1000 + . gene_id "SS.1289"; transcript_id "SS.1289.1"; exon_number "1"; cov "97.746574"; +CM143128.1 StringTie exon 438062 439875 1000 + . gene_id "SS.1289"; transcript_id "SS.1289.1"; exon_number "2"; cov "485.725464"; +CM143128.1 StringTie transcript 446755 447221 1000 . . gene_id "SS.1290"; transcript_id "SS.1290.1"; cov "181.612420"; FPKM "8.881664"; TPM "18.992078"; +CM143128.1 StringTie exon 446755 447221 1000 . . gene_id "SS.1290"; transcript_id "SS.1290.1"; exon_number "1"; cov "181.612427"; +CM143128.1 StringTie transcript 447495 450607 1000 . . gene_id "SS.1291"; transcript_id "SS.1291.1"; cov "4968.538066"; FPKM "242.983867"; TPM "519.583760"; +CM143128.1 StringTie exon 447495 450607 1000 . . gene_id "SS.1291"; transcript_id "SS.1291.1"; exon_number "1"; cov "4968.538086"; +CM143128.1 StringTie transcript 458383 458906 1000 + . gene_id "SS.1292"; transcript_id "SS.1292.1"; cov "1672.888060"; FPKM "81.811753"; TPM "174.941896"; +CM143128.1 StringTie exon 458383 458504 1000 + . gene_id "SS.1292"; transcript_id "SS.1292.1"; exon_number "1"; cov "692.434448"; +CM143128.1 StringTie exon 458627 458906 1000 + . gene_id "SS.1292"; transcript_id "SS.1292.1"; exon_number "2"; cov "2100.085693"; +CM143128.1 StringTie transcript 463108 464387 1000 . . gene_id "SS.1293"; transcript_id "SS.1293.1"; cov "9471.582813"; FPKM "463.203016"; TPM "990.488659"; +CM143128.1 StringTie exon 463108 464387 1000 . . gene_id "SS.1293"; transcript_id "SS.1293.1"; exon_number "1"; cov "9471.583008"; +CM143128.1 StringTie transcript 464963 466287 1000 . . gene_id "SS.1294"; transcript_id "SS.1294.1"; cov "77.353208"; FPKM "3.782920"; TPM "8.089194"; +CM143128.1 StringTie exon 464963 466287 1000 . . gene_id "SS.1294"; transcript_id "SS.1294.1"; exon_number "1"; cov "77.353210"; +CM143128.1 StringTie transcript 485074 490282 1000 . . gene_id "SS.1295"; transcript_id "SS.1295.1"; cov "92.809752"; FPKM "4.538814"; TPM "9.705559"; +CM143128.1 StringTie exon 485074 490282 1000 . . gene_id "SS.1295"; transcript_id "SS.1295.1"; exon_number "1"; cov "92.809753"; +CM143128.1 StringTie transcript 491017 491842 1000 . . gene_id "SS.1296"; transcript_id "SS.1296.1"; cov "26.785714"; FPKM "1.309942"; TPM "2.801110"; +CM143128.1 StringTie exon 491017 491842 1000 . . gene_id "SS.1296"; transcript_id "SS.1296.1"; exon_number "1"; cov "26.785715"; +CM143128.1 StringTie transcript 466958 468150 1000 . . gene_id "SS.1297"; transcript_id "SS.1297.1"; cov "160.911987"; FPKM "7.869320"; TPM "16.827335"; +CM143128.1 StringTie exon 466958 468150 1000 . . gene_id "SS.1297"; transcript_id "SS.1297.1"; exon_number "1"; cov "160.911987"; +CM143128.1 StringTie transcript 468476 472470 1000 - . gene_id "SS.1298"; transcript_id "SS.1298.1"; cov "364.780882"; FPKM "17.839426"; TPM "38.146879"; +CM143128.1 StringTie exon 468476 472267 1000 - . gene_id "SS.1298"; transcript_id "SS.1298.1"; exon_number "1"; cov "374.154785"; +CM143128.1 StringTie exon 472361 472470 1000 - . gene_id "SS.1298"; transcript_id "SS.1298.1"; exon_number "2"; cov "41.636364"; +CM143128.1 StringTie transcript 478612 481930 1000 - . gene_id "SS.1299"; transcript_id "SS.1299.1"; cov "578.534056"; FPKM "28.292918"; TPM "60.500070"; +CM143128.1 StringTie exon 478612 481789 1000 - . gene_id "SS.1299"; transcript_id "SS.1299.1"; exon_number "1"; cov "571.932007"; +CM143128.1 StringTie exon 481879 481930 1000 - . gene_id "SS.1299"; transcript_id "SS.1299.1"; exon_number "2"; cov "982.019226"; +CM143128.1 StringTie transcript 483054 484066 1000 . . gene_id "SS.1300"; transcript_id "SS.1300.1"; cov "6134.678184"; FPKM "300.013366"; TPM "641.532602"; +CM143128.1 StringTie exon 483054 484066 1000 . . gene_id "SS.1300"; transcript_id "SS.1300.1"; exon_number "1"; cov "6134.678223"; +CM143128.1 StringTie transcript 566513 568596 1000 . . gene_id "SS.1301"; transcript_id "SS.1301.1"; cov "376.999520"; FPKM "18.436973"; TPM "39.424641"; +CM143128.1 StringTie exon 566513 568596 1000 . . gene_id "SS.1301"; transcript_id "SS.1301.1"; exon_number "1"; cov "376.999512"; +CM143128.1 StringTie transcript 569548 571523 1000 . . gene_id "SS.1302"; transcript_id "SS.1302.1"; cov "222.255567"; FPKM "10.869297"; TPM "23.242326"; +CM143128.1 StringTie exon 569548 571523 1000 . . gene_id "SS.1302"; transcript_id "SS.1302.1"; exon_number "1"; cov "222.255569"; +CM143128.1 StringTie transcript 572174 573254 1000 . . gene_id "SS.1303"; transcript_id "SS.1303.1"; cov "10.357077"; FPKM "0.506508"; TPM "1.083089"; +CM143128.1 StringTie exon 572174 573254 1000 . . gene_id "SS.1303"; transcript_id "SS.1303.1"; exon_number "1"; cov "10.357077"; +CM143128.1 StringTie transcript 574629 578434 1000 - . gene_id "SS.1304"; transcript_id "SS.1304.1"; cov "788.472563"; FPKM "38.559856"; TPM "82.454342"; +CM143128.1 StringTie exon 574629 578132 1000 - . gene_id "SS.1304"; transcript_id "SS.1304.1"; exon_number "1"; cov "766.728577"; +CM143128.1 StringTie exon 578276 578434 1000 - . gene_id "SS.1304"; transcript_id "SS.1304.1"; exon_number "2"; cov "1267.660400"; +CM143128.1 StringTie transcript 579233 581062 1000 . . gene_id "SS.1305"; transcript_id "SS.1305.1"; cov "368.988525"; FPKM "18.045199"; TPM "38.586893"; +CM143128.1 StringTie exon 579233 581062 1000 . . gene_id "SS.1305"; transcript_id "SS.1305.1"; exon_number "1"; cov "368.988525"; +CM143128.1 StringTie transcript 581623 591078 1000 . . gene_id "SS.1306"; transcript_id "SS.1306.1"; cov "430.296584"; FPKM "21.043439"; TPM "44.998169"; +CM143128.1 StringTie exon 581623 591078 1000 . . gene_id "SS.1306"; transcript_id "SS.1306.1"; exon_number "1"; cov "430.296570"; +CM143128.1 StringTie transcript 581673 587421 1000 + . gene_id "SS.1307"; transcript_id "SS.1307.1"; cov "314.149409"; FPKM "15.363320"; TPM "32.852104"; +CM143128.1 StringTie exon 581673 585297 1000 + . gene_id "SS.1307"; transcript_id "SS.1307.1"; exon_number "1"; cov "282.286194"; +CM143128.1 StringTie exon 585629 587421 1000 + . gene_id "SS.1307"; transcript_id "SS.1307.1"; exon_number "2"; cov "378.568878"; +CM143128.1 StringTie transcript 495887 499989 1000 + . gene_id "SS.1308"; transcript_id "SS.1308.1"; cov "1922.649206"; FPKM "94.026197"; TPM "201.060612"; +CM143128.1 StringTie exon 495887 498672 1000 + . gene_id "SS.1308"; transcript_id "SS.1308.1"; exon_number "1"; cov "96.480614"; +CM143128.1 StringTie exon 498748 499989 1000 + . gene_id "SS.1308"; transcript_id "SS.1308.1"; exon_number "2"; cov "6019.030762"; +CM143128.1 StringTie transcript 502349 508258 1000 . . gene_id "SS.1309"; transcript_id "SS.1309.1"; cov "8002.381049"; FPKM "391.352439"; TPM "836.847213"; +CM143128.1 StringTie exon 502349 508258 1000 . . gene_id "SS.1309"; transcript_id "SS.1309.1"; exon_number "1"; cov "8002.380859"; +CM143128.1 StringTie transcript 508474 509793 1000 + . gene_id "SS.1310"; transcript_id "SS.1310.1"; cov "1591.806667"; FPKM "77.846508"; TPM "166.462827"; +CM143128.1 StringTie exon 508474 508687 1000 + . gene_id "SS.1310"; transcript_id "SS.1310.1"; exon_number "1"; cov "699.214966"; +CM143128.1 StringTie exon 508808 509793 1000 + . gene_id "SS.1310"; transcript_id "SS.1310.1"; exon_number "2"; cov "1785.533447"; +CM143128.1 StringTie transcript 514851 517229 1000 + . gene_id "SS.1311"; transcript_id "SS.1311.1"; cov "4784.996872"; FPKM "234.007877"; TPM "500.389980"; +CM143128.1 StringTie exon 514851 514926 1000 + . gene_id "SS.1311"; transcript_id "SS.1311.1"; exon_number "1"; cov "1944.078979"; +CM143128.1 StringTie exon 515068 517229 1000 + . gene_id "SS.1311"; transcript_id "SS.1311.1"; exon_number "2"; cov "4884.862793"; +CM143128.1 StringTie transcript 517558 519213 1000 . . gene_id "SS.1312"; transcript_id "SS.1312.1"; cov "591.587560"; FPKM "28.931293"; TPM "61.865137"; +CM143128.1 StringTie exon 517558 519213 1000 . . gene_id "SS.1312"; transcript_id "SS.1312.1"; exon_number "1"; cov "591.587585"; +CM143128.1 StringTie transcript 519525 520695 1000 - . gene_id "SS.1313"; transcript_id "SS.1313.1"; cov "3515.327884"; FPKM "171.915350"; TPM "367.614629"; +CM143128.1 StringTie exon 519525 520595 1000 - . gene_id "SS.1313"; transcript_id "SS.1313.1"; exon_number "1"; cov "3591.731201"; +CM143128.1 StringTie exon 520666 520695 1000 - . gene_id "SS.1313"; transcript_id "SS.1313.1"; exon_number "2"; cov "787.733337"; +CM143128.1 StringTie transcript 521144 523798 1000 . . gene_id "SS.1314"; transcript_id "SS.1314.1"; cov "2281.690960"; FPKM "111.584954"; TPM "238.607323"; +CM143128.1 StringTie exon 521144 523798 1000 . . gene_id "SS.1314"; transcript_id "SS.1314.1"; exon_number "1"; cov "2281.690918"; +CM143128.1 StringTie transcript 521144 524898 1000 - . gene_id "SS.1315"; transcript_id "SS.1315.1"; cov "273.582939"; FPKM "13.379437"; TPM "28.609875"; +CM143128.1 StringTie exon 521144 524473 1000 - . gene_id "SS.1315"; transcript_id "SS.1315.1"; exon_number "1"; cov "268.762238"; +CM143128.1 StringTie exon 524565 524736 1000 - . gene_id "SS.1315"; transcript_id "SS.1315.1"; exon_number "2"; cov "483.761627"; +CM143128.1 StringTie exon 524805 524898 1000 - . gene_id "SS.1315"; transcript_id "SS.1315.1"; exon_number "3"; cov "59.776596"; +CM143128.1 StringTie transcript 525117 526707 1000 + . gene_id "SS.1316"; transcript_id "SS.1316.1"; cov "398.802145"; FPKM "19.503219"; TPM "41.704645"; +CM143128.1 StringTie exon 525117 525266 1000 + . gene_id "SS.1316"; transcript_id "SS.1316.1"; exon_number "1"; cov "331.633331"; +CM143128.1 StringTie exon 525331 526707 1000 + . gene_id "SS.1316"; transcript_id "SS.1316.1"; exon_number "2"; cov "406.119019"; +CM143128.1 StringTie transcript 525895 526707 1000 . . gene_id "SS.1317"; transcript_id "SS.1317.1"; cov "1894.361777"; FPKM "92.642814"; TPM "198.102460"; +CM143128.1 StringTie exon 525895 526707 1000 . . gene_id "SS.1317"; transcript_id "SS.1317.1"; exon_number "1"; cov "1894.361816"; +CM143128.1 StringTie transcript 528743 530638 1000 . . gene_id "SS.1318"; transcript_id "SS.1318.1"; cov "6733.174051"; FPKM "329.282506"; TPM "704.120174"; +CM143128.1 StringTie exon 528743 530638 1000 . . gene_id "SS.1318"; transcript_id "SS.1318.1"; exon_number "1"; cov "6733.173828"; +CM143128.1 StringTie transcript 533119 540232 1000 . . gene_id "SS.1319"; transcript_id "SS.1319.1"; cov "3265.413551"; FPKM "159.693415"; TPM "341.479893"; +CM143128.1 StringTie exon 533119 540232 1000 . . gene_id "SS.1319"; transcript_id "SS.1319.1"; exon_number "1"; cov "3265.413574"; +CM143128.1 StringTie transcript 540795 549064 1000 . . gene_id "SS.1320"; transcript_id "SS.1320.1"; cov "193.186457"; FPKM "9.447687"; TPM "20.202431"; +CM143128.1 StringTie exon 540795 549064 1000 . . gene_id "SS.1320"; transcript_id "SS.1320.1"; exon_number "1"; cov "193.186462"; +CM143128.1 StringTie transcript 549323 550297 1000 . . gene_id "SS.1321"; transcript_id "SS.1321.1"; cov "488.172308"; FPKM "23.873822"; TPM "51.050510"; +CM143128.1 StringTie exon 549323 550297 1000 . . gene_id "SS.1321"; transcript_id "SS.1321.1"; exon_number "1"; cov "488.172302"; +CM143128.1 StringTie transcript 551016 551764 1000 . . gene_id "SS.1322"; transcript_id "SS.1322.1"; cov "2604.656876"; FPKM "127.379441"; TPM "272.381412"; +CM143128.1 StringTie exon 551016 551764 1000 . . gene_id "SS.1322"; transcript_id "SS.1322.1"; exon_number "1"; cov "2604.656982"; +CM143128.1 StringTie transcript 560192 562801 1000 . . gene_id "SS.1323"; transcript_id "SS.1323.1"; cov "1319.333716"; FPKM "64.521355"; TPM "137.969029"; +CM143128.1 StringTie exon 560192 562801 1000 . . gene_id "SS.1323"; transcript_id "SS.1323.1"; exon_number "1"; cov "1319.333740"; +CM143128.1 StringTie transcript 563640 566203 1000 - . gene_id "SS.1324"; transcript_id "SS.1324.1"; cov "1911.775869"; FPKM "93.494442"; TPM "199.923535"; +CM143128.1 StringTie exon 563640 565537 1000 - . gene_id "SS.1324"; transcript_id "SS.1324.1"; exon_number "1"; cov "1999.268188"; +CM143128.1 StringTie exon 565657 566203 1000 - . gene_id "SS.1324"; transcript_id "SS.1324.1"; exon_number "2"; cov "1608.192017"; +CM143128.1 StringTie transcript 591422 594738 1000 . . gene_id "SS.1325"; transcript_id "SS.1325.1"; cov "435.653000"; FPKM "21.305392"; TPM "45.558315"; +CM143128.1 StringTie exon 591422 594738 1000 . . gene_id "SS.1325"; transcript_id "SS.1325.1"; exon_number "1"; cov "435.652985"; +CM143128.1 StringTie transcript 595188 596423 1000 - . gene_id "SS.1326"; transcript_id "SS.1326.1"; cov "436.602941"; FPKM "21.351848"; TPM "45.657655"; +CM143128.1 StringTie exon 595188 596217 1000 - . gene_id "SS.1326"; transcript_id "SS.1326.1"; exon_number "1"; cov "466.933990"; +CM143128.1 StringTie exon 596298 596423 1000 - . gene_id "SS.1326"; transcript_id "SS.1326.1"; exon_number "2"; cov "188.658737"; +CM143128.1 StringTie transcript 596738 600016 1000 . . gene_id "SS.1327"; transcript_id "SS.1327.1"; cov "1689.780116"; FPKM "82.637851"; TPM "176.708379"; +CM143128.1 StringTie exon 596738 600016 1000 . . gene_id "SS.1327"; transcript_id "SS.1327.1"; exon_number "1"; cov "1689.780151"; +CM143128.1 StringTie transcript 600378 603523 1000 . . gene_id "SS.1328"; transcript_id "SS.1328.1"; cov "689.653846"; FPKM "33.727176"; TPM "72.120397"; +CM143128.1 StringTie exon 600378 603523 1000 . . gene_id "SS.1328"; transcript_id "SS.1328.1"; exon_number "1"; cov "689.653870"; +CM143128.1 StringTie transcript 603930 606386 1000 . . gene_id "SS.1329"; transcript_id "SS.1329.1"; cov "839.612536"; FPKM "41.060831"; TPM "87.802294"; +CM143128.1 StringTie exon 603930 606386 1000 . . gene_id "SS.1329"; transcript_id "SS.1329.1"; exon_number "1"; cov "839.612549"; +CM143128.1 StringTie transcript 606700 626734 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.1"; cov "199.139050"; FPKM "9.738796"; TPM "20.824922"; +CM143128.1 StringTie exon 606700 618866 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.1"; exon_number "1"; cov "213.067871"; +CM143128.1 StringTie exon 619134 626734 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.1"; exon_number "2"; cov "176.843048"; +CM143128.1 StringTie transcript 606700 626734 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.2"; cov "42.830546"; FPKM "2.094606"; TPM "4.478995"; +CM143128.1 StringTie exon 606700 607672 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.2"; exon_number "1"; cov "51.444733"; +CM143128.1 StringTie exon 607781 618866 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.2"; exon_number "2"; cov "45.192516"; +CM143128.1 StringTie exon 619134 626734 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.2"; exon_number "3"; cov "38.282936"; +CM143128.1 StringTie transcript 606700 626734 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.3"; cov "32.853011"; FPKM "1.606660"; TPM "3.435596"; +CM143128.1 StringTie exon 606700 607708 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.3"; exon_number "1"; cov "40.388313"; +CM143128.1 StringTie exon 607889 618866 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.3"; exon_number "2"; cov "34.472881"; +CM143128.1 StringTie exon 619134 626734 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.3"; exon_number "3"; cov "29.513182"; +CM143128.1 StringTie transcript 606700 626734 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.4"; cov "12.007129"; FPKM "0.587203"; TPM "1.255643"; +CM143128.1 StringTie exon 606700 607708 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.4"; exon_number "1"; cov "14.623199"; +CM143128.1 StringTie exon 607745 618866 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.4"; exon_number "2"; cov "12.672893"; +CM143128.1 StringTie exon 619134 626734 1000 - . gene_id "SS.1330"; transcript_id "SS.1330.4"; exon_number "3"; cov "10.685693"; +CM143128.1 StringTie transcript 627803 631544 1000 . . gene_id "SS.1331"; transcript_id "SS.1331.1"; cov "974.098878"; FPKM "47.637818"; TPM "101.866173"; +CM143128.1 StringTie exon 627803 631544 1000 . . gene_id "SS.1331"; transcript_id "SS.1331.1"; exon_number "1"; cov "974.098877"; +CM143128.1 StringTie transcript 631956 633879 1000 . . gene_id "SS.1332"; transcript_id "SS.1332.1"; cov "695.590437"; FPKM "34.017502"; TPM "72.741215"; +CM143128.1 StringTie exon 631956 633879 1000 . . gene_id "SS.1332"; transcript_id "SS.1332.1"; exon_number "1"; cov "695.590454"; +CM143128.1 StringTie transcript 634104 643373 1000 . . gene_id "SS.1333"; transcript_id "SS.1333.1"; cov "243.515426"; FPKM "11.909000"; TPM "25.465571"; +CM143128.1 StringTie exon 634104 643373 1000 . . gene_id "SS.1333"; transcript_id "SS.1333.1"; exon_number "1"; cov "243.515427"; +CM143128.1 StringTie transcript 643627 644273 1000 . . gene_id "SS.1334"; transcript_id "SS.1334.1"; cov "26.865533"; FPKM "1.313845"; TPM "2.809457"; +CM143128.1 StringTie exon 643627 644273 1000 . . gene_id "SS.1334"; transcript_id "SS.1334.1"; exon_number "1"; cov "26.865534"; +CM143128.1 StringTie transcript 644509 647416 1000 . . gene_id "SS.1335"; transcript_id "SS.1335.1"; cov "514.055365"; FPKM "25.139620"; TPM "53.757225"; +CM143128.1 StringTie exon 644509 647416 1000 . . gene_id "SS.1335"; transcript_id "SS.1335.1"; exon_number "1"; cov "514.055359"; +CM143128.1 StringTie transcript 647971 649213 1000 + . gene_id "SS.1336"; transcript_id "SS.1336.1"; cov "9242.328922"; FPKM "451.991469"; TPM "966.514485"; +CM143128.1 StringTie exon 647971 648109 1000 + . gene_id "SS.1336"; transcript_id "SS.1336.1"; exon_number "1"; cov "2063.733887"; +CM143128.1 StringTie exon 648824 649213 1000 + . gene_id "SS.1336"; transcript_id "SS.1336.1"; exon_number "2"; cov "11800.853516"; +CM143128.1 StringTie transcript 649564 650244 1000 . . gene_id "SS.1337"; transcript_id "SS.1337.1"; cov "1299.941263"; FPKM "63.572977"; TPM "135.941068"; +CM143128.1 StringTie exon 649564 650244 1000 . . gene_id "SS.1337"; transcript_id "SS.1337.1"; exon_number "1"; cov "1299.941284"; +CM143128.1 StringTie transcript 650904 653477 1000 . . gene_id "SS.1338"; transcript_id "SS.1338.1"; cov "823.705517"; FPKM "40.282906"; TPM "86.138821"; +CM143128.1 StringTie exon 650904 653477 1000 . . gene_id "SS.1338"; transcript_id "SS.1338.1"; exon_number "1"; cov "823.705505"; +CM143128.1 StringTie transcript 653683 658266 1000 . . gene_id "SS.1339"; transcript_id "SS.1339.1"; cov "168.643106"; FPKM "8.247407"; TPM "17.635815"; +CM143128.1 StringTie exon 653683 658266 1000 . . gene_id "SS.1339"; transcript_id "SS.1339.1"; exon_number "1"; cov "168.643112"; +CM143128.1 StringTie transcript 660260 661210 1000 . . gene_id "SS.1340"; transcript_id "SS.1340.1"; cov "1149.175605"; FPKM "56.199858"; TPM "120.174782"; +CM143128.1 StringTie exon 660260 661210 1000 . . gene_id "SS.1340"; transcript_id "SS.1340.1"; exon_number "1"; cov "1149.175659"; +CM143128.1 StringTie transcript 661816 663867 1000 . . gene_id "SS.1341"; transcript_id "SS.1341.1"; cov "3923.645712"; FPKM "191.883929"; TPM "410.314375"; +CM143128.1 StringTie exon 661816 663867 1000 . . gene_id "SS.1341"; transcript_id "SS.1341.1"; exon_number "1"; cov "3923.645752"; +CM143128.1 StringTie transcript 664168 666915 1000 . . gene_id "SS.1342"; transcript_id "SS.1342.1"; cov "219.034934"; FPKM "10.711794"; TPM "22.905529"; +CM143128.1 StringTie exon 664168 666915 1000 . . gene_id "SS.1342"; transcript_id "SS.1342.1"; exon_number "1"; cov "219.034927"; +CM143128.1 StringTie transcript 667234 669876 1000 . . gene_id "SS.1343"; transcript_id "SS.1343.1"; cov "3095.720015"; FPKM "151.394638"; TPM "323.734230"; +CM143128.1 StringTie exon 667234 669876 1000 . . gene_id "SS.1343"; transcript_id "SS.1343.1"; exon_number "1"; cov "3095.719971"; +CM143128.1 StringTie transcript 670389 679802 1000 . . gene_id "SS.1344"; transcript_id "SS.1344.1"; cov "297.686849"; FPKM "14.558226"; TPM "31.130536"; +CM143128.1 StringTie exon 670389 679802 1000 . . gene_id "SS.1344"; transcript_id "SS.1344.1"; exon_number "1"; cov "297.686859"; +CM143128.1 StringTie transcript 680243 682507 1000 . . gene_id "SS.1345"; transcript_id "SS.1345.1"; cov "463.681236"; FPKM "22.676099"; TPM "48.489362"; +CM143128.1 StringTie exon 680243 682507 1000 . . gene_id "SS.1345"; transcript_id "SS.1345.1"; exon_number "1"; cov "463.681244"; +CM143128.1 StringTie transcript 683290 686182 1000 + . gene_id "SS.1346"; transcript_id "SS.1346.1"; cov "755.820604"; FPKM "36.963028"; TPM "79.039771"; +CM143128.1 StringTie exon 683290 683435 1000 + . gene_id "SS.1346"; transcript_id "SS.1346.1"; exon_number "1"; cov "89.575340"; +CM143128.1 StringTie exon 683514 686182 1000 + . gene_id "SS.1346"; transcript_id "SS.1346.1"; exon_number "2"; cov "792.265625"; +CM143128.1 StringTie transcript 686522 687234 1000 . . gene_id "SS.1347"; transcript_id "SS.1347.1"; cov "3263.479663"; FPKM "159.598839"; TPM "341.277658"; +CM143128.1 StringTie exon 686522 687234 1000 . . gene_id "SS.1347"; transcript_id "SS.1347.1"; exon_number "1"; cov "3263.479736"; +CM143128.1 StringTie transcript 712832 713912 1000 . . gene_id "SS.1348"; transcript_id "SS.1348.1"; cov "743.956522"; FPKM "36.382821"; TPM "77.799087"; +CM143128.1 StringTie exon 712832 713912 1000 . . gene_id "SS.1348"; transcript_id "SS.1348.1"; exon_number "1"; cov "743.956543"; +CM143128.1 StringTie transcript 692566 693788 1000 . . gene_id "SS.1349"; transcript_id "SS.1349.1"; cov "7068.890433"; FPKM "345.700548"; TPM "739.227640"; +CM143128.1 StringTie exon 692566 693788 1000 . . gene_id "SS.1349"; transcript_id "SS.1349.1"; exon_number "1"; cov "7068.890625"; +CM143128.1 StringTie transcript 699965 702505 1000 + . gene_id "SS.1350"; transcript_id "SS.1350.1"; cov "2208.029150"; FPKM "107.982560"; TPM "230.904156"; +CM143128.1 StringTie exon 699965 700122 1000 + . gene_id "SS.1350"; transcript_id "SS.1350.1"; exon_number "1"; cov "825.329102"; +CM143128.1 StringTie exon 700194 702505 1000 + . gene_id "SS.1350"; transcript_id "SS.1350.1"; exon_number "2"; cov "2302.521729"; +CM143128.1 StringTie transcript 702993 706024 1000 + . gene_id "SS.1351"; transcript_id "SS.1351.1"; cov "8017.013143"; FPKM "392.068014"; TPM "838.377360"; +CM143128.1 StringTie exon 702993 703073 1000 + . gene_id "SS.1351"; transcript_id "SS.1351.1"; exon_number "1"; cov "1417.839478"; +CM143128.1 StringTie exon 703519 706024 1000 + . gene_id "SS.1351"; transcript_id "SS.1351.1"; exon_number "2"; cov "8230.314453"; +CM143128.1 StringTie transcript 706259 709709 1000 . . gene_id "SS.1352"; transcript_id "SS.1352.1"; cov "478.326427"; FPKM "23.392314"; TPM "50.020879"; +CM143128.1 StringTie exon 706259 709709 1000 . . gene_id "SS.1352"; transcript_id "SS.1352.1"; exon_number "1"; cov "478.326416"; +CM143128.1 StringTie transcript 706259 710133 1000 - . gene_id "SS.1353"; transcript_id "SS.1353.1"; cov "25.270402"; FPKM "1.235836"; TPM "2.642647"; +CM143128.1 StringTie exon 706259 709037 1000 - . gene_id "SS.1353"; transcript_id "SS.1353.1"; exon_number "1"; cov "18.807409"; +CM143128.1 StringTie exon 709106 709724 1000 - . gene_id "SS.1353"; transcript_id "SS.1353.1"; exon_number "2"; cov "22.021959"; +CM143128.1 StringTie exon 709787 709871 1000 - . gene_id "SS.1353"; transcript_id "SS.1353.1"; exon_number "3"; cov "135.532074"; +CM143128.1 StringTie exon 709964 710133 1000 - . gene_id "SS.1353"; transcript_id "SS.1353.1"; exon_number "4"; cov "87.618629"; +CM143128.1 StringTie transcript 709188 710133 1000 - . gene_id "SS.1353"; transcript_id "SS.1353.2"; cov "190.442546"; FPKM "9.313497"; TPM "19.915487"; +CM143128.1 StringTie exon 709188 709724 1000 - . gene_id "SS.1353"; transcript_id "SS.1353.2"; exon_number "1"; cov "94.666893"; +CM143128.1 StringTie exon 709787 709871 1000 - . gene_id "SS.1353"; transcript_id "SS.1353.2"; exon_number "2"; cov "511.738525"; +CM143128.1 StringTie exon 709968 710133 1000 - . gene_id "SS.1353"; transcript_id "SS.1353.2"; exon_number "3"; cov "335.752014"; +CM143128.1 StringTie transcript 714371 715970 1000 . . gene_id "SS.1354"; transcript_id "SS.1354.1"; cov "247.840625"; FPKM "12.120522"; TPM "25.917878"; +CM143128.1 StringTie exon 714371 715970 1000 . . gene_id "SS.1354"; transcript_id "SS.1354.1"; exon_number "1"; cov "247.840622"; +CM143128.1 StringTie transcript 716328 718425 1000 . . gene_id "SS.1355"; transcript_id "SS.1355.1"; cov "497.924690"; FPKM "24.350758"; TPM "52.070363"; +CM143128.1 StringTie exon 716328 718425 1000 . . gene_id "SS.1355"; transcript_id "SS.1355.1"; exon_number "1"; cov "497.924683"; +CM143128.1 StringTie transcript 718786 723703 1000 . . gene_id "SS.1356"; transcript_id "SS.1356.1"; cov "345.416633"; FPKM "16.892428"; TPM "36.121867"; +CM143128.1 StringTie exon 718786 723703 1000 . . gene_id "SS.1356"; transcript_id "SS.1356.1"; exon_number "1"; cov "345.416626"; +CM143128.1 StringTie transcript 723923 726179 1000 . . gene_id "SS.1357"; transcript_id "SS.1357.1"; cov "184.311918"; FPKM "9.013682"; TPM "19.274378"; +CM143128.1 StringTie exon 723923 726179 1000 . . gene_id "SS.1357"; transcript_id "SS.1357.1"; exon_number "1"; cov "184.311920"; +CM143128.1 StringTie transcript 726456 727648 1000 . . gene_id "SS.1358"; transcript_id "SS.1358.1"; cov "1373.650461"; FPKM "67.177688"; TPM "143.649190"; +CM143128.1 StringTie exon 726456 727648 1000 . . gene_id "SS.1358"; transcript_id "SS.1358.1"; exon_number "1"; cov "1373.650513"; +CM143128.1 StringTie transcript 729049 747681 1000 . . gene_id "SS.1359"; transcript_id "SS.1359.1"; cov "233.256802"; FPKM "11.407307"; TPM "24.392778"; +CM143128.1 StringTie exon 729049 747681 1000 . . gene_id "SS.1359"; transcript_id "SS.1359.1"; exon_number "1"; cov "233.256805"; +CM143128.1 StringTie transcript 747975 751760 1000 . . gene_id "SS.1360"; transcript_id "SS.1360.1"; cov "898.644744"; FPKM "43.947771"; TPM "93.975574"; +CM143128.1 StringTie exon 747975 751760 1000 . . gene_id "SS.1360"; transcript_id "SS.1360.1"; exon_number "1"; cov "898.644714"; +CM143128.1 StringTie transcript 754664 756843 1000 . . gene_id "SS.1361"; transcript_id "SS.1361.1"; cov "1316.185780"; FPKM "64.367407"; TPM "137.639834"; +CM143128.1 StringTie exon 754664 756843 1000 . . gene_id "SS.1361"; transcript_id "SS.1361.1"; exon_number "1"; cov "1316.185791"; +CM143128.1 StringTie transcript 757132 760640 1000 . . gene_id "SS.1362"; transcript_id "SS.1362.1"; cov "1124.499288"; FPKM "54.993075"; TPM "117.594262"; +CM143128.1 StringTie exon 757132 760640 1000 . . gene_id "SS.1362"; transcript_id "SS.1362.1"; exon_number "1"; cov "1124.499268"; +CM143128.1 StringTie transcript 760947 765760 1000 . . gene_id "SS.1363"; transcript_id "SS.1363.1"; cov "495.809722"; FPKM "24.247326"; TPM "51.849191"; +CM143128.1 StringTie exon 760947 765760 1000 . . gene_id "SS.1363"; transcript_id "SS.1363.1"; exon_number "1"; cov "495.809723"; +CM143128.1 StringTie transcript 765981 773325 1000 . . gene_id "SS.1364"; transcript_id "SS.1364.1"; cov "284.531382"; FPKM "13.914865"; TPM "29.754806"; +CM143128.1 StringTie exon 765981 773325 1000 . . gene_id "SS.1364"; transcript_id "SS.1364.1"; exon_number "1"; cov "284.531372"; +CM143128.1 StringTie transcript 773687 781247 1000 . . gene_id "SS.1365"; transcript_id "SS.1365.1"; cov "194.775559"; FPKM "9.525401"; TPM "20.368611"; +CM143128.1 StringTie exon 773687 781247 1000 . . gene_id "SS.1365"; transcript_id "SS.1365.1"; exon_number "1"; cov "194.775558"; +CM143128.1 StringTie transcript 781585 784583 1000 . . gene_id "SS.1366"; transcript_id "SS.1366.1"; cov "475.239747"; FPKM "23.241362"; TPM "49.698090"; +CM143128.1 StringTie exon 781585 784583 1000 . . gene_id "SS.1366"; transcript_id "SS.1366.1"; exon_number "1"; cov "475.239746"; +CM143128.1 StringTie transcript 793159 795636 1000 . . gene_id "SS.1367"; transcript_id "SS.1367.1"; cov "2455.876513"; FPKM "120.103411"; TPM "256.822738"; +CM143128.1 StringTie exon 793159 795636 1000 . . gene_id "SS.1367"; transcript_id "SS.1367.1"; exon_number "1"; cov "2455.876465"; +CM143128.1 StringTie transcript 796523 805021 1000 . . gene_id "SS.1368"; transcript_id "SS.1368.1"; cov "374.029651"; FPKM "18.291733"; TPM "39.114067"; +CM143128.1 StringTie exon 796523 805021 1000 . . gene_id "SS.1368"; transcript_id "SS.1368.1"; exon_number "1"; cov "374.029663"; +CM143128.1 StringTie transcript 805262 809358 1000 . . gene_id "SS.1369"; transcript_id "SS.1369.1"; cov "454.261899"; FPKM "22.215451"; TPM "47.504337"; +CM143128.1 StringTie exon 805262 809358 1000 . . gene_id "SS.1369"; transcript_id "SS.1369.1"; exon_number "1"; cov "454.261902"; +CM143128.1 StringTie transcript 809650 815886 1000 . . gene_id "SS.1370"; transcript_id "SS.1370.1"; cov "437.368126"; FPKM "21.389269"; TPM "45.737674"; +CM143128.1 StringTie exon 809650 815886 1000 . . gene_id "SS.1370"; transcript_id "SS.1370.1"; exon_number "1"; cov "437.368134"; +CM143128.1 StringTie transcript 816450 817607 1000 . . gene_id "SS.1371"; transcript_id "SS.1371.1"; cov "2346.222798"; FPKM "114.740851"; TPM "245.355726"; +CM143128.1 StringTie exon 816450 817607 1000 . . gene_id "SS.1371"; transcript_id "SS.1371.1"; exon_number "1"; cov "2346.222900"; +CM143128.1 StringTie transcript 822479 824353 1000 + . gene_id "SS.1372"; transcript_id "SS.1372.1"; cov "73.969044"; FPKM "3.617419"; TPM "7.735296"; +CM143128.1 StringTie exon 822479 822557 1000 + . gene_id "SS.1372"; transcript_id "SS.1372.1"; exon_number "1"; cov "27.177216"; +CM143128.1 StringTie exon 822624 824353 1000 + . gene_id "SS.1372"; transcript_id "SS.1372.1"; exon_number "2"; cov "76.105782"; +CM143128.1 StringTie transcript 830311 832519 1000 . . gene_id "SS.1373"; transcript_id "SS.1373.1"; cov "1958.345405"; FPKM "95.771902"; TPM "204.793534"; +CM143128.1 StringTie exon 830311 832519 1000 . . gene_id "SS.1373"; transcript_id "SS.1373.1"; exon_number "1"; cov "1958.345459"; +CM143128.1 StringTie transcript 832832 839910 1000 . . gene_id "SS.1374"; transcript_id "SS.1374.1"; cov "707.683712"; FPKM "34.608918"; TPM "74.005866"; +CM143128.1 StringTie exon 832832 839910 1000 . . gene_id "SS.1374"; transcript_id "SS.1374.1"; exon_number "1"; cov "707.683716"; +CM143128.1 StringTie transcript 840300 841560 1000 . . gene_id "SS.1375"; transcript_id "SS.1375.1"; cov "126.762094"; FPKM "6.199237"; TPM "13.256118"; +CM143128.1 StringTie exon 840300 841560 1000 . . gene_id "SS.1375"; transcript_id "SS.1375.1"; exon_number "1"; cov "126.762093"; +CM143128.1 StringTie transcript 843575 845090 1000 . . gene_id "SS.1376"; transcript_id "SS.1376.1"; cov "36191.496042"; FPKM "1769.926996"; TPM "3784.717623"; +CM143128.1 StringTie exon 843575 845090 1000 . . gene_id "SS.1376"; transcript_id "SS.1376.1"; exon_number "1"; cov "36191.496094"; +CM143128.1 StringTie transcript 849437 850401 1000 . . gene_id "SS.1377"; transcript_id "SS.1377.1"; cov "1958.955440"; FPKM "95.801735"; TPM "204.857328"; +CM143128.1 StringTie exon 849437 850401 1000 . . gene_id "SS.1377"; transcript_id "SS.1377.1"; exon_number "1"; cov "1958.955444"; +CM143128.1 StringTie transcript 854664 855225 1000 . . gene_id "SS.1378"; transcript_id "SS.1378.1"; cov "14005.814947"; FPKM "684.947369"; TPM "1464.654973"; +CM143128.1 StringTie exon 854664 855225 1000 . . gene_id "SS.1378"; transcript_id "SS.1378.1"; exon_number "1"; cov "14005.815430"; +CM143128.1 StringTie transcript 855512 857035 1000 . . gene_id "SS.1379"; transcript_id "SS.1379.1"; cov "935.685039"; FPKM "45.759208"; TPM "97.849054"; +CM143128.1 StringTie exon 855512 857035 1000 . . gene_id "SS.1379"; transcript_id "SS.1379.1"; exon_number "1"; cov "935.685059"; +CM143128.1 StringTie transcript 858135 858875 1000 . . gene_id "SS.1380"; transcript_id "SS.1380.1"; cov "2669.078273"; FPKM "130.529937"; TPM "279.118265"; +CM143128.1 StringTie exon 858135 858875 1000 . . gene_id "SS.1380"; transcript_id "SS.1380.1"; exon_number "1"; cov "2669.078369"; +CM143128.1 StringTie transcript 859294 863484 1000 + . gene_id "SS.1381"; transcript_id "SS.1381.1"; cov "470.593401"; FPKM "23.014135"; TPM "49.212200"; +CM143128.1 StringTie exon 859294 859544 1000 + . gene_id "SS.1381"; transcript_id "SS.1381.1"; exon_number "1"; cov "300.709167"; +CM143128.1 StringTie exon 859614 863484 1000 + . gene_id "SS.1381"; transcript_id "SS.1381.1"; exon_number "2"; cov "481.608887"; +CM143128.1 StringTie transcript 863926 865114 1000 . . gene_id "SS.1382"; transcript_id "SS.1382.1"; cov "8667.005046"; FPKM "423.855543"; TPM "906.350119"; +CM143128.1 StringTie exon 863926 865114 1000 . . gene_id "SS.1382"; transcript_id "SS.1382.1"; exon_number "1"; cov "8667.004883"; +CM143128.1 StringTie transcript 866018 867902 1000 . . gene_id "SS.1383"; transcript_id "SS.1383.1"; cov "183.176127"; FPKM "8.958137"; TPM "19.155603"; +CM143128.1 StringTie exon 866018 867902 1000 . . gene_id "SS.1383"; transcript_id "SS.1383.1"; exon_number "1"; cov "183.176132"; +CM143128.1 StringTie transcript 868211 874032 1000 . . gene_id "SS.1384"; transcript_id "SS.1384.1"; cov "322.560460"; FPKM "15.774658"; TPM "33.731688"; +CM143128.1 StringTie exon 868211 874032 1000 . . gene_id "SS.1384"; transcript_id "SS.1384.1"; exon_number "1"; cov "322.560455"; +CM143128.1 StringTie transcript 874286 881261 1000 . . gene_id "SS.1385"; transcript_id "SS.1385.1"; cov "296.153096"; FPKM "14.483219"; TPM "30.970144"; +CM143128.1 StringTie exon 874286 881261 1000 . . gene_id "SS.1385"; transcript_id "SS.1385.1"; exon_number "1"; cov "296.153107"; +CM143128.1 StringTie transcript 881489 881887 1000 . . gene_id "SS.1386"; transcript_id "SS.1386.1"; cov "6.629073"; FPKM "0.324191"; TPM "0.693234"; +CM143128.1 StringTie exon 881489 881887 1000 . . gene_id "SS.1386"; transcript_id "SS.1386.1"; exon_number "1"; cov "6.629073"; +CM143128.1 StringTie transcript 883126 884160 1000 . . gene_id "SS.1387"; transcript_id "SS.1387.1"; cov "4621.493720"; FPKM "226.011837"; TPM "483.291675"; +CM143128.1 StringTie exon 883126 884160 1000 . . gene_id "SS.1387"; transcript_id "SS.1387.1"; exon_number "1"; cov "4621.493652"; +CM143128.1 StringTie transcript 884796 886765 1000 . . gene_id "SS.1388"; transcript_id "SS.1388.1"; cov "1023.914721"; FPKM "50.074037"; TPM "107.075653"; +CM143128.1 StringTie exon 884796 886765 1000 . . gene_id "SS.1388"; transcript_id "SS.1388.1"; exon_number "1"; cov "1023.914734"; +CM143128.1 StringTie transcript 887254 896734 1000 - . gene_id "SS.1389"; transcript_id "SS.1389.1"; cov "283.114929"; FPKM "13.845594"; TPM "29.606681"; +CM143128.1 StringTie exon 887254 893844 1000 - . gene_id "SS.1389"; transcript_id "SS.1389.1"; exon_number "1"; cov "229.673950"; +CM143128.1 StringTie exon 893955 896734 1000 - . gene_id "SS.1389"; transcript_id "SS.1389.1"; exon_number "2"; cov "409.816193"; +CM143128.1 StringTie transcript 897152 903808 1000 . . gene_id "SS.1390"; transcript_id "SS.1390.1"; cov "549.920835"; FPKM "26.893603"; TPM "57.507849"; +CM143128.1 StringTie exon 897152 903808 1000 . . gene_id "SS.1390"; transcript_id "SS.1390.1"; exon_number "1"; cov "549.920837"; +CM143128.1 StringTie transcript 904015 908013 1000 . . gene_id "SS.1391"; transcript_id "SS.1391.1"; cov "110.125281"; FPKM "5.385622"; TPM "11.516327"; +CM143128.1 StringTie exon 904015 908013 1000 . . gene_id "SS.1391"; transcript_id "SS.1391.1"; exon_number "1"; cov "110.125282"; +CM143128.1 StringTie transcript 912754 913639 1000 . . gene_id "SS.1392"; transcript_id "SS.1392.1"; cov "2148.571106"; FPKM "105.074794"; TPM "224.686344"; +CM143128.1 StringTie exon 912754 913639 1000 . . gene_id "SS.1392"; transcript_id "SS.1392.1"; exon_number "1"; cov "2148.571045"; +CM143128.1 StringTie transcript 913869 915789 1000 . . gene_id "SS.1393"; transcript_id "SS.1393.1"; cov "1855.842790"; FPKM "90.759063"; TPM "194.074346"; +CM143128.1 StringTie exon 913869 915789 1000 . . gene_id "SS.1393"; transcript_id "SS.1393.1"; exon_number "1"; cov "1855.842773"; +CM143128.1 StringTie transcript 918134 919948 1000 . . gene_id "SS.1394"; transcript_id "SS.1394.1"; cov "2420.181818"; FPKM "118.357780"; TPM "253.089974"; +CM143128.1 StringTie exon 918134 919948 1000 . . gene_id "SS.1394"; transcript_id "SS.1394.1"; exon_number "1"; cov "2420.181885"; +CM143128.1 StringTie transcript 920480 920709 1000 . . gene_id "SS.1395"; transcript_id "SS.1395.1"; cov "5.234783"; FPKM "0.256004"; TPM "0.547426"; +CM143128.1 StringTie exon 920480 920709 1000 . . gene_id "SS.1395"; transcript_id "SS.1395.1"; exon_number "1"; cov "5.234783"; +CM143128.1 StringTie transcript 921070 926634 1000 . . gene_id "SS.1396"; transcript_id "SS.1396.1"; cov "239.779695"; FPKM "11.726306"; TPM "25.074908"; +CM143128.1 StringTie exon 921070 926634 1000 . . gene_id "SS.1396"; transcript_id "SS.1396.1"; exon_number "1"; cov "239.779694"; +CM143128.1 StringTie transcript 927525 931105 1000 . . gene_id "SS.1397"; transcript_id "SS.1397.1"; cov "1449.664060"; FPKM "70.895095"; TPM "151.598296"; +CM143128.1 StringTie exon 927525 931105 1000 . . gene_id "SS.1397"; transcript_id "SS.1397.1"; exon_number "1"; cov "1449.664062"; +CM143128.1 StringTie transcript 931317 935068 1000 . . gene_id "SS.1398"; transcript_id "SS.1398.1"; cov "2801.749733"; FPKM "137.018168"; TPM "292.992353"; +CM143128.1 StringTie exon 931317 935068 1000 . . gene_id "SS.1398"; transcript_id "SS.1398.1"; exon_number "1"; cov "2801.749756"; +CM143128.1 StringTie transcript 935883 939029 1000 . . gene_id "SS.1399"; transcript_id "SS.1399.1"; cov "712.688275"; FPKM "34.853663"; TPM "74.529217"; +CM143128.1 StringTie exon 935883 939029 1000 . . gene_id "SS.1399"; transcript_id "SS.1399.1"; exon_number "1"; cov "712.688293"; +CM143128.1 StringTie transcript 939434 947008 1000 . . gene_id "SS.1400"; transcript_id "SS.1400.1"; cov "802.528845"; FPKM "39.247271"; TPM "83.924275"; +CM143128.1 StringTie exon 939434 947008 1000 . . gene_id "SS.1400"; transcript_id "SS.1400.1"; exon_number "1"; cov "802.528870"; +CM143128.1 StringTie transcript 947270 948804 1000 . . gene_id "SS.1401"; transcript_id "SS.1401.1"; cov "937.207818"; FPKM "45.833679"; TPM "98.008298"; +CM143128.1 StringTie exon 947270 948804 1000 . . gene_id "SS.1401"; transcript_id "SS.1401.1"; exon_number "1"; cov "937.207825"; +CM143128.1 StringTie transcript 949093 953972 1000 . . gene_id "SS.1402"; transcript_id "SS.1402.1"; cov "102.557787"; FPKM "5.015537"; TPM "10.724958"; +CM143128.1 StringTie exon 949093 953972 1000 . . gene_id "SS.1402"; transcript_id "SS.1402.1"; exon_number "1"; cov "102.557785"; +CM143128.1 StringTie transcript 954330 957755 1000 . . gene_id "SS.1403"; transcript_id "SS.1403.1"; cov "1028.571220"; FPKM "50.301761"; TPM "107.562606"; +CM143128.1 StringTie exon 954330 957755 1000 . . gene_id "SS.1403"; transcript_id "SS.1403.1"; exon_number "1"; cov "1028.571167"; +CM143128.1 StringTie transcript 958287 959259 1000 . . gene_id "SS.1404"; transcript_id "SS.1404.1"; cov "114.229188"; FPKM "5.586321"; TPM "11.945492"; +CM143128.1 StringTie exon 958287 959259 1000 . . gene_id "SS.1404"; transcript_id "SS.1404.1"; exon_number "1"; cov "114.229187"; +CM143128.1 StringTie transcript 959626 961648 1000 . . gene_id "SS.1405"; transcript_id "SS.1405.1"; cov "1280.168067"; FPKM "62.605978"; TPM "133.873290"; +CM143128.1 StringTie exon 959626 961648 1000 . . gene_id "SS.1405"; transcript_id "SS.1405.1"; exon_number "1"; cov "1280.168091"; +CM143128.1 StringTie transcript 968534 969254 1000 . . gene_id "SS.1406"; transcript_id "SS.1406.1"; cov "3620.399445"; FPKM "177.053822"; TPM "378.602464"; +CM143128.1 StringTie exon 968534 969254 1000 . . gene_id "SS.1406"; transcript_id "SS.1406.1"; exon_number "1"; cov "3620.399414"; +CM143128.1 StringTie transcript 971266 974745 1000 . . gene_id "SS.1407"; transcript_id "SS.1407.1"; cov "684.833621"; FPKM "33.491445"; TPM "71.616323"; +CM143128.1 StringTie exon 971266 974745 1000 . . gene_id "SS.1407"; transcript_id "SS.1407.1"; exon_number "1"; cov "684.833618"; +CM143128.1 StringTie transcript 975651 977535 1000 . . gene_id "SS.1408"; transcript_id "SS.1408.1"; cov "331.500265"; FPKM "16.211855"; TPM "34.666566"; +CM143128.1 StringTie exon 975651 977535 1000 . . gene_id "SS.1408"; transcript_id "SS.1408.1"; exon_number "1"; cov "331.500275"; +CM143128.1 StringTie transcript 998274 1002339 1000 . . gene_id "SS.1409"; transcript_id "SS.1409.1"; cov "69.400394"; FPKM "3.393992"; TPM "7.257531"; +CM143128.1 StringTie exon 998274 1002339 1000 . . gene_id "SS.1409"; transcript_id "SS.1409.1"; exon_number "1"; cov "69.400391"; +CM143128.1 StringTie transcript 980430 982243 1000 . . gene_id "SS.1410"; transcript_id "SS.1410.1"; cov "343.197905"; FPKM "16.783922"; TPM "35.889844"; +CM143128.1 StringTie exon 980430 982243 1000 . . gene_id "SS.1410"; transcript_id "SS.1410.1"; exon_number "1"; cov "343.197906"; +CM143128.1 StringTie transcript 982513 987016 1000 . . gene_id "SS.1411"; transcript_id "SS.1411.1"; cov "269.526865"; FPKM "13.181076"; TPM "28.185712"; +CM143128.1 StringTie exon 982513 987016 1000 . . gene_id "SS.1411"; transcript_id "SS.1411.1"; exon_number "1"; cov "269.526855"; +CM143128.1 StringTie transcript 987996 990456 1000 . . gene_id "SS.1412"; transcript_id "SS.1412.1"; cov "1534.823243"; FPKM "75.059762"; TPM "160.503798"; +CM143128.1 StringTie exon 987996 990456 1000 . . gene_id "SS.1412"; transcript_id "SS.1412.1"; exon_number "1"; cov "1534.823242"; +CM143128.1 StringTie transcript 990802 992889 1000 + . gene_id "SS.1413"; transcript_id "SS.1413.1"; cov "1688.493671"; FPKM "82.574938"; TPM "176.573849"; +CM143128.1 StringTie exon 990802 990984 1000 + . gene_id "SS.1413"; transcript_id "SS.1413.1"; exon_number "1"; cov "576.546448"; +CM143128.1 StringTie exon 991335 992889 1000 + . gene_id "SS.1413"; transcript_id "SS.1413.1"; exon_number "2"; cov "1819.353027"; +CM143128.1 StringTie transcript 995666 997952 1000 - . gene_id "SS.1414"; transcript_id "SS.1414.1"; cov "711.541497"; FPKM "34.797581"; TPM "74.409293"; +CM143128.1 StringTie exon 995666 997479 1000 - . gene_id "SS.1414"; transcript_id "SS.1414.1"; exon_number "1"; cov "785.719971"; +CM143128.1 StringTie exon 997562 997952 1000 - . gene_id "SS.1414"; transcript_id "SS.1414.1"; exon_number "2"; cov "367.398987"; +CM143128.1 StringTie transcript 1006224 1007938 1000 . . gene_id "SS.1415"; transcript_id "SS.1415.1"; cov "13012.915452"; FPKM "636.390116"; TPM "1360.822730"; +CM143128.1 StringTie exon 1006224 1007938 1000 . . gene_id "SS.1415"; transcript_id "SS.1415.1"; exon_number "1"; cov "13012.915039"; +CM143128.1 StringTie transcript 1008241 1011490 1000 . . gene_id "SS.1416"; transcript_id "SS.1416.1"; cov "547.745846"; FPKM "26.787236"; TPM "57.280400"; +CM143128.1 StringTie exon 1008241 1011490 1000 . . gene_id "SS.1416"; transcript_id "SS.1416.1"; exon_number "1"; cov "547.745850"; +CM143128.1 StringTie transcript 1011765 1017478 1000 . . gene_id "SS.1417"; transcript_id "SS.1417.1"; cov "276.162058"; FPKM "13.505567"; TPM "28.879586"; +CM143128.1 StringTie exon 1011765 1017478 1000 . . gene_id "SS.1417"; transcript_id "SS.1417.1"; exon_number "1"; cov "276.162048"; +CM143128.1 StringTie transcript 1022397 1024270 1000 . . gene_id "SS.1418"; transcript_id "SS.1418.1"; cov "1463.299360"; FPKM "71.561923"; TPM "153.024204"; +CM143128.1 StringTie exon 1022397 1024270 1000 . . gene_id "SS.1418"; transcript_id "SS.1418.1"; exon_number "1"; cov "1463.299316"; +CM143128.1 StringTie transcript 1028023 1028502 1000 . . gene_id "SS.1419"; transcript_id "SS.1419.1"; cov "2869.087500"; FPKM "140.311288"; TPM "300.034185"; +CM143128.1 StringTie exon 1028023 1028502 1000 . . gene_id "SS.1419"; transcript_id "SS.1419.1"; exon_number "1"; cov "2869.087402"; +CM143128.1 StringTie transcript 1028912 1047622 1000 . . gene_id "SS.1420"; transcript_id "SS.1420.1"; cov "285.612554"; FPKM "13.967739"; TPM "29.867869"; +CM143128.1 StringTie exon 1028912 1047622 1000 . . gene_id "SS.1420"; transcript_id "SS.1420.1"; exon_number "1"; cov "285.612549"; +CM143128.1 StringTie transcript 1048098 1052866 1000 - . gene_id "SS.1421"; transcript_id "SS.1421.1"; cov "363.805043"; FPKM "17.791704"; TPM "38.044831"; +CM143128.1 StringTie exon 1048098 1052625 1000 - . gene_id "SS.1421"; transcript_id "SS.1421.1"; exon_number "1"; cov "371.140869"; +CM143128.1 StringTie exon 1052763 1052866 1000 - . gene_id "SS.1421"; transcript_id "SS.1421.1"; exon_number "2"; cov "44.414280"; +CM143128.1 StringTie transcript 1052184 1052866 1000 - . gene_id "SS.1421"; transcript_id "SS.1421.2"; cov "5.574023"; FPKM "0.272595"; TPM "0.582902"; +CM143128.1 StringTie exon 1052184 1052487 1000 - . gene_id "SS.1421"; transcript_id "SS.1421.2"; exon_number "1"; cov "7.251633"; +CM143128.1 StringTie exon 1052581 1052625 1000 - . gene_id "SS.1421"; transcript_id "SS.1421.2"; exon_number "2"; cov "3.213797"; +CM143128.1 StringTie exon 1052763 1052866 1000 - . gene_id "SS.1421"; transcript_id "SS.1421.2"; exon_number "3"; cov "1.691491"; +CM143128.1 StringTie transcript 1053175 1059121 1000 - . gene_id "SS.1422"; transcript_id "SS.1422.1"; cov "555.694776"; FPKM "27.175975"; TPM "58.111657"; +CM143128.1 StringTie exon 1053175 1058898 1000 - . gene_id "SS.1422"; transcript_id "SS.1422.1"; exon_number "1"; cov "563.538452"; +CM143128.1 StringTie exon 1058988 1059121 1000 - . gene_id "SS.1422"; transcript_id "SS.1422.1"; exon_number "2"; cov "220.641785"; +CM143128.1 StringTie transcript 1065587 1067338 1000 . . gene_id "SS.1423"; transcript_id "SS.1423.1"; cov "725.308219"; FPKM "35.470835"; TPM "75.848945"; +CM143128.1 StringTie exon 1065587 1067338 1000 . . gene_id "SS.1423"; transcript_id "SS.1423.1"; exon_number "1"; cov "725.308228"; +CM143128.1 StringTie transcript 1067929 1070908 1000 . . gene_id "SS.1424"; transcript_id "SS.1424.1"; cov "562.976510"; FPKM "27.532084"; TPM "58.873143"; +CM143128.1 StringTie exon 1067929 1070908 1000 . . gene_id "SS.1424"; transcript_id "SS.1424.1"; exon_number "1"; cov "562.976501"; +CM143128.1 StringTie transcript 1071769 1073473 1000 . . gene_id "SS.1425"; transcript_id "SS.1425.1"; cov "4384.430499"; FPKM "214.418379"; TPM "458.500841"; +CM143128.1 StringTie exon 1071769 1073473 1000 . . gene_id "SS.1425"; transcript_id "SS.1425.1"; exon_number "1"; cov "4384.430664"; +CM143128.1 StringTie transcript 1073701 1077653 1000 + . gene_id "SS.1426"; transcript_id "SS.1426.1"; cov "1814.541699"; FPKM "88.739253"; TPM "189.755293"; +CM143128.1 StringTie exon 1073701 1074735 1000 + . gene_id "SS.1426"; transcript_id "SS.1426.1"; exon_number "1"; cov "776.691772"; +CM143128.1 StringTie exon 1074816 1077653 1000 + . gene_id "SS.1426"; transcript_id "SS.1426.1"; exon_number "2"; cov "2193.038818"; +CM143128.1 StringTie transcript 1081517 1083478 1000 . . gene_id "SS.1427"; transcript_id "SS.1427.1"; cov "11.402650"; FPKM "0.557641"; TPM "1.192430"; +CM143128.1 StringTie exon 1081517 1083478 1000 . . gene_id "SS.1427"; transcript_id "SS.1427.1"; exon_number "1"; cov "11.402651"; +CM143128.1 StringTie transcript 1084268 1084954 1000 . . gene_id "SS.1428"; transcript_id "SS.1428.1"; cov "140.519651"; FPKM "6.872043"; TPM "14.694811"; +CM143128.1 StringTie exon 1084268 1084954 1000 . . gene_id "SS.1428"; transcript_id "SS.1428.1"; exon_number "1"; cov "140.519653"; +CM143128.1 StringTie transcript 1085717 1086069 1000 . . gene_id "SS.1429"; transcript_id "SS.1429.1"; cov "10.067989"; FPKM "0.492370"; TPM "1.052858"; +CM143128.1 StringTie exon 1085717 1086069 1000 . . gene_id "SS.1429"; transcript_id "SS.1429.1"; exon_number "1"; cov "10.067988"; +CM143128.1 StringTie transcript 1086313 1087409 1000 . . gene_id "SS.1430"; transcript_id "SS.1430.1"; cov "10.984503"; FPKM "0.537192"; TPM "1.148702"; +CM143128.1 StringTie exon 1086313 1087409 1000 . . gene_id "SS.1430"; transcript_id "SS.1430.1"; exon_number "1"; cov "10.984503"; +CM143128.1 StringTie transcript 1078028 1081099 1000 . . gene_id "SS.1431"; transcript_id "SS.1431.1"; cov "1928.756836"; FPKM "94.324888"; TPM "201.699316"; +CM143128.1 StringTie exon 1078028 1081099 1000 . . gene_id "SS.1431"; transcript_id "SS.1431.1"; exon_number "1"; cov "1928.756836"; +CM143128.1 StringTie transcript 1091350 1093139 1000 . . gene_id "SS.1432"; transcript_id "SS.1432.1"; cov "5056.355307"; FPKM "247.278525"; TPM "528.767228"; +CM143128.1 StringTie exon 1091350 1093139 1000 . . gene_id "SS.1432"; transcript_id "SS.1432.1"; exon_number "1"; cov "5056.355469"; +CM143128.1 StringTie transcript 1097481 1098149 1000 . . gene_id "SS.1433"; transcript_id "SS.1433.1"; cov "23.841555"; FPKM "1.165959"; TPM "2.493225"; +CM143128.1 StringTie exon 1097481 1098149 1000 . . gene_id "SS.1433"; transcript_id "SS.1433.1"; exon_number "1"; cov "23.841555"; +CM143128.1 StringTie transcript 1100658 1100976 1000 . . gene_id "SS.1434"; transcript_id "SS.1434.1"; cov "20156.987461"; FPKM "985.767381"; TPM "2107.912466"; +CM143128.1 StringTie exon 1100658 1100976 1000 . . gene_id "SS.1434"; transcript_id "SS.1434.1"; exon_number "1"; cov "20156.988281"; +CM143128.1 StringTie transcript 1108802 1112211 1000 . . gene_id "SS.1435"; transcript_id "SS.1435.1"; cov "150.454545"; FPKM "7.357904"; TPM "15.733750"; +CM143128.1 StringTie exon 1108802 1112211 1000 . . gene_id "SS.1435"; transcript_id "SS.1435.1"; exon_number "1"; cov "150.454544"; +CM143128.1 StringTie transcript 1112573 1120031 1000 . . gene_id "SS.1436"; transcript_id "SS.1436.1"; cov "110.942083"; FPKM "5.425567"; TPM "11.601744"; +CM143128.1 StringTie exon 1112573 1120031 1000 . . gene_id "SS.1436"; transcript_id "SS.1436.1"; exon_number "1"; cov "110.942085"; +CM143128.1 StringTie transcript 1120250 1122163 1000 . . gene_id "SS.1437"; transcript_id "SS.1437.1"; cov "616.738767"; FPKM "30.161301"; TPM "64.495319"; +CM143128.1 StringTie exon 1120250 1122163 1000 . . gene_id "SS.1437"; transcript_id "SS.1437.1"; exon_number "1"; cov "616.738770"; +CM143128.1 StringTie transcript 1122415 1124033 1000 . . gene_id "SS.1438"; transcript_id "SS.1438.1"; cov "695.845584"; FPKM "34.029980"; TPM "72.767897"; +CM143128.1 StringTie exon 1122415 1124033 1000 . . gene_id "SS.1438"; transcript_id "SS.1438.1"; exon_number "1"; cov "695.845581"; +CM143128.1 StringTie transcript 1124306 1127248 1000 . . gene_id "SS.1439"; transcript_id "SS.1439.1"; cov "2303.319062"; FPKM "112.642666"; TPM "240.869077"; +CM143128.1 StringTie exon 1124306 1127248 1000 . . gene_id "SS.1439"; transcript_id "SS.1439.1"; exon_number "1"; cov "2303.319092"; +CM143128.1 StringTie transcript 1127744 1128785 1000 . . gene_id "SS.1440"; transcript_id "SS.1440.1"; cov "88.643954"; FPKM "4.335088"; TPM "9.269922"; +CM143128.1 StringTie exon 1127744 1128785 1000 . . gene_id "SS.1440"; transcript_id "SS.1440.1"; exon_number "1"; cov "88.643951"; +CM143128.1 StringTie transcript 1129068 1131107 1000 . . gene_id "SS.1441"; transcript_id "SS.1441.1"; cov "525.510784"; FPKM "25.699842"; TPM "54.955173"; +CM143128.1 StringTie exon 1129068 1131107 1000 . . gene_id "SS.1441"; transcript_id "SS.1441.1"; exon_number "1"; cov "525.510803"; +CM143128.1 StringTie transcript 1131788 1134323 1000 . . gene_id "SS.1442"; transcript_id "SS.1442.1"; cov "504.157334"; FPKM "24.655562"; TPM "52.722141"; +CM143128.1 StringTie exon 1131788 1134323 1000 . . gene_id "SS.1442"; transcript_id "SS.1442.1"; exon_number "1"; cov "504.157349"; +CM143128.1 StringTie transcript 1134620 1139346 1000 . . gene_id "SS.1443"; transcript_id "SS.1443.1"; cov "241.828644"; FPKM "11.826509"; TPM "25.289176"; +CM143128.1 StringTie exon 1134620 1139346 1000 . . gene_id "SS.1443"; transcript_id "SS.1443.1"; exon_number "1"; cov "241.828644"; +CM143128.1 StringTie transcript 1140652 1147139 1000 . . gene_id "SS.1444"; transcript_id "SS.1444.1"; cov "757.876541"; FPKM "37.063573"; TPM "79.254770"; +CM143128.1 StringTie exon 1140652 1147139 1000 . . gene_id "SS.1444"; transcript_id "SS.1444.1"; exon_number "1"; cov "757.876526"; +CM143128.1 StringTie transcript 1157068 1157840 1000 + . gene_id "SS.1445"; transcript_id "SS.1445.1"; cov "1260.678886"; FPKM "61.652870"; TPM "131.835213"; +CM143128.1 StringTie exon 1157068 1157172 1000 + . gene_id "SS.1445"; transcript_id "SS.1445.1"; exon_number "1"; cov "353.428558"; +CM143128.1 StringTie exon 1157264 1157840 1000 + . gene_id "SS.1445"; transcript_id "SS.1445.1"; exon_number "2"; cov "1425.776489"; +CM143128.1 StringTie transcript 1158957 1163084 1000 . . gene_id "SS.1446"; transcript_id "SS.1446.1"; cov "482.582607"; FPKM "23.600461"; TPM "50.465968"; +CM143128.1 StringTie exon 1158957 1163084 1000 . . gene_id "SS.1446"; transcript_id "SS.1446.1"; exon_number "1"; cov "482.582611"; +CM143128.1 StringTie transcript 1163956 1169427 1000 . . gene_id "SS.1447"; transcript_id "SS.1447.1"; cov "3839.324561"; FPKM "187.760246"; TPM "401.496509"; +CM143128.1 StringTie exon 1163956 1169427 1000 . . gene_id "SS.1447"; transcript_id "SS.1447.1"; exon_number "1"; cov "3839.324463"; +CM143128.1 StringTie transcript 1169815 1176187 1000 . . gene_id "SS.1448"; transcript_id "SS.1448.1"; cov "173.824886"; FPKM "8.500819"; TPM "18.177699"; +CM143128.1 StringTie exon 1169815 1176187 1000 . . gene_id "SS.1448"; transcript_id "SS.1448.1"; exon_number "1"; cov "173.824890"; +CM143128.1 StringTie transcript 1177231 1177889 1000 . . gene_id "SS.1449"; transcript_id "SS.1449.1"; cov "53069.268589"; FPKM "2595.326014"; TPM "5549.706921"; +CM143128.1 StringTie exon 1177231 1177889 1000 . . gene_id "SS.1449"; transcript_id "SS.1449.1"; exon_number "1"; cov "53069.269531"; +CM143128.1 StringTie transcript 1178317 1188666 1000 . . gene_id "SS.1450"; transcript_id "SS.1450.1"; cov "864.971884"; FPKM "42.301017"; TPM "90.454242"; +CM143128.1 StringTie exon 1178317 1188666 1000 . . gene_id "SS.1450"; transcript_id "SS.1450.1"; exon_number "1"; cov "864.971863"; +CM143128.1 StringTie transcript 1187242 1188666 1000 . . gene_id "SS.1450"; transcript_id "SS.1450.2"; cov "1842.452281"; FPKM "90.104206"; TPM "192.674036"; +CM143128.1 StringTie exon 1187242 1188666 1000 . . gene_id "SS.1450"; transcript_id "SS.1450.2"; exon_number "1"; cov "1842.452271"; +CM143128.1 StringTie transcript 1189405 1192845 1000 . . gene_id "SS.1451"; transcript_id "SS.1451.1"; cov "100.445510"; FPKM "4.912237"; TPM "10.504067"; +CM143128.1 StringTie exon 1189405 1192845 1000 . . gene_id "SS.1451"; transcript_id "SS.1451.1"; exon_number "1"; cov "100.445511"; +CM143128.1 StringTie transcript 1193095 1198222 1000 . . gene_id "SS.1452"; transcript_id "SS.1452.1"; cov "641.646061"; FPKM "31.379379"; TPM "67.099994"; +CM143128.1 StringTie exon 1193095 1198222 1000 . . gene_id "SS.1452"; transcript_id "SS.1452.1"; exon_number "1"; cov "641.646057"; +CM143128.1 StringTie transcript 1198975 1201107 1000 . . gene_id "SS.1453"; transcript_id "SS.1453.1"; cov "1709.119081"; FPKM "83.583613"; TPM "178.730747"; +CM143128.1 StringTie exon 1198975 1201107 1000 . . gene_id "SS.1453"; transcript_id "SS.1453.1"; exon_number "1"; cov "1709.119141"; +CM143128.1 StringTie transcript 1202681 1205549 1000 . . gene_id "SS.1454"; transcript_id "SS.1454.1"; cov "3398.428024"; FPKM "166.198421"; TPM "355.389852"; +CM143128.1 StringTie exon 1202681 1205549 1000 . . gene_id "SS.1454"; transcript_id "SS.1454.1"; exon_number "1"; cov "3398.427979"; +CM143128.1 StringTie transcript 1206793 1208190 1000 . . gene_id "SS.1455"; transcript_id "SS.1455.1"; cov "5791.610873"; FPKM "283.235830"; TPM "605.656415"; +CM143128.1 StringTie exon 1206793 1208190 1000 . . gene_id "SS.1455"; transcript_id "SS.1455.1"; exon_number "1"; cov "5791.610840"; +CM143128.1 StringTie transcript 1208493 1211388 1000 . . gene_id "SS.1456"; transcript_id "SS.1456.1"; cov "746.283840"; FPKM "36.496638"; TPM "78.042466"; +CM143128.1 StringTie exon 1208493 1211388 1000 . . gene_id "SS.1456"; transcript_id "SS.1456.1"; exon_number "1"; cov "746.283813"; +CM143128.1 StringTie transcript 1211767 1215345 1000 . . gene_id "SS.1457"; transcript_id "SS.1457.1"; cov "551.643755"; FPKM "26.977862"; TPM "57.688023"; +CM143128.1 StringTie exon 1211767 1215345 1000 . . gene_id "SS.1457"; transcript_id "SS.1457.1"; exon_number "1"; cov "551.643738"; +CM143128.1 StringTie transcript 1217720 1219657 1000 . . gene_id "SS.1458"; transcript_id "SS.1458.1"; cov "2170.473684"; FPKM "106.145929"; TPM "226.976801"; +CM143128.1 StringTie exon 1217720 1219657 1000 . . gene_id "SS.1458"; transcript_id "SS.1458.1"; exon_number "1"; cov "2170.473633"; +CM143128.1 StringTie transcript 1223418 1224904 1000 . . gene_id "SS.1459"; transcript_id "SS.1459.1"; cov "1382.936785"; FPKM "67.631831"; TPM "144.620306"; +CM143128.1 StringTie exon 1223418 1224904 1000 . . gene_id "SS.1459"; transcript_id "SS.1459.1"; exon_number "1"; cov "1382.936768"; +CM143128.1 StringTie transcript 1225112 1228224 1000 . . gene_id "SS.1460"; transcript_id "SS.1460.1"; cov "605.759396"; FPKM "29.624360"; TPM "63.347154"; +CM143128.1 StringTie exon 1225112 1228224 1000 . . gene_id "SS.1460"; transcript_id "SS.1460.1"; exon_number "1"; cov "605.759399"; +CM143128.1 StringTie transcript 1229434 1230049 1000 . . gene_id "SS.1461"; transcript_id "SS.1461.1"; cov "108776.519481"; FPKM "5319.661232"; TPM "11375.280252"; +CM143128.1 StringTie exon 1229434 1230049 1000 . . gene_id "SS.1461"; transcript_id "SS.1461.1"; exon_number "1"; cov "108776.515625"; +CM143128.1 StringTie transcript 1230739 1232176 1000 - . gene_id "SS.1462"; transcript_id "SS.1462.1"; cov "544.340176"; FPKM "26.620684"; TPM "56.924252"; +CM143128.1 StringTie exon 1230739 1231207 1000 - . gene_id "SS.1462"; transcript_id "SS.1462.1"; exon_number "1"; cov "1470.430664"; +CM143128.1 StringTie exon 1231282 1232176 1000 - . gene_id "SS.1462"; transcript_id "SS.1462.1"; exon_number "2"; cov "59.048046"; +CM143128.1 StringTie transcript 1233631 1236563 1000 . . gene_id "SS.1463"; transcript_id "SS.1463.1"; cov "171.008524"; FPKM "8.363086"; TPM "17.883178"; +CM143128.1 StringTie exon 1233631 1236563 1000 . . gene_id "SS.1463"; transcript_id "SS.1463.1"; exon_number "1"; cov "171.008530"; +CM143128.1 StringTie transcript 1236798 1239838 1000 . . gene_id "SS.1464"; transcript_id "SS.1464.1"; cov "160.192042"; FPKM "7.834112"; TPM "16.752047"; +CM143128.1 StringTie exon 1236798 1239838 1000 . . gene_id "SS.1464"; transcript_id "SS.1464.1"; exon_number "1"; cov "160.192047"; +CM143128.1 StringTie transcript 1240108 1242277 1000 . . gene_id "SS.1465"; transcript_id "SS.1465.1"; cov "742.041935"; FPKM "36.289189"; TPM "77.598870"; +CM143128.1 StringTie exon 1240108 1242277 1000 . . gene_id "SS.1465"; transcript_id "SS.1465.1"; exon_number "1"; cov "742.041931"; +CM143128.1 StringTie transcript 1244028 1248784 1000 . . gene_id "SS.1466"; transcript_id "SS.1466.1"; cov "1418.419382"; FPKM "69.367090"; TPM "148.330890"; +CM143128.1 StringTie exon 1244028 1248784 1000 . . gene_id "SS.1466"; transcript_id "SS.1466.1"; exon_number "1"; cov "1418.419434"; +CM143128.1 StringTie transcript 1253163 1259367 1000 . . gene_id "SS.1467"; transcript_id "SS.1467.1"; cov "2569.789525"; FPKM "125.674270"; TPM "268.735166"; +CM143128.1 StringTie exon 1253163 1259367 1000 . . gene_id "SS.1467"; transcript_id "SS.1467.1"; exon_number "1"; cov "2569.789551"; +CM143128.1 StringTie transcript 1267443 1269198 1000 . . gene_id "SS.1468"; transcript_id "SS.1468.1"; cov "1094.302392"; FPKM "53.516311"; TPM "114.436428"; +CM143128.1 StringTie exon 1267443 1269198 1000 . . gene_id "SS.1468"; transcript_id "SS.1468.1"; exon_number "1"; cov "1094.302368"; +CM143128.1 StringTie transcript 1269517 1270830 1000 . . gene_id "SS.1469"; transcript_id "SS.1469.1"; cov "77.746575"; FPKM "3.802157"; TPM "8.130331"; +CM143128.1 StringTie exon 1269517 1270830 1000 . . gene_id "SS.1469"; transcript_id "SS.1469.1"; exon_number "1"; cov "77.746574"; +CM143128.1 StringTie transcript 1271313 1280004 1000 . . gene_id "SS.1470"; transcript_id "SS.1470.1"; cov "157.513921"; FPKM "7.703139"; TPM "16.471983"; +CM143128.1 StringTie exon 1271313 1280004 1000 . . gene_id "SS.1470"; transcript_id "SS.1470.1"; exon_number "1"; cov "157.513916"; +CM143128.1 StringTie transcript 1280284 1281433 1000 . . gene_id "SS.1471"; transcript_id "SS.1471.1"; cov "327.547826"; FPKM "16.018562"; TPM "34.253241"; +CM143128.1 StringTie exon 1280284 1281433 1000 . . gene_id "SS.1471"; transcript_id "SS.1471.1"; exon_number "1"; cov "327.547821"; +CM143128.1 StringTie transcript 1281669 1285470 1000 . . gene_id "SS.1472"; transcript_id "SS.1472.1"; cov "296.792478"; FPKM "14.514488"; TPM "31.037007"; +CM143128.1 StringTie exon 1281669 1285470 1000 . . gene_id "SS.1472"; transcript_id "SS.1472.1"; exon_number "1"; cov "296.792480"; +CM143128.1 StringTie transcript 1299542 1299759 1000 . . gene_id "SS.1473"; transcript_id "SS.1473.1"; cov "8.449541"; FPKM "0.413221"; TPM "0.883609"; +CM143128.1 StringTie exon 1299542 1299759 1000 . . gene_id "SS.1473"; transcript_id "SS.1473.1"; exon_number "1"; cov "8.449541"; +CM143128.1 StringTie transcript 1285839 1286596 1000 . . gene_id "SS.1474"; transcript_id "SS.1474.1"; cov "481.060686"; FPKM "23.526032"; TPM "50.306814"; +CM143128.1 StringTie exon 1285839 1286596 1000 . . gene_id "SS.1474"; transcript_id "SS.1474.1"; exon_number "1"; cov "481.060699"; +CM143128.1 StringTie transcript 1296391 1298791 1000 . . gene_id "SS.1475"; transcript_id "SS.1475.1"; cov "7256.643898"; FPKM "354.882537"; TPM "758.861916"; +CM143128.1 StringTie exon 1296391 1298791 1000 . . gene_id "SS.1475"; transcript_id "SS.1475.1"; exon_number "1"; cov "7256.644043"; +CM143128.1 StringTie transcript 1299049 1299262 1000 . . gene_id "SS.1476"; transcript_id "SS.1476.1"; cov "8.000000"; FPKM "0.391236"; TPM "0.836598"; +CM143128.1 StringTie exon 1299049 1299262 1000 . . gene_id "SS.1476"; transcript_id "SS.1476.1"; exon_number "1"; cov "8.000000"; +CM143128.1 StringTie transcript 1300544 1303500 1000 . . gene_id "SS.1477"; transcript_id "SS.1477.1"; cov "1692.882651"; FPKM "82.789579"; TPM "177.032825"; +CM143128.1 StringTie exon 1300544 1303500 1000 . . gene_id "SS.1477"; transcript_id "SS.1477.1"; exon_number "1"; cov "1692.882690"; +CM143128.1 StringTie transcript 1308057 1311126 1000 + . gene_id "SS.1478"; transcript_id "SS.1478.1"; cov "871.700603"; FPKM "42.630082"; TPM "91.157896"; +CM143128.1 StringTie exon 1308057 1308245 1000 + . gene_id "SS.1478"; transcript_id "SS.1478.1"; exon_number "1"; cov "957.412720"; +CM143128.1 StringTie exon 1308330 1311126 1000 + . gene_id "SS.1478"; transcript_id "SS.1478.1"; exon_number "2"; cov "865.908813"; +CM143128.1 StringTie transcript 1315931 1317588 1000 . . gene_id "SS.1479"; transcript_id "SS.1479.1"; cov "2384.040410"; FPKM "116.590303"; TPM "249.310494"; +CM143128.1 StringTie exon 1315931 1317588 1000 . . gene_id "SS.1479"; transcript_id "SS.1479.1"; exon_number "1"; cov "2384.040527"; +CM143128.1 StringTie transcript 1317855 1329893 1000 . . gene_id "SS.1480"; transcript_id "SS.1480.1"; cov "406.628790"; FPKM "19.885977"; TPM "42.523115"; +CM143128.1 StringTie exon 1317855 1329893 1000 . . gene_id "SS.1480"; transcript_id "SS.1480.1"; exon_number "1"; cov "406.628784"; +CM143128.1 StringTie transcript 1330676 1331483 1000 - . gene_id "SS.1481"; transcript_id "SS.1481.1"; cov "54.095331"; FPKM "2.645505"; TPM "5.657007"; +CM143128.1 StringTie exon 1330676 1331483 1000 - . gene_id "SS.1481"; transcript_id "SS.1481.1"; exon_number "1"; cov "54.095329"; +CM143128.1 StringTie transcript 1330712 1331483 1000 - . gene_id "SS.1481"; transcript_id "SS.1481.2"; cov "14.148584"; FPKM "0.691929"; TPM "1.479585"; +CM143128.1 StringTie exon 1330712 1330781 1000 - . gene_id "SS.1481"; transcript_id "SS.1481.2"; exon_number "1"; cov "1.817176"; +CM143128.1 StringTie exon 1331216 1331483 1000 - . gene_id "SS.1481"; transcript_id "SS.1481.2"; exon_number "2"; cov "17.369474"; +CM143128.1 StringTie transcript 1331981 1332855 1000 - . gene_id "SS.1482"; transcript_id "SS.1482.1"; cov "2786.176043"; FPKM "136.256545"; TPM "291.363738"; +CM143128.1 StringTie exon 1331981 1332675 1000 - . gene_id "SS.1482"; transcript_id "SS.1482.1"; exon_number "1"; cov "3126.581543"; +CM143128.1 StringTie exon 1332760 1332855 1000 - . gene_id "SS.1482"; transcript_id "SS.1482.1"; exon_number "2"; cov "321.781250"; +CM143128.1 StringTie transcript 1332944 1338240 1000 + . gene_id "SS.1483"; transcript_id "SS.1483.1"; cov "19.748606"; FPKM "0.965796"; TPM "2.065206"; +CM143128.1 StringTie exon 1332944 1337055 1000 + . gene_id "SS.1483"; transcript_id "SS.1483.1"; exon_number "1"; cov "9.579820"; +CM143128.1 StringTie exon 1337122 1337885 1000 + . gene_id "SS.1483"; transcript_id "SS.1483.1"; exon_number "2"; cov "29.692022"; +CM143128.1 StringTie exon 1337965 1338240 1000 + . gene_id "SS.1483"; transcript_id "SS.1483.1"; exon_number "3"; cov "143.724258"; +CM143128.1 StringTie transcript 1333109 1338240 1000 + . gene_id "SS.1483"; transcript_id "SS.1483.2"; cov "917.752514"; FPKM "44.882227"; TPM "95.973764"; +CM143128.1 StringTie exon 1333109 1337885 1000 + . gene_id "SS.1483"; transcript_id "SS.1483.2"; exon_number "1"; cov "905.607910"; +CM143128.1 StringTie exon 1338008 1338240 1000 + . gene_id "SS.1483"; transcript_id "SS.1483.2"; exon_number "2"; cov "1166.742920"; +CM143128.1 StringTie transcript 1338487 1340647 1000 . . gene_id "SS.1484"; transcript_id "SS.1484.1"; cov "156.696437"; FPKM "7.663161"; TPM "16.386495"; +CM143128.1 StringTie exon 1338487 1340647 1000 . . gene_id "SS.1484"; transcript_id "SS.1484.1"; exon_number "1"; cov "156.696442"; +CM143128.1 StringTie transcript 1340877 1347978 1000 . . gene_id "SS.1485"; transcript_id "SS.1485.1"; cov "209.479583"; FPKM "10.244494"; TPM "21.906281"; +CM143128.1 StringTie exon 1340877 1347978 1000 . . gene_id "SS.1485"; transcript_id "SS.1485.1"; exon_number "1"; cov "209.479584"; +CM143128.1 StringTie transcript 1364579 1368645 1000 . . gene_id "SS.1486"; transcript_id "SS.1486.1"; cov "1431.837472"; FPKM "70.023295"; TPM "149.734084"; +CM143128.1 StringTie exon 1364579 1368645 1000 . . gene_id "SS.1486"; transcript_id "SS.1486.1"; exon_number "1"; cov "1431.837524"; +CM143128.1 StringTie transcript 1369317 1371259 1000 . . gene_id "SS.1487"; transcript_id "SS.1487.1"; cov "570.972208"; FPKM "27.923110"; TPM "59.709291"; +CM143128.1 StringTie exon 1369317 1371259 1000 . . gene_id "SS.1487"; transcript_id "SS.1487.1"; exon_number "1"; cov "570.972229"; +CM143128.1 StringTie transcript 1376736 1377944 1000 . . gene_id "SS.1488"; transcript_id "SS.1488.1"; cov "2772.770058"; FPKM "135.600932"; TPM "289.961810"; +CM143128.1 StringTie exon 1376736 1377944 1000 . . gene_id "SS.1488"; transcript_id "SS.1488.1"; exon_number "1"; cov "2772.770020"; +CM143128.1 StringTie transcript 1379101 1380955 1000 + . gene_id "SS.1489"; transcript_id "SS.1489.1"; cov "642.193530"; FPKM "31.406153"; TPM "67.157245"; +CM143128.1 StringTie exon 1379101 1379385 1000 + . gene_id "SS.1489"; transcript_id "SS.1489.1"; exon_number "1"; cov "1408.196533"; +CM143128.1 StringTie exon 1379479 1380955 1000 + . gene_id "SS.1489"; transcript_id "SS.1489.1"; exon_number "2"; cov "494.386597"; +CM143128.1 StringTie transcript 1389779 1393486 1000 . . gene_id "SS.1490"; transcript_id "SS.1490.1"; cov "175.560410"; FPKM "8.585694"; TPM "18.359191"; +CM143128.1 StringTie exon 1389779 1393486 1000 . . gene_id "SS.1490"; transcript_id "SS.1490.1"; exon_number "1"; cov "175.560410"; +CM143128.1 StringTie transcript 1393753 1394800 1000 . . gene_id "SS.1491"; transcript_id "SS.1491.1"; cov "158.589933"; FPKM "7.755761"; TPM "16.584507"; +CM143128.1 StringTie exon 1393753 1394800 1000 . . gene_id "SS.1491"; transcript_id "SS.1491.1"; exon_number "1"; cov "158.589935"; +CM143128.1 StringTie transcript 1395740 1403621 1000 . . gene_id "SS.1492"; transcript_id "SS.1492.1"; cov "610.261609"; FPKM "29.844538"; TPM "63.817972"; +CM143128.1 StringTie exon 1395740 1403621 1000 . . gene_id "SS.1492"; transcript_id "SS.1492.1"; exon_number "1"; cov "610.261597"; +CM143128.1 StringTie transcript 1403865 1406749 1000 . . gene_id "SS.1493"; transcript_id "SS.1493.1"; cov "2631.633969"; FPKM "128.698742"; TPM "275.202535"; +CM143128.1 StringTie exon 1403865 1406749 1000 . . gene_id "SS.1493"; transcript_id "SS.1493.1"; exon_number "1"; cov "2631.634033"; +CM143128.1 StringTie transcript 1422835 1429341 1000 - . gene_id "SS.1494"; transcript_id "SS.1494.1"; cov "690.177028"; FPKM "33.752762"; TPM "72.175109"; +CM143128.1 StringTie exon 1422835 1426697 1000 - . gene_id "SS.1494"; transcript_id "SS.1494.1"; exon_number "1"; cov "759.100708"; +CM143128.1 StringTie exon 1426771 1429341 1000 - . gene_id "SS.1494"; transcript_id "SS.1494.1"; exon_number "2"; cov "586.617249"; +CM143128.1 StringTie transcript 1427115 1429341 1000 . . gene_id "SS.1495"; transcript_id "SS.1495.1"; cov "1221.265379"; FPKM "59.725372"; TPM "127.713554"; +CM143128.1 StringTie exon 1427115 1429341 1000 . . gene_id "SS.1495"; transcript_id "SS.1495.1"; exon_number "1"; cov "1221.265381"; +CM143128.1 StringTie transcript 1435339 1436592 1000 - . gene_id "SS.1496"; transcript_id "SS.1496.1"; cov "20564.862629"; FPKM "1005.714312"; TPM "2150.565921"; +CM143128.1 StringTie exon 1435339 1435871 1000 - . gene_id "SS.1496"; transcript_id "SS.1496.1"; exon_number "1"; cov "25885.703125"; +CM143128.1 StringTie exon 1436449 1436592 1000 - . gene_id "SS.1496"; transcript_id "SS.1496.1"; exon_number "2"; cov "870.361084"; +CM143128.1 StringTie transcript 1438527 1439024 1000 . . gene_id "SS.1497"; transcript_id "SS.1497.1"; cov "66395.550201"; FPKM "3247.041145"; TPM "6943.299847"; +CM143128.1 StringTie exon 1438527 1439024 1000 . . gene_id "SS.1497"; transcript_id "SS.1497.1"; exon_number "1"; cov "66395.546875"; +CM143128.1 StringTie transcript 1443669 1447319 1000 . . gene_id "SS.1498"; transcript_id "SS.1498.1"; cov "454.158861"; FPKM "22.210412"; TPM "47.493562"; +CM143128.1 StringTie exon 1443669 1447319 1000 . . gene_id "SS.1498"; transcript_id "SS.1498.1"; exon_number "1"; cov "454.158875"; +CM143128.1 StringTie transcript 1448550 1449383 1000 . . gene_id "SS.1499"; transcript_id "SS.1499.1"; cov "21632.824940"; FPKM "1057.942474"; TPM "2262.247841"; +CM143128.1 StringTie exon 1448550 1449383 1000 . . gene_id "SS.1499"; transcript_id "SS.1499.1"; exon_number "1"; cov "21632.824219"; +CM143128.1 StringTie transcript 1450009 1450293 1000 . . gene_id "SS.1500"; transcript_id "SS.1500.1"; cov "136.653125"; FPKM "6.682953"; TPM "14.290470"; +CM143128.1 StringTie exon 1450009 1450293 1000 . . gene_id "SS.1500"; transcript_id "SS.1500.1"; exon_number "1"; cov "136.653122"; +CM143128.1 StringTie transcript 1450009 1452218 1000 + . gene_id "SS.1501"; transcript_id "SS.1501.1"; cov "35.840198"; FPKM "1.752747"; TPM "3.747981"; +CM143128.1 StringTie exon 1450009 1450160 1000 + . gene_id "SS.1501"; transcript_id "SS.1501.1"; exon_number "1"; cov "68.288544"; +CM143128.1 StringTie exon 1452047 1452218 1000 + . gene_id "SS.1501"; transcript_id "SS.1501.1"; exon_number "2"; cov "7.164917"; +CM143128.1 StringTie transcript 1451115 1455315 1000 . . gene_id "SS.1502"; transcript_id "SS.1502.1"; cov "219.487176"; FPKM "10.733910"; TPM "22.952822"; +CM143128.1 StringTie exon 1451115 1455315 1000 . . gene_id "SS.1502"; transcript_id "SS.1502.1"; exon_number "1"; cov "219.487183"; +CM143128.1 StringTie transcript 1458023 1460295 1000 . . gene_id "SS.1503"; transcript_id "SS.1503.1"; cov "1051.788825"; FPKM "51.437206"; TPM "109.990582"; +CM143128.1 StringTie exon 1458023 1460295 1000 . . gene_id "SS.1503"; transcript_id "SS.1503.1"; exon_number "1"; cov "1051.788818"; +CM143128.1 StringTie transcript 1461160 1463909 1000 . . gene_id "SS.1504"; transcript_id "SS.1504.1"; cov "108.021455"; FPKM "5.282735"; TPM "11.296320"; +CM143128.1 StringTie exon 1461160 1463909 1000 . . gene_id "SS.1504"; transcript_id "SS.1504.1"; exon_number "1"; cov "108.021454"; +CM143128.1 StringTie transcript 1464143 1476779 1000 . . gene_id "SS.1505"; transcript_id "SS.1505.1"; cov "1171.418295"; FPKM "57.287625"; TPM "122.500807"; +CM143128.1 StringTie exon 1464143 1476779 1000 . . gene_id "SS.1505"; transcript_id "SS.1505.1"; exon_number "1"; cov "1171.418335"; +CM143128.1 StringTie transcript 1474205 1476779 1000 + . gene_id "SS.1506"; transcript_id "SS.1506.1"; cov "153.310564"; FPKM "7.497576"; TPM "16.032418"; +CM143128.1 StringTie exon 1474205 1474316 1000 + . gene_id "SS.1506"; transcript_id "SS.1506.1"; exon_number "1"; cov "222.906250"; +CM143128.1 StringTie exon 1474390 1476779 1000 + . gene_id "SS.1506"; transcript_id "SS.1506.1"; exon_number "2"; cov "150.049179"; +CM143128.1 StringTie transcript 1486013 1488177 1000 - . gene_id "SS.1507"; transcript_id "SS.1507.1"; cov "1969.970966"; FPKM "96.340444"; TPM "206.009274"; +CM143128.1 StringTie exon 1486013 1487870 1000 - . gene_id "SS.1507"; transcript_id "SS.1507.1"; exon_number "1"; cov "1981.234131"; +CM143128.1 StringTie exon 1487935 1488177 1000 - . gene_id "SS.1507"; transcript_id "SS.1507.1"; exon_number "2"; cov "1883.851807"; +CM143128.1 StringTie transcript 1490032 1491892 1000 . . gene_id "SS.1508"; transcript_id "SS.1508.1"; cov "1335.876948"; FPKM "65.330393"; TPM "139.699034"; +CM143128.1 StringTie exon 1490032 1491892 1000 . . gene_id "SS.1508"; transcript_id "SS.1508.1"; exon_number "1"; cov "1335.876953"; +CM143128.1 StringTie transcript 1492485 1499656 1000 . . gene_id "SS.1509"; transcript_id "SS.1509.1"; cov "255.179727"; FPKM "12.479437"; TPM "26.685363"; +CM143128.1 StringTie exon 1492485 1499656 1000 . . gene_id "SS.1509"; transcript_id "SS.1509.1"; exon_number "1"; cov "255.179733"; +CM143128.1 StringTie transcript 1500070 1504819 1000 . . gene_id "SS.1510"; transcript_id "SS.1510.1"; cov "478.255789"; FPKM "23.388860"; TPM "50.013492"; +CM143128.1 StringTie exon 1500070 1504819 1000 . . gene_id "SS.1510"; transcript_id "SS.1510.1"; exon_number "1"; cov "478.255798"; +CM143128.1 StringTie transcript 1505021 1510869 1000 . . gene_id "SS.1511"; transcript_id "SS.1511.1"; cov "418.070610"; FPKM "20.445534"; TPM "43.719641"; +CM143128.1 StringTie exon 1505021 1510869 1000 . . gene_id "SS.1511"; transcript_id "SS.1511.1"; exon_number "1"; cov "418.070618"; +CM143128.1 StringTie transcript 1511489 1515431 1000 . . gene_id "SS.1512"; transcript_id "SS.1512.1"; cov "384.834390"; FPKM "18.820133"; TPM "40.243970"; +CM143128.1 StringTie exon 1511489 1515431 1000 . . gene_id "SS.1512"; transcript_id "SS.1512.1"; exon_number "1"; cov "384.834381"; +CM143128.1 StringTie transcript 1515893 1520913 1000 . . gene_id "SS.1513"; transcript_id "SS.1513.1"; cov "316.835690"; FPKM "15.494691"; TPM "33.133022"; +CM143128.1 StringTie exon 1515893 1520913 1000 . . gene_id "SS.1513"; transcript_id "SS.1513.1"; exon_number "1"; cov "316.835693"; +CM143128.1 StringTie transcript 1522210 1530268 1000 . . gene_id "SS.1514"; transcript_id "SS.1514.1"; cov "456.434545"; FPKM "22.321703"; TPM "47.731541"; +CM143128.1 StringTie exon 1522210 1530268 1000 . . gene_id "SS.1514"; transcript_id "SS.1514.1"; exon_number "1"; cov "456.434540"; +CM143128.1 StringTie transcript 1530721 1532277 1000 . . gene_id "SS.1515"; transcript_id "SS.1515.1"; cov "1080.707771"; FPKM "52.851473"; TPM "113.014774"; +CM143128.1 StringTie exon 1530721 1532277 1000 . . gene_id "SS.1515"; transcript_id "SS.1515.1"; exon_number "1"; cov "1080.707764"; +CM143128.1 StringTie transcript 1533241 1536192 1000 . . gene_id "SS.1516"; transcript_id "SS.1516.1"; cov "597.454946"; FPKM "29.218235"; TPM "62.478718"; +CM143128.1 StringTie exon 1533241 1536192 1000 . . gene_id "SS.1516"; transcript_id "SS.1516.1"; exon_number "1"; cov "597.454956"; +CM143128.1 StringTie transcript 1536500 1540701 1000 . . gene_id "SS.1517"; transcript_id "SS.1517.1"; cov "773.932889"; FPKM "37.848801"; TPM "80.933859"; +CM143128.1 StringTie exon 1536500 1540701 1000 . . gene_id "SS.1517"; transcript_id "SS.1517.1"; exon_number "1"; cov "773.932861"; +CM143128.1 StringTie transcript 1540984 1546288 1000 . . gene_id "SS.1518"; transcript_id "SS.1518.1"; cov "681.036946"; FPKM "33.305771"; TPM "71.219287"; +CM143128.1 StringTie exon 1540984 1546288 1000 . . gene_id "SS.1518"; transcript_id "SS.1518.1"; exon_number "1"; cov "681.036926"; +CM143128.1 StringTie transcript 1546829 1548178 1000 . . gene_id "SS.1519"; transcript_id "SS.1519.1"; cov "521.288148"; FPKM "25.493336"; TPM "54.513592"; +CM143128.1 StringTie exon 1546829 1548178 1000 . . gene_id "SS.1519"; transcript_id "SS.1519.1"; exon_number "1"; cov "521.288147"; +CM143128.1 StringTie transcript 1549649 1550450 1000 . . gene_id "SS.1520"; transcript_id "SS.1520.1"; cov "458.072319"; FPKM "22.401797"; TPM "47.902811"; +CM143128.1 StringTie exon 1549649 1550450 1000 . . gene_id "SS.1520"; transcript_id "SS.1520.1"; exon_number "1"; cov "458.072327"; +CM143128.1 StringTie transcript 1551226 1553059 1000 . . gene_id "SS.1521"; transcript_id "SS.1521.1"; cov "521.997819"; FPKM "25.528042"; TPM "54.587805"; +CM143128.1 StringTie exon 1551226 1553059 1000 . . gene_id "SS.1521"; transcript_id "SS.1521.1"; exon_number "1"; cov "521.997803"; +CM143128.1 StringTie transcript 1553323 1556401 1000 . . gene_id "SS.1522"; transcript_id "SS.1522.1"; cov "547.119844"; FPKM "26.756622"; TPM "57.214936"; +CM143128.1 StringTie exon 1553323 1556401 1000 . . gene_id "SS.1522"; transcript_id "SS.1522.1"; exon_number "1"; cov "547.119873"; +CM143128.1 StringTie transcript 1556605 1557724 1000 - . gene_id "SS.1523"; transcript_id "SS.1523.1"; cov "294.788032"; FPKM "14.416461"; TPM "30.827393"; +CM143128.1 StringTie exon 1556605 1557490 1000 - . gene_id "SS.1523"; transcript_id "SS.1523.1"; exon_number "1"; cov "315.837463"; +CM143128.1 StringTie exon 1557625 1557724 1000 - . gene_id "SS.1523"; transcript_id "SS.1523.1"; exon_number "2"; cov "108.290001"; +CM143128.1 StringTie transcript 1557976 1558687 1000 . . gene_id "SS.1524"; transcript_id "SS.1524.1"; cov "1702.636938"; FPKM "83.266607"; TPM "178.052878"; +CM143128.1 StringTie exon 1557976 1558687 1000 . . gene_id "SS.1524"; transcript_id "SS.1524.1"; exon_number "1"; cov "1702.636963"; +CM143128.1 StringTie transcript 1559162 1559706 1000 . . gene_id "SS.1525"; transcript_id "SS.1525.1"; cov "2871.935780"; FPKM "140.450582"; TPM "300.332043"; +CM143128.1 StringTie exon 1559162 1559706 1000 . . gene_id "SS.1525"; transcript_id "SS.1525.1"; exon_number "1"; cov "2871.935791"; +CM143128.1 StringTie transcript 1561707 1563090 1000 . . gene_id "SS.1526"; transcript_id "SS.1526.1"; cov "528.334538"; FPKM "25.837936"; TPM "55.250466"; +CM143128.1 StringTie exon 1561707 1563090 1000 . . gene_id "SS.1526"; transcript_id "SS.1526.1"; exon_number "1"; cov "528.334534"; +CM143128.1 StringTie transcript 1565451 1575541 1000 . . gene_id "SS.1527"; transcript_id "SS.1527.1"; cov "219.947082"; FPKM "10.756402"; TPM "23.000917"; +CM143128.1 StringTie exon 1565451 1575541 1000 . . gene_id "SS.1527"; transcript_id "SS.1527.1"; exon_number "1"; cov "219.947083"; +CM143128.1 StringTie transcript 1575852 1576598 1000 . . gene_id "SS.1528"; transcript_id "SS.1528.1"; cov "1702.290495"; FPKM "83.249664"; TPM "178.016649"; +CM143128.1 StringTie exon 1575852 1576598 1000 . . gene_id "SS.1528"; transcript_id "SS.1528.1"; exon_number "1"; cov "1702.290527"; +CM143128.1 StringTie transcript 1576854 1584193 1000 . . gene_id "SS.1529"; transcript_id "SS.1529.1"; cov "421.704360"; FPKM "20.623241"; TPM "44.099639"; +CM143128.1 StringTie exon 1576854 1584193 1000 . . gene_id "SS.1529"; transcript_id "SS.1529.1"; exon_number "1"; cov "421.704346"; +CM143128.1 StringTie transcript 1584937 1590226 1000 . . gene_id "SS.1530"; transcript_id "SS.1530.1"; cov "287.541966"; FPKM "14.062096"; TPM "30.069637"; +CM143128.1 StringTie exon 1584937 1590226 1000 . . gene_id "SS.1530"; transcript_id "SS.1530.1"; exon_number "1"; cov "287.541962"; +CM143128.1 StringTie transcript 1590687 1592240 1000 . . gene_id "SS.1531"; transcript_id "SS.1531.1"; cov "5596.723938"; FPKM "273.704982"; TPM "585.276157"; +CM143128.1 StringTie exon 1590687 1592240 1000 . . gene_id "SS.1531"; transcript_id "SS.1531.1"; exon_number "1"; cov "5596.724121"; +CM143128.1 StringTie transcript 1592731 1593299 1000 . . gene_id "SS.1532"; transcript_id "SS.1532.1"; cov "2129.080844"; FPKM "104.121633"; TPM "222.648154"; +CM143128.1 StringTie exon 1592731 1593299 1000 . . gene_id "SS.1532"; transcript_id "SS.1532.1"; exon_number "1"; cov "2129.080811"; +CM143128.1 StringTie transcript 1593585 1594723 1000 . . gene_id "SS.1533"; transcript_id "SS.1533.1"; cov "1706.904302"; FPKM "83.475300"; TPM "178.499136"; +CM143128.1 StringTie exon 1593585 1594723 1000 . . gene_id "SS.1533"; transcript_id "SS.1533.1"; exon_number "1"; cov "1706.904297"; +CM143128.1 StringTie transcript 1596130 1596835 1000 . . gene_id "SS.1534"; transcript_id "SS.1534.1"; cov "1939.841360"; FPKM "94.866971"; TPM "202.858477"; +CM143128.1 StringTie exon 1596130 1596835 1000 . . gene_id "SS.1534"; transcript_id "SS.1534.1"; exon_number "1"; cov "1939.841309"; +CM143128.1 StringTie transcript 1604965 1610392 1000 . . gene_id "SS.1535"; transcript_id "SS.1535.1"; cov "822.520450"; FPKM "40.224951"; TPM "86.014893"; +CM143128.1 StringTie exon 1604965 1610392 1000 . . gene_id "SS.1535"; transcript_id "SS.1535.1"; exon_number "1"; cov "822.520447"; +CM143128.1 StringTie transcript 1624131 1625806 1000 . . gene_id "SS.1536"; transcript_id "SS.1536.1"; cov "1170.613365"; FPKM "57.248261"; TPM "122.416631"; +CM143128.1 StringTie exon 1624131 1625806 1000 . . gene_id "SS.1536"; transcript_id "SS.1536.1"; exon_number "1"; cov "1170.613403"; +CM143128.1 StringTie transcript 1626202 1628098 1000 . . gene_id "SS.1537"; transcript_id "SS.1537.1"; cov "566.709541"; FPKM "27.714646"; TPM "59.263524"; +CM143128.1 StringTie exon 1626202 1628098 1000 . . gene_id "SS.1537"; transcript_id "SS.1537.1"; exon_number "1"; cov "566.709534"; +CM143128.1 StringTie transcript 1628310 1631934 1000 . . gene_id "SS.1538"; transcript_id "SS.1538.1"; cov "191.999845"; FPKM "9.389656"; TPM "20.078341"; +CM143128.1 StringTie exon 1628310 1631934 1000 . . gene_id "SS.1538"; transcript_id "SS.1538.1"; exon_number "1"; cov "191.999847"; +CM143128.1 StringTie transcript 1628310 1631934 1000 + . gene_id "SS.1539"; transcript_id "SS.1539.1"; cov "89.752692"; FPKM "4.389310"; TPM "9.385868"; +CM143128.1 StringTie exon 1628310 1630598 1000 + . gene_id "SS.1539"; transcript_id "SS.1539.1"; exon_number "1"; cov "72.281044"; +CM143128.1 StringTie exon 1630672 1631934 1000 + . gene_id "SS.1539"; transcript_id "SS.1539.1"; exon_number "2"; cov "121.417458"; +CM143128.1 StringTie transcript 1632389 1635809 1000 . . gene_id "SS.1540"; transcript_id "SS.1540.1"; cov "1469.340836"; FPKM "71.857378"; TPM "153.655990"; +CM143128.1 StringTie exon 1632389 1635809 1000 . . gene_id "SS.1540"; transcript_id "SS.1540.1"; exon_number "1"; cov "1469.340820"; +CM143128.1 StringTie transcript 1636010 1639784 1000 . . gene_id "SS.1541"; transcript_id "SS.1541.1"; cov "115.909934"; FPKM "5.668517"; TPM "12.121255"; +CM143128.1 StringTie exon 1636010 1639784 1000 . . gene_id "SS.1541"; transcript_id "SS.1541.1"; exon_number "1"; cov "115.909935"; +CM143128.1 StringTie transcript 1640100 1641672 1000 . . gene_id "SS.1542"; transcript_id "SS.1542.1"; cov "1089.363636"; FPKM "53.274783"; TPM "113.919959"; +CM143128.1 StringTie exon 1640100 1641672 1000 . . gene_id "SS.1542"; transcript_id "SS.1542.1"; exon_number "1"; cov "1089.363647"; +CM143128.1 StringTie transcript 1642507 1643509 1000 . . gene_id "SS.1543"; transcript_id "SS.1543.1"; cov "708.013958"; FPKM "34.625068"; TPM "74.040402"; +CM143128.1 StringTie exon 1642507 1643509 1000 . . gene_id "SS.1543"; transcript_id "SS.1543.1"; exon_number "1"; cov "708.013977"; +CM143128.1 StringTie transcript 1643798 1645220 1000 . . gene_id "SS.1544"; transcript_id "SS.1544.1"; cov "275.022488"; FPKM "13.449837"; TPM "28.760415"; +CM143128.1 StringTie exon 1643798 1645220 1000 . . gene_id "SS.1544"; transcript_id "SS.1544.1"; exon_number "1"; cov "275.022491"; +CM143128.1 StringTie transcript 1648657 1658878 1000 . . gene_id "SS.1545"; transcript_id "SS.1545.1"; cov "297.956931"; FPKM "14.571435"; TPM "31.158780"; +CM143128.1 StringTie exon 1648657 1658878 1000 . . gene_id "SS.1545"; transcript_id "SS.1545.1"; exon_number "1"; cov "297.956940"; +CM143128.1 StringTie transcript 1648657 1658878 1000 + . gene_id "SS.1546"; transcript_id "SS.1546.1"; cov "86.156090"; FPKM "4.213420"; TPM "9.009754"; +CM143128.1 StringTie exon 1648657 1653449 1000 + . gene_id "SS.1546"; transcript_id "SS.1546.1"; exon_number "1"; cov "123.645424"; +CM143128.1 StringTie exon 1653522 1658878 1000 + . gene_id "SS.1546"; transcript_id "SS.1546.1"; exon_number "2"; cov "52.613743"; +CM143128.1 StringTie transcript 1662938 1665139 1000 . . gene_id "SS.1547"; transcript_id "SS.1547.1"; cov "507.056767"; FPKM "24.797357"; TPM "53.025348"; +CM143128.1 StringTie exon 1662938 1665139 1000 . . gene_id "SS.1547"; transcript_id "SS.1547.1"; exon_number "1"; cov "507.056763"; +CM143128.1 StringTie transcript 1665974 1667492 1000 . . gene_id "SS.1548"; transcript_id "SS.1548.1"; cov "378.634628"; FPKM "18.516937"; TPM "39.595632"; +CM143128.1 StringTie exon 1665974 1667492 1000 . . gene_id "SS.1548"; transcript_id "SS.1548.1"; exon_number "1"; cov "378.634613"; +CM143128.1 StringTie transcript 1667702 1676891 1000 . . gene_id "SS.1549"; transcript_id "SS.1549.1"; cov "609.886398"; FPKM "29.826189"; TPM "63.778734"; +CM143128.1 StringTie exon 1667702 1676891 1000 . . gene_id "SS.1549"; transcript_id "SS.1549.1"; exon_number "1"; cov "609.886414"; +CM143128.1 StringTie transcript 1677137 1679776 1000 . . gene_id "SS.1550"; transcript_id "SS.1550.1"; cov "269.635606"; FPKM "13.186394"; TPM "28.197083"; +CM143128.1 StringTie exon 1677137 1679776 1000 . . gene_id "SS.1550"; transcript_id "SS.1550.1"; exon_number "1"; cov "269.635620"; +CM143128.1 StringTie transcript 1684345 1686012 1000 . . gene_id "SS.1551"; transcript_id "SS.1551.1"; cov "775.463429"; FPKM "37.923651"; TPM "81.093915"; +CM143128.1 StringTie exon 1684345 1686012 1000 . . gene_id "SS.1551"; transcript_id "SS.1551.1"; exon_number "1"; cov "775.463440"; +CM143128.1 StringTie transcript 1686220 1688922 1000 . . gene_id "SS.1552"; transcript_id "SS.1552.1"; cov "310.083241"; FPKM "15.164466"; TPM "32.426886"; +CM143128.1 StringTie exon 1686220 1688922 1000 . . gene_id "SS.1552"; transcript_id "SS.1552.1"; exon_number "1"; cov "310.083252"; +CM143128.1 StringTie transcript 1691819 1693391 1000 + . gene_id "SS.1553"; transcript_id "SS.1553.1"; cov "7198.604633"; FPKM "352.044156"; TPM "752.792473"; +CM143128.1 StringTie exon 1691819 1691870 1000 + . gene_id "SS.1553"; transcript_id "SS.1553.1"; exon_number "1"; cov "1062.000000"; +CM143128.1 StringTie exon 1692192 1693391 1000 + . gene_id "SS.1553"; transcript_id "SS.1553.1"; exon_number "2"; cov "7464.523926"; +CM143128.1 StringTie transcript 1697187 1698274 1000 - . gene_id "SS.1554"; transcript_id "SS.1554.1"; cov "4200.506116"; FPKM "205.423649"; TPM "439.266990"; +CM143128.1 StringTie exon 1697187 1697445 1000 - . gene_id "SS.1554"; transcript_id "SS.1554.1"; exon_number "1"; cov "3504.783691"; +CM143128.1 StringTie exon 1697663 1697936 1000 - . gene_id "SS.1554"; transcript_id "SS.1554.1"; exon_number "2"; cov "6508.324707"; +CM143128.1 StringTie exon 1698024 1698034 1000 - . gene_id "SS.1554"; transcript_id "SS.1554.1"; exon_number "3"; cov "1549.909058"; +CM143128.1 StringTie exon 1698165 1698274 1000 - . gene_id "SS.1554"; transcript_id "SS.1554.1"; exon_number "4"; cov "355.109100"; +CM143128.1 StringTie transcript 1698538 1702217 1000 . . gene_id "SS.1555"; transcript_id "SS.1555.1"; cov "292.015489"; FPKM "14.280871"; TPM "30.537455"; +CM143128.1 StringTie exon 1698538 1702217 1000 . . gene_id "SS.1555"; transcript_id "SS.1555.1"; exon_number "1"; cov "292.015503"; +CM143128.1 StringTie transcript 1702566 1717010 1000 - . gene_id "SS.1556"; transcript_id "SS.1556.1"; cov "170.970667"; FPKM "8.361235"; TPM "17.879219"; +CM143128.1 StringTie exon 1702566 1709352 1000 - . gene_id "SS.1556"; transcript_id "SS.1556.1"; exon_number "1"; cov "221.835144"; +CM143128.1 StringTie exon 1709731 1717010 1000 - . gene_id "SS.1556"; transcript_id "SS.1556.1"; exon_number "2"; cov "123.550720"; +CM143128.1 StringTie transcript 1702616 1713694 1000 - . gene_id "SS.1556"; transcript_id "SS.1556.2"; cov "401.885704"; FPKM "19.654019"; TPM "42.027108"; +CM143128.1 StringTie exon 1702616 1709352 1000 - . gene_id "SS.1556"; transcript_id "SS.1556.2"; exon_number "1"; cov "456.601776"; +CM143128.1 StringTie exon 1709501 1713694 1000 - . gene_id "SS.1556"; transcript_id "SS.1556.2"; exon_number "2"; cov "313.992950"; +CM143128.1 StringTie transcript 1717061 1719005 1000 . . gene_id "SS.1557"; transcript_id "SS.1557.1"; cov "498.668380"; FPKM "24.387127"; TPM "52.148135"; +CM143128.1 StringTie exon 1717061 1719005 1000 . . gene_id "SS.1557"; transcript_id "SS.1557.1"; exon_number "1"; cov "498.668365"; +CM143128.1 StringTie transcript 1719265 1721588 1000 + . gene_id "SS.1558"; transcript_id "SS.1558.1"; cov "534.631144"; FPKM "26.145868"; TPM "55.908933"; +CM143128.1 StringTie exon 1719265 1719395 1000 + . gene_id "SS.1558"; transcript_id "SS.1558.1"; exon_number "1"; cov "203.916031"; +CM143128.1 StringTie exon 1719482 1721588 1000 + . gene_id "SS.1558"; transcript_id "SS.1558.1"; exon_number "2"; cov "555.192932"; +CM143128.1 StringTie transcript 1719486 1721588 1000 . . gene_id "SS.1559"; transcript_id "SS.1559.1"; cov "785.513314"; FPKM "38.415135"; TPM "82.144880"; +CM143128.1 StringTie exon 1719486 1721588 1000 . . gene_id "SS.1559"; transcript_id "SS.1559.1"; exon_number "1"; cov "785.513306"; +CM143128.1 StringTie transcript 1721906 1728349 1000 . . gene_id "SS.1560"; transcript_id "SS.1560.1"; cov "325.593110"; FPKM "15.922968"; TPM "34.048827"; +CM143128.1 StringTie exon 1721906 1728349 1000 . . gene_id "SS.1560"; transcript_id "SS.1560.1"; exon_number "1"; cov "325.593109"; +CM143128.1 StringTie transcript 1728696 1738500 1000 . . gene_id "SS.1561"; transcript_id "SS.1561.1"; cov "560.005303"; FPKM "27.386779"; TPM "58.562430"; +CM143128.1 StringTie exon 1728696 1738500 1000 . . gene_id "SS.1561"; transcript_id "SS.1561.1"; exon_number "1"; cov "560.005310"; +CM143128.1 StringTie transcript 1739524 1740306 1000 - . gene_id "SS.1562"; transcript_id "SS.1562.1"; cov "1242.897695"; FPKM "60.783290"; TPM "129.975749"; +CM143128.1 StringTie exon 1739524 1740122 1000 - . gene_id "SS.1562"; transcript_id "SS.1562.1"; exon_number "1"; cov "1353.767944"; +CM143128.1 StringTie exon 1740212 1740306 1000 - . gene_id "SS.1562"; transcript_id "SS.1562.1"; exon_number "2"; cov "543.831604"; +CM143128.1 StringTie transcript 1742388 1745900 1000 + . gene_id "SS.1563"; transcript_id "SS.1563.1"; cov "353.517522"; FPKM "17.288597"; TPM "36.969016"; +CM143128.1 StringTie exon 1742388 1743668 1000 + . gene_id "SS.1563"; transcript_id "SS.1563.1"; exon_number "1"; cov "182.619049"; +CM143128.1 StringTie exon 1743747 1745900 1000 + . gene_id "SS.1563"; transcript_id "SS.1563.1"; exon_number "2"; cov "455.152130"; +CM143128.1 StringTie transcript 1743780 1745900 1000 . . gene_id "SS.1564"; transcript_id "SS.1564.1"; cov "608.506070"; FPKM "29.758685"; TPM "63.634386"; +CM143128.1 StringTie exon 1743780 1745900 1000 . . gene_id "SS.1564"; transcript_id "SS.1564.1"; exon_number "1"; cov "608.506042"; +CM143128.1 StringTie transcript 1746286 1747523 1000 . . gene_id "SS.1565"; transcript_id "SS.1565.1"; cov "3707.763328"; FPKM "181.326309"; TPM "387.738523"; +CM143128.1 StringTie exon 1746286 1747523 1000 . . gene_id "SS.1565"; transcript_id "SS.1565.1"; exon_number "1"; cov "3707.763428"; +CM143128.1 StringTie transcript 1748694 1749519 1000 . . gene_id "SS.1566"; transcript_id "SS.1566.1"; cov "8.819613"; FPKM "0.431319"; TPM "0.922309"; +CM143128.1 StringTie exon 1748694 1749519 1000 . . gene_id "SS.1566"; transcript_id "SS.1566.1"; exon_number "1"; cov "8.819613"; +CM143128.1 StringTie transcript 1750721 1751720 1000 . . gene_id "SS.1567"; transcript_id "SS.1567.1"; cov "799.644000"; FPKM "39.106190"; TPM "83.622593"; +CM143128.1 StringTie exon 1750721 1751720 1000 . . gene_id "SS.1567"; transcript_id "SS.1567.1"; exon_number "1"; cov "799.643982"; +CM143128.1 StringTie transcript 1753765 1754552 1000 . . gene_id "SS.1568"; transcript_id "SS.1568.1"; cov "9375.431472"; FPKM "458.500783"; TPM "980.433654"; +CM143128.1 StringTie exon 1753765 1754552 1000 . . gene_id "SS.1568"; transcript_id "SS.1568.1"; exon_number "1"; cov "9375.431641"; +CM143128.1 StringTie transcript 1754947 1756260 1000 . . gene_id "SS.1569"; transcript_id "SS.1569.1"; cov "2951.163623"; FPKM "144.325180"; TPM "308.617277"; +CM143128.1 StringTie exon 1754947 1756260 1000 . . gene_id "SS.1569"; transcript_id "SS.1569.1"; exon_number "1"; cov "2951.163574"; +CM143128.1 StringTie transcript 1758284 1760698 1000 . . gene_id "SS.1570"; transcript_id "SS.1570.1"; cov "1598.583437"; FPKM "78.177923"; TPM "167.171506"; +CM143128.1 StringTie exon 1758284 1760698 1000 . . gene_id "SS.1570"; transcript_id "SS.1570.1"; exon_number "1"; cov "1598.583496"; +CM143128.1 StringTie transcript 1761165 1764713 1000 . . gene_id "SS.1571"; transcript_id "SS.1571.1"; cov "768.732883"; FPKM "37.594497"; TPM "80.390070"; +CM143128.1 StringTie exon 1761165 1764713 1000 . . gene_id "SS.1571"; transcript_id "SS.1571.1"; exon_number "1"; cov "768.732910"; +CM143128.1 StringTie transcript 1764920 1766309 1000 . . gene_id "SS.1572"; transcript_id "SS.1572.1"; cov "316.061151"; FPKM "15.456812"; TPM "33.052024"; +CM143128.1 StringTie exon 1764920 1766309 1000 . . gene_id "SS.1572"; transcript_id "SS.1572.1"; exon_number "1"; cov "316.061157"; +CM143128.1 StringTie transcript 1766666 1773710 1000 + . gene_id "SS.1573"; transcript_id "SS.1573.1"; cov "325.106068"; FPKM "15.899150"; TPM "33.997895"; +CM143128.1 StringTie exon 1766666 1773710 1000 + . gene_id "SS.1573"; transcript_id "SS.1573.1"; exon_number "1"; cov "325.106079"; +CM143128.1 StringTie transcript 1766692 1767463 1000 + . gene_id "SS.1573"; transcript_id "SS.1573.2"; cov "1033.478100"; FPKM "50.541729"; TPM "108.075742"; +CM143128.1 StringTie exon 1766692 1766804 1000 + . gene_id "SS.1573"; transcript_id "SS.1573.2"; exon_number "1"; cov "246.472672"; +CM143128.1 StringTie exon 1766948 1767463 1000 + . gene_id "SS.1573"; transcript_id "SS.1573.2"; exon_number "2"; cov "1205.826172"; +CM143128.1 StringTie transcript 1775634 1781140 1000 . . gene_id "SS.1574"; transcript_id "SS.1574.1"; cov "1062.805157"; FPKM "51.975954"; TPM "111.142612"; +CM143128.1 StringTie exon 1775634 1781140 1000 . . gene_id "SS.1574"; transcript_id "SS.1574.1"; exon_number "1"; cov "1062.805176"; +CM143128.1 StringTie transcript 1795613 1796569 1000 . . gene_id "SS.1575"; transcript_id "SS.1575.1"; cov "20.092999"; FPKM "0.982638"; TPM "2.101221"; +CM143128.1 StringTie exon 1795613 1796569 1000 . . gene_id "SS.1575"; transcript_id "SS.1575.1"; exon_number "1"; cov "20.092999"; +CM143128.1 StringTie transcript 1796993 1799888 1000 . . gene_id "SS.1576"; transcript_id "SS.1576.1"; cov "88.681630"; FPKM "4.336931"; TPM "9.273862"; +CM143128.1 StringTie exon 1796993 1799888 1000 . . gene_id "SS.1576"; transcript_id "SS.1576.1"; exon_number "1"; cov "88.681633"; +CM143128.1 StringTie transcript 1781630 1786337 1000 . . gene_id "SS.1577"; transcript_id "SS.1577.1"; cov "389.553314"; FPKM "19.050910"; TPM "40.737451"; +CM143128.1 StringTie exon 1781630 1786337 1000 . . gene_id "SS.1577"; transcript_id "SS.1577.1"; exon_number "1"; cov "389.553314"; +CM143128.1 StringTie transcript 1786614 1790584 1000 . . gene_id "SS.1578"; transcript_id "SS.1578.1"; cov "1323.004281"; FPKM "64.700862"; TPM "138.352877"; +CM143128.1 StringTie exon 1786614 1790584 1000 . . gene_id "SS.1578"; transcript_id "SS.1578.1"; exon_number "1"; cov "1323.004272"; +CM143128.1 StringTie transcript 1795016 1795376 1000 . . gene_id "SS.1579"; transcript_id "SS.1579.1"; cov "12.085873"; FPKM "0.591054"; TPM "1.263877"; +CM143128.1 StringTie exon 1795016 1795376 1000 . . gene_id "SS.1579"; transcript_id "SS.1579.1"; exon_number "1"; cov "12.085873"; +CM143128.1 StringTie transcript 1800435 1803330 1000 . . gene_id "SS.1580"; transcript_id "SS.1580.1"; cov "124.487569"; FPKM "6.088002"; TPM "13.018260"; +CM143128.1 StringTie exon 1800435 1803330 1000 . . gene_id "SS.1580"; transcript_id "SS.1580.1"; exon_number "1"; cov "124.487572"; +CM143128.1 StringTie transcript 1803710 1807251 1000 . . gene_id "SS.1581"; transcript_id "SS.1581.1"; cov "403.247883"; FPKM "19.720636"; TPM "42.169557"; +CM143128.1 StringTie exon 1803710 1807251 1000 . . gene_id "SS.1581"; transcript_id "SS.1581.1"; exon_number "1"; cov "403.247894"; +CM143128.1 StringTie transcript 1807547 1812005 1000 . . gene_id "SS.1582"; transcript_id "SS.1582.1"; cov "244.731554"; FPKM "11.968474"; TPM "25.592748"; +CM143128.1 StringTie exon 1807547 1812005 1000 . . gene_id "SS.1582"; transcript_id "SS.1582.1"; exon_number "1"; cov "244.731552"; +CM143128.1 StringTie transcript 1812386 1813968 1000 . . gene_id "SS.1583"; transcript_id "SS.1583.1"; cov "59.900821"; FPKM "2.929420"; TPM "6.264115"; +CM143128.1 StringTie exon 1812386 1813968 1000 . . gene_id "SS.1583"; transcript_id "SS.1583.1"; exon_number "1"; cov "59.900822"; +CM143128.1 StringTie transcript 1814186 1815751 1000 . . gene_id "SS.1584"; transcript_id "SS.1584.1"; cov "25.130268"; FPKM "1.228983"; TPM "2.627992"; +CM143128.1 StringTie exon 1814186 1815751 1000 . . gene_id "SS.1584"; transcript_id "SS.1584.1"; exon_number "1"; cov "25.130268"; +CM143128.1 StringTie transcript 1816103 1816871 1000 . . gene_id "SS.1585"; transcript_id "SS.1585.1"; cov "162.058518"; FPKM "7.925391"; TPM "16.947233"; +CM143128.1 StringTie exon 1816103 1816871 1000 . . gene_id "SS.1585"; transcript_id "SS.1585.1"; exon_number "1"; cov "162.058517"; +CM143128.1 StringTie transcript 1817176 1818900 1000 . . gene_id "SS.1586"; transcript_id "SS.1586.1"; cov "2991.819710"; FPKM "146.313445"; TPM "312.868879"; +CM143128.1 StringTie exon 1817176 1818900 1000 . . gene_id "SS.1586"; transcript_id "SS.1586.1"; exon_number "1"; cov "2991.819824"; +CM143128.1 StringTie transcript 1819144 1822907 1000 . . gene_id "SS.1587"; transcript_id "SS.1587.1"; cov "1193.356801"; FPKM "58.360517"; TPM "124.795021"; +CM143128.1 StringTie exon 1819144 1822907 1000 . . gene_id "SS.1587"; transcript_id "SS.1587.1"; exon_number "1"; cov "1193.356812"; +CM143128.1 StringTie transcript 1823250 1827710 1000 . . gene_id "SS.1588"; transcript_id "SS.1588.1"; cov "1041.038332"; FPKM "50.911458"; TPM "108.866351"; +CM143128.1 StringTie exon 1823250 1827710 1000 . . gene_id "SS.1588"; transcript_id "SS.1588.1"; exon_number "1"; cov "1041.038330"; +CM143128.1 StringTie transcript 1828147 1828574 1000 . . gene_id "SS.1589"; transcript_id "SS.1589.1"; cov "27.581776"; FPKM "1.348873"; TPM "2.884358"; +CM143128.1 StringTie exon 1828147 1828574 1000 . . gene_id "SS.1589"; transcript_id "SS.1589.1"; exon_number "1"; cov "27.581776"; +CM143128.1 StringTie transcript 1832870 1834983 1000 . . gene_id "SS.1590"; transcript_id "SS.1590.1"; cov "233.955061"; FPKM "11.441455"; TPM "24.465798"; +CM143128.1 StringTie exon 1832870 1834983 1000 . . gene_id "SS.1590"; transcript_id "SS.1590.1"; exon_number "1"; cov "233.955063"; +CM143128.1 StringTie transcript 1835337 1838266 1000 . . gene_id "SS.1591"; transcript_id "SS.1591.1"; cov "1170.425597"; FPKM "57.239078"; TPM "122.396996"; +CM143128.1 StringTie exon 1835337 1838266 1000 . . gene_id "SS.1591"; transcript_id "SS.1591.1"; exon_number "1"; cov "1170.425537"; +CM143128.1 StringTie transcript 1843772 1845100 1000 - . gene_id "SS.1592"; transcript_id "SS.1592.1"; cov "899.266881"; FPKM "43.978197"; TPM "94.040633"; +CM143128.1 StringTie exon 1843772 1844852 1000 - . gene_id "SS.1592"; transcript_id "SS.1592.1"; exon_number "1"; cov "957.172974"; +CM143128.1 StringTie exon 1844938 1845100 1000 - . gene_id "SS.1592"; transcript_id "SS.1592.1"; exon_number "2"; cov "515.239258"; +CM143128.1 StringTie transcript 1845353 1848834 1000 - . gene_id "SS.1593"; transcript_id "SS.1593.1"; cov "542.353526"; FPKM "26.523528"; TPM "56.716499"; +CM143128.1 StringTie exon 1845353 1847149 1000 - . gene_id "SS.1593"; transcript_id "SS.1593.1"; exon_number "1"; cov "576.688354"; +CM143128.1 StringTie exon 1847215 1848834 1000 - . gene_id "SS.1593"; transcript_id "SS.1593.1"; exon_number "2"; cov "504.267273"; +CM143128.1 StringTie transcript 1849125 1852895 1000 . . gene_id "SS.1594"; transcript_id "SS.1594.1"; cov "1533.872448"; FPKM "75.013264"; TPM "160.404369"; +CM143128.1 StringTie exon 1849125 1852895 1000 . . gene_id "SS.1594"; transcript_id "SS.1594.1"; exon_number "1"; cov "1533.872437"; +CM143128.1 StringTie transcript 1853122 1857225 1000 . . gene_id "SS.1595"; transcript_id "SS.1595.1"; cov "279.589912"; FPKM "13.673205"; TPM "29.238053"; +CM143128.1 StringTie exon 1853122 1857225 1000 . . gene_id "SS.1595"; transcript_id "SS.1595.1"; exon_number "1"; cov "279.589905"; +CM143128.1 StringTie transcript 1857792 1860158 1000 . . gene_id "SS.1596"; transcript_id "SS.1596.1"; cov "58.098859"; FPKM "2.841296"; TPM "6.075675"; +CM143128.1 StringTie exon 1857792 1860158 1000 . . gene_id "SS.1596"; transcript_id "SS.1596.1"; exon_number "1"; cov "58.098858"; +CM143128.1 StringTie transcript 1861395 1862107 1000 . . gene_id "SS.1597"; transcript_id "SS.1597.1"; cov "3922.997195"; FPKM "191.852214"; TPM "410.246556"; +CM143128.1 StringTie exon 1861395 1862107 1000 . . gene_id "SS.1597"; transcript_id "SS.1597.1"; exon_number "1"; cov "3922.997314"; +CM143128.1 StringTie transcript 1862346 1866538 1000 . . gene_id "SS.1598"; transcript_id "SS.1598.1"; cov "503.773909"; FPKM "24.636811"; TPM "52.682044"; +CM143128.1 StringTie exon 1862346 1866538 1000 . . gene_id "SS.1598"; transcript_id "SS.1598.1"; exon_number "1"; cov "503.773895"; +CM143128.1 StringTie transcript 1866850 1868079 1000 . . gene_id "SS.1599"; transcript_id "SS.1599.1"; cov "462.370732"; FPKM "22.612009"; TPM "48.352316"; +CM143128.1 StringTie exon 1866850 1868079 1000 . . gene_id "SS.1599"; transcript_id "SS.1599.1"; exon_number "1"; cov "462.370728"; +CM143128.1 StringTie transcript 1869156 1881416 1000 . . gene_id "SS.1600"; transcript_id "SS.1600.1"; cov "259.585026"; FPKM "12.694876"; TPM "27.146046"; +CM143128.1 StringTie exon 1869156 1881416 1000 . . gene_id "SS.1600"; transcript_id "SS.1600.1"; exon_number "1"; cov "259.585022"; +CM143128.1 StringTie transcript 1881688 1882816 1000 + . gene_id "SS.1601"; transcript_id "SS.1601.1"; cov "3145.588894"; FPKM "153.833450"; TPM "328.949257"; +CM143128.1 StringTie exon 1881688 1881739 1000 + . gene_id "SS.1601"; transcript_id "SS.1601.1"; exon_number "1"; cov "472.957825"; +CM143128.1 StringTie exon 1882067 1882096 1000 + . gene_id "SS.1601"; transcript_id "SS.1601.1"; exon_number "2"; cov "2503.899902"; +CM143128.1 StringTie exon 1882354 1882396 1000 + . gene_id "SS.1601"; transcript_id "SS.1601.1"; exon_number "3"; cov "3553.707764"; +CM143128.1 StringTie exon 1882471 1882816 1000 + . gene_id "SS.1601"; transcript_id "SS.1601.1"; exon_number "4"; cov "3552.173828"; +CM143128.1 StringTie transcript 1881688 1882805 1000 + . gene_id "SS.1601"; transcript_id "SS.1601.2"; cov "118.223662"; FPKM "5.781669"; TPM "12.363213"; +CM143128.1 StringTie exon 1881688 1881739 1000 + . gene_id "SS.1601"; transcript_id "SS.1601.2"; exon_number "1"; cov "17.119108"; +CM143128.1 StringTie exon 1882354 1882396 1000 + . gene_id "SS.1601"; transcript_id "SS.1601.2"; exon_number "2"; cov "128.629456"; +CM143128.1 StringTie exon 1882471 1882805 1000 + . gene_id "SS.1601"; transcript_id "SS.1601.2"; exon_number "3"; cov "132.581833"; +CM143128.1 StringTie transcript 1883058 1892005 1000 . . gene_id "SS.1602"; transcript_id "SS.1602.1"; cov "1099.579236"; FPKM "53.774372"; TPM "114.988253"; +CM143128.1 StringTie exon 1883058 1892005 1000 . . gene_id "SS.1602"; transcript_id "SS.1602.1"; exon_number "1"; cov "1099.579224"; +CM143128.1 StringTie transcript 1891282 1891989 1000 + . gene_id "SS.1603"; transcript_id "SS.1603.1"; cov "3704.413606"; FPKM "181.162493"; TPM "387.388226"; +CM143128.1 StringTie exon 1891282 1891431 1000 + . gene_id "SS.1603"; transcript_id "SS.1603.1"; exon_number "1"; cov "786.767090"; +CM143128.1 StringTie exon 1891507 1891989 1000 + . gene_id "SS.1603"; transcript_id "SS.1603.1"; exon_number "2"; cov "4610.515137"; +CM143128.1 StringTie transcript 1895246 1896724 1000 . . gene_id "SS.1604"; transcript_id "SS.1604.1"; cov "703.384719"; FPKM "34.398678"; TPM "73.556300"; +CM143128.1 StringTie exon 1895246 1896724 1000 . . gene_id "SS.1604"; transcript_id "SS.1604.1"; exon_number "1"; cov "703.384705"; +CM143128.1 StringTie transcript 1896927 1898887 1000 . . gene_id "SS.1605"; transcript_id "SS.1605.1"; cov "376.535951"; FPKM "18.414302"; TPM "39.376163"; +CM143128.1 StringTie exon 1896927 1898887 1000 . . gene_id "SS.1605"; transcript_id "SS.1605.1"; exon_number "1"; cov "376.535950"; +CM143128.1 StringTie transcript 1899155 1902395 1000 . . gene_id "SS.1606"; transcript_id "SS.1606.1"; cov "375.680654"; FPKM "18.372474"; TPM "39.286721"; +CM143128.1 StringTie exon 1899155 1902395 1000 . . gene_id "SS.1606"; transcript_id "SS.1606.1"; exon_number "1"; cov "375.680664"; +CM143128.1 StringTie transcript 1902578 1909412 1000 . . gene_id "SS.1607"; transcript_id "SS.1607.1"; cov "349.810388"; FPKM "17.107302"; TPM "36.581343"; +CM143128.1 StringTie exon 1902578 1909412 1000 . . gene_id "SS.1607"; transcript_id "SS.1607.1"; exon_number "1"; cov "349.810394"; +CM143128.1 StringTie transcript 1909776 1910401 1000 . . gene_id "SS.1608"; transcript_id "SS.1608.1"; cov "18.993610"; FPKM "0.928873"; TPM "1.986253"; +CM143128.1 StringTie exon 1909776 1910401 1000 . . gene_id "SS.1608"; transcript_id "SS.1608.1"; exon_number "1"; cov "18.993610"; +CM143128.1 StringTie transcript 1912940 1914887 1000 - . gene_id "SS.1609"; transcript_id "SS.1609.1"; cov "15855.058169"; FPKM "775.383683"; TPM "1658.039170"; +CM143128.1 StringTie exon 1912940 1913532 1000 - . gene_id "SS.1609"; transcript_id "SS.1609.1"; exon_number "1"; cov "15571.941406"; +CM143128.1 StringTie exon 1913852 1914333 1000 - . gene_id "SS.1609"; transcript_id "SS.1609.1"; exon_number "2"; cov "18571.771484"; +CM143128.1 StringTie exon 1914794 1914887 1000 - . gene_id "SS.1609"; transcript_id "SS.1609.1"; exon_number "3"; cov "3710.723389"; +CM143128.1 StringTie transcript 1925845 1926310 1000 . . gene_id "SS.1610"; transcript_id "SS.1610.1"; cov "6.547210"; FPKM "0.320188"; TPM "0.684673"; +CM143128.1 StringTie exon 1925845 1926310 1000 . . gene_id "SS.1610"; transcript_id "SS.1610.1"; exon_number "1"; cov "6.547210"; +CM143128.1 StringTie transcript 1915470 1916480 1000 + . gene_id "SS.1611"; transcript_id "SS.1611.1"; cov "476.618644"; FPKM "23.308796"; TPM "49.842288"; +CM143128.1 StringTie exon 1915470 1915552 1000 + . gene_id "SS.1611"; transcript_id "SS.1611.1"; exon_number "1"; cov "136.698792"; +CM143128.1 StringTie exon 1915620 1916480 1000 + . gene_id "SS.1611"; transcript_id "SS.1611.1"; exon_number "2"; cov "509.386749"; +CM143128.1 StringTie transcript 1921259 1922514 1000 - . gene_id "SS.1612"; transcript_id "SS.1612.1"; cov "2947.767681"; FPKM "144.159103"; TPM "308.262147"; +CM143128.1 StringTie exon 1921259 1922111 1000 - . gene_id "SS.1612"; transcript_id "SS.1612.1"; exon_number "1"; cov "3189.152100"; +CM143128.1 StringTie exon 1922269 1922288 1000 - . gene_id "SS.1612"; transcript_id "SS.1612.1"; exon_number "2"; cov "2857.848145"; +CM143128.1 StringTie exon 1922366 1922514 1000 - . gene_id "SS.1612"; transcript_id "SS.1612.1"; exon_number "3"; cov "1577.952026"; +CM143128.1 StringTie transcript 1921292 1922514 1000 - . gene_id "SS.1612"; transcript_id "SS.1612.2"; cov "392.678702"; FPKM "19.203755"; TPM "41.064288"; +CM143128.1 StringTie exon 1921292 1922288 1000 - . gene_id "SS.1612"; transcript_id "SS.1612.2"; exon_number "1"; cov "418.228851"; +CM143128.1 StringTie exon 1922366 1922514 1000 - . gene_id "SS.1612"; transcript_id "SS.1612.2"; exon_number "2"; cov "221.715683"; +CM143128.1 StringTie transcript 1923143 1925253 1000 . . gene_id "SS.1613"; transcript_id "SS.1613.1"; cov "356.328280"; FPKM "17.426056"; TPM "37.262950"; +CM143128.1 StringTie exon 1923143 1925253 1000 . . gene_id "SS.1613"; transcript_id "SS.1613.1"; exon_number "1"; cov "356.328278"; +CM143128.1 StringTie transcript 1929727 1931344 1000 . . gene_id "SS.1614"; transcript_id "SS.1614.1"; cov "375.660692"; FPKM "18.371498"; TPM "39.284633"; +CM143128.1 StringTie exon 1929727 1931344 1000 . . gene_id "SS.1614"; transcript_id "SS.1614.1"; exon_number "1"; cov "375.660706"; +CM143128.1 StringTie transcript 1934177 1935144 1000 . . gene_id "SS.1615"; transcript_id "SS.1615.1"; cov "26045.537190"; FPKM "1273.743958"; TPM "2723.706240"; +CM143128.1 StringTie exon 1934177 1935144 1000 . . gene_id "SS.1615"; transcript_id "SS.1615.1"; exon_number "1"; cov "26045.537109"; +CM143128.1 StringTie transcript 1936086 1945693 1000 . . gene_id "SS.1616"; transcript_id "SS.1616.1"; cov "457.791320"; FPKM "22.388055"; TPM "47.873425"; +CM143128.1 StringTie exon 1936086 1945693 1000 . . gene_id "SS.1616"; transcript_id "SS.1616.1"; exon_number "1"; cov "457.791321"; +CM143128.1 StringTie transcript 1946078 1947901 1000 . . gene_id "SS.1617"; transcript_id "SS.1617.1"; cov "144.567434"; FPKM "7.069998"; TPM "15.118107"; +CM143128.1 StringTie exon 1946078 1947901 1000 . . gene_id "SS.1617"; transcript_id "SS.1617.1"; exon_number "1"; cov "144.567429"; +CM143128.1 StringTie transcript 1948144 1950804 1000 . . gene_id "SS.1618"; transcript_id "SS.1618.1"; cov "513.437430"; FPKM "25.109400"; TPM "53.692605"; +CM143128.1 StringTie exon 1948144 1950804 1000 . . gene_id "SS.1618"; transcript_id "SS.1618.1"; exon_number "1"; cov "513.437439"; +CM143128.1 StringTie transcript 1951237 1953084 1000 . . gene_id "SS.1619"; transcript_id "SS.1619.1"; cov "2565.436147"; FPKM "125.461371"; TPM "268.279913"; +CM143128.1 StringTie exon 1951237 1953084 1000 . . gene_id "SS.1619"; transcript_id "SS.1619.1"; exon_number "1"; cov "2565.436035"; +CM143128.1 StringTie transcript 1955213 1957055 1000 . . gene_id "SS.1620"; transcript_id "SS.1620.1"; cov "954.577320"; FPKM "46.683126"; TPM "99.824710"; +CM143128.1 StringTie exon 1955213 1957055 1000 . . gene_id "SS.1620"; transcript_id "SS.1620.1"; exon_number "1"; cov "954.577332"; +CM143128.1 StringTie transcript 1960139 1961944 1000 . . gene_id "SS.1621"; transcript_id "SS.1621.1"; cov "17107.435216"; FPKM "836.630555"; TPM "1789.006220"; +CM143128.1 StringTie exon 1960139 1961944 1000 . . gene_id "SS.1621"; transcript_id "SS.1621.1"; exon_number "1"; cov "17107.435547"; +CM143128.1 StringTie transcript 1964323 1965530 1000 . . gene_id "SS.1622"; transcript_id "SS.1622.1"; cov "561.718543"; FPKM "27.470564"; TPM "58.741591"; +CM143128.1 StringTie exon 1964323 1965530 1000 . . gene_id "SS.1622"; transcript_id "SS.1622.1"; exon_number "1"; cov "561.718567"; +CM143128.1 StringTie transcript 1965892 1970042 1000 . . gene_id "SS.1623"; transcript_id "SS.1623.1"; cov "500.649000"; FPKM "24.483989"; TPM "52.355257"; +CM143128.1 StringTie exon 1965892 1970042 1000 . . gene_id "SS.1623"; transcript_id "SS.1623.1"; exon_number "1"; cov "500.648987"; +CM143128.1 StringTie transcript 1970318 1974765 1000 . . gene_id "SS.1624"; transcript_id "SS.1624.1"; cov "727.577788"; FPKM "35.581827"; TPM "76.086285"; +CM143128.1 StringTie exon 1970318 1974765 1000 . . gene_id "SS.1624"; transcript_id "SS.1624.1"; exon_number "1"; cov "727.577759"; +CM143128.1 StringTie transcript 1975180 1978042 1000 . . gene_id "SS.1625"; transcript_id "SS.1625.1"; cov "499.388404"; FPKM "24.422340"; TPM "52.223431"; +CM143128.1 StringTie exon 1975180 1978042 1000 . . gene_id "SS.1625"; transcript_id "SS.1625.1"; exon_number "1"; cov "499.388397"; +CM143128.1 StringTie transcript 1978440 1983345 1000 . . gene_id "SS.1626"; transcript_id "SS.1626.1"; cov "644.458622"; FPKM "31.516926"; TPM "67.394117"; +CM143128.1 StringTie exon 1978440 1983345 1000 . . gene_id "SS.1626"; transcript_id "SS.1626.1"; exon_number "1"; cov "644.458618"; +CM143128.1 StringTie transcript 1984056 1987259 1000 . . gene_id "SS.1627"; transcript_id "SS.1627.1"; cov "1605.366417"; FPKM "78.509641"; TPM "167.880835"; +CM143128.1 StringTie exon 1984056 1987259 1000 . . gene_id "SS.1627"; transcript_id "SS.1627.1"; exon_number "1"; cov "1605.366455"; +CM143128.1 StringTie transcript 2000945 2004271 1000 . . gene_id "SS.1628"; transcript_id "SS.1628.1"; cov "10.326420"; FPKM "0.505008"; TPM "1.079883"; +CM143128.1 StringTie exon 2000945 2004271 1000 . . gene_id "SS.1628"; transcript_id "SS.1628.1"; exon_number "1"; cov "10.326420"; +CM143128.1 StringTie transcript 1990824 1995178 1000 - . gene_id "SS.1629"; transcript_id "SS.1629.1"; cov "7850.109983"; FPKM "383.905699"; TPM "820.923500"; +CM143128.1 StringTie exon 1990824 1994224 1000 - . gene_id "SS.1629"; transcript_id "SS.1629.1"; exon_number "1"; cov "8151.704590"; +CM143128.1 StringTie exon 1994489 1994507 1000 - . gene_id "SS.1629"; transcript_id "SS.1629.1"; exon_number "2"; cov "3338.526367"; +CM143128.1 StringTie exon 1995053 1995178 1000 - . gene_id "SS.1629"; transcript_id "SS.1629.1"; exon_number "3"; cov "389.761902"; +CM143128.1 StringTie transcript 1995573 1997103 1000 - . gene_id "SS.1630"; transcript_id "SS.1630.1"; cov "907.235908"; FPKM "44.367918"; TPM "94.873993"; +CM143128.1 StringTie exon 1995573 1996751 1000 - . gene_id "SS.1630"; transcript_id "SS.1630.1"; exon_number "1"; cov "1030.900757"; +CM143128.1 StringTie exon 1996846 1997103 1000 - . gene_id "SS.1630"; transcript_id "SS.1630.1"; exon_number "2"; cov "342.116272"; +CM143128.1 StringTie transcript 1997447 2000582 1000 - . gene_id "SS.1631"; transcript_id "SS.1631.1"; cov "307.843189"; FPKM "15.054917"; TPM "32.192633"; +CM143128.1 StringTie exon 1997447 2000217 1000 - . gene_id "SS.1631"; transcript_id "SS.1631.1"; exon_number "1"; cov "326.518951"; +CM143128.1 StringTie exon 2000293 2000582 1000 - . gene_id "SS.1631"; transcript_id "SS.1631.1"; exon_number "2"; cov "129.393097"; +CM143128.1 StringTie transcript 2006111 2007900 1000 . . gene_id "SS.1632"; transcript_id "SS.1632.1"; cov "1796.910056"; FPKM "87.876987"; TPM "187.911468"; +CM143128.1 StringTie exon 2006111 2007900 1000 . . gene_id "SS.1632"; transcript_id "SS.1632.1"; exon_number "1"; cov "1796.910034"; +CM143128.1 StringTie transcript 2008626 2010165 1000 . . gene_id "SS.1633"; transcript_id "SS.1633.1"; cov "2003.131169"; FPKM "97.962127"; TPM "209.476995"; +CM143128.1 StringTie exon 2008626 2010165 1000 . . gene_id "SS.1633"; transcript_id "SS.1633.1"; exon_number "1"; cov "2003.131226"; +CM143128.1 StringTie transcript 2014587 2015286 1000 + . gene_id "SS.1634"; transcript_id "SS.1634.1"; cov "875.303859"; FPKM "42.806297"; TPM "91.534706"; +CM143128.1 StringTie exon 2014587 2014685 1000 + . gene_id "SS.1634"; transcript_id "SS.1634.1"; exon_number "1"; cov "240.202026"; +CM143128.1 StringTie exon 2014764 2015286 1000 + . gene_id "SS.1634"; transcript_id "SS.1634.1"; exon_number "2"; cov "995.523926"; +CM143128.1 StringTie transcript 2015443 2017798 1000 - . gene_id "SS.1635"; transcript_id "SS.1635.1"; cov "1796.940723"; FPKM "87.878487"; TPM "187.914675"; +CM143128.1 StringTie exon 2015443 2016139 1000 - . gene_id "SS.1635"; transcript_id "SS.1635.1"; exon_number "1"; cov "2123.418945"; +CM143128.1 StringTie exon 2016227 2017798 1000 - . gene_id "SS.1635"; transcript_id "SS.1635.1"; exon_number "2"; cov "1652.185425"; +CM143128.1 StringTie transcript 2018039 2022399 1000 . . gene_id "SS.1636"; transcript_id "SS.1636.1"; cov "989.088168"; FPKM "48.370862"; TPM "103.433674"; +CM143128.1 StringTie exon 2018039 2022399 1000 . . gene_id "SS.1636"; transcript_id "SS.1636.1"; exon_number "1"; cov "989.088196"; +CM143128.1 StringTie transcript 2022735 2023579 1000 + . gene_id "SS.1637"; transcript_id "SS.1637.1"; cov "2872.409774"; FPKM "140.473762"; TPM "300.381611"; +CM143128.1 StringTie exon 2022735 2022776 1000 + . gene_id "SS.1637"; transcript_id "SS.1637.1"; exon_number "1"; cov "339.833344"; +CM143128.1 StringTie exon 2022873 2022953 1000 + . gene_id "SS.1637"; transcript_id "SS.1637.1"; exon_number "2"; cov "2334.753174"; +CM143128.1 StringTie exon 2023171 2023579 1000 + . gene_id "SS.1637"; transcript_id "SS.1637.1"; exon_number "3"; cov "3238.958496"; +CM143128.1 StringTie transcript 2024724 2026085 1000 . . gene_id "SS.1638"; transcript_id "SS.1638.1"; cov "141.168869"; FPKM "6.903793"; TPM "14.762703"; +CM143128.1 StringTie exon 2024724 2026085 1000 . . gene_id "SS.1638"; transcript_id "SS.1638.1"; exon_number "1"; cov "141.168869"; +CM143128.1 StringTie transcript 2035443 2037641 1000 . . gene_id "SS.1639"; transcript_id "SS.1639.1"; cov "7638.855844"; FPKM "373.574421"; TPM "798.831645"; +CM143128.1 StringTie exon 2035443 2037641 1000 . . gene_id "SS.1639"; transcript_id "SS.1639.1"; exon_number "1"; cov "7638.855957"; +CM143128.1 StringTie transcript 2037916 2040312 1000 . . gene_id "SS.1640"; transcript_id "SS.1640.1"; cov "2802.853567"; FPKM "137.072151"; TPM "293.107786"; +CM143128.1 StringTie exon 2037916 2040312 1000 . . gene_id "SS.1640"; transcript_id "SS.1640.1"; exon_number "1"; cov "2802.853516"; +CM143128.1 StringTie transcript 2041764 2042438 1000 . . gene_id "SS.1641"; transcript_id "SS.1641.1"; cov "27907.025185"; FPKM "1364.779096"; TPM "2918.370931"; +CM143128.1 StringTie exon 2041764 2042438 1000 . . gene_id "SS.1641"; transcript_id "SS.1641.1"; exon_number "1"; cov "27907.025391"; +CM143128.1 StringTie transcript 2046396 2047015 1000 . . gene_id "SS.1642"; transcript_id "SS.1642.1"; cov "21.120968"; FPKM "1.032910"; TPM "2.208721"; +CM143128.1 StringTie exon 2046396 2047015 1000 . . gene_id "SS.1642"; transcript_id "SS.1642.1"; exon_number "1"; cov "21.120968"; +CM143128.1 StringTie transcript 2047331 2053880 1000 . . gene_id "SS.1643"; transcript_id "SS.1643.1"; cov "1181.047481"; FPKM "57.758536"; TPM "123.507777"; +CM143128.1 StringTie exon 2047331 2053880 1000 . . gene_id "SS.1643"; transcript_id "SS.1643.1"; exon_number "1"; cov "1181.047485"; +CM143128.1 StringTie transcript 2054194 2056462 1000 . . gene_id "SS.1644"; transcript_id "SS.1644.1"; cov "33.292199"; FPKM "1.628138"; TPM "3.481524"; +CM143128.1 StringTie exon 2054194 2056462 1000 . . gene_id "SS.1644"; transcript_id "SS.1644.1"; exon_number "1"; cov "33.292198"; +CM143128.1 StringTie transcript 2056990 2061524 1000 . . gene_id "SS.1645"; transcript_id "SS.1645.1"; cov "646.516483"; FPKM "31.617565"; TPM "67.609317"; +CM143128.1 StringTie exon 2056990 2061524 1000 . . gene_id "SS.1645"; transcript_id "SS.1645.1"; exon_number "1"; cov "646.516479"; +CM143128.1 StringTie transcript 2056990 2061524 1000 + . gene_id "SS.1646"; transcript_id "SS.1646.1"; cov "68.986203"; FPKM "3.373736"; TPM "7.214217"; +CM143128.1 StringTie exon 2056990 2060820 1000 + . gene_id "SS.1646"; transcript_id "SS.1646.1"; exon_number "1"; cov "61.850769"; +CM143128.1 StringTie exon 2060848 2061524 1000 + . gene_id "SS.1646"; transcript_id "SS.1646.1"; exon_number "2"; cov "109.364120"; +CM143128.1 StringTie transcript 2061747 2062534 1000 . . gene_id "SS.1647"; transcript_id "SS.1647.1"; cov "766.908629"; FPKM "37.505283"; TPM "80.199299"; +CM143128.1 StringTie exon 2061747 2062534 1000 . . gene_id "SS.1647"; transcript_id "SS.1647.1"; exon_number "1"; cov "766.908630"; +CM143128.1 StringTie transcript 2062809 2065686 1000 . . gene_id "SS.1648"; transcript_id "SS.1648.1"; cov "960.633426"; FPKM "46.979297"; TPM "100.458026"; +CM143128.1 StringTie exon 2062809 2065686 1000 . . gene_id "SS.1648"; transcript_id "SS.1648.1"; exon_number "1"; cov "960.633423"; +CM143128.1 StringTie transcript 2066280 2070604 1000 . . gene_id "SS.1649"; transcript_id "SS.1649.1"; cov "1116.882543"; FPKM "54.620582"; TPM "116.797743"; +CM143128.1 StringTie exon 2066280 2070604 1000 . . gene_id "SS.1649"; transcript_id "SS.1649.1"; exon_number "1"; cov "1116.882568"; +CM143128.1 StringTie transcript 2079095 2085770 1000 . . gene_id "SS.1650"; transcript_id "SS.1650.1"; cov "1743.986219"; FPKM "85.288773"; TPM "182.376970"; +CM143128.1 StringTie exon 2079095 2085770 1000 . . gene_id "SS.1650"; transcript_id "SS.1650.1"; exon_number "1"; cov "1743.986206"; +CM143128.1 StringTie transcript 2086440 2088531 1000 . . gene_id "SS.1651"; transcript_id "SS.1651.1"; cov "915.451721"; FPKM "44.769708"; TPM "95.733159"; +CM143128.1 StringTie exon 2086440 2088531 1000 . . gene_id "SS.1651"; transcript_id "SS.1651.1"; exon_number "1"; cov "915.451721"; +CM143128.1 StringTie transcript 2089047 2091457 1000 . . gene_id "SS.1652"; transcript_id "SS.1652.1"; cov "340.863957"; FPKM "16.669781"; TPM "35.645772"; +CM143128.1 StringTie exon 2089047 2091457 1000 . . gene_id "SS.1652"; transcript_id "SS.1652.1"; exon_number "1"; cov "340.863953"; +CM143128.1 StringTie transcript 2091789 2095853 1000 + . gene_id "SS.1653"; transcript_id "SS.1653.1"; cov "6551.078967"; FPKM "320.377237"; TPM "685.077621"; +CM143128.1 StringTie exon 2091789 2093196 1000 + . gene_id "SS.1653"; transcript_id "SS.1653.1"; exon_number "1"; cov "7347.573730"; +CM143128.1 StringTie exon 2094590 2095853 1000 + . gene_id "SS.1653"; transcript_id "SS.1653.1"; exon_number "2"; cov "5663.844238"; +CM143128.1 StringTie transcript 2096354 2096884 1000 . . gene_id "SS.1654"; transcript_id "SS.1654.1"; cov "1136.532957"; FPKM "55.581575"; TPM "118.852680"; +CM143128.1 StringTie exon 2096354 2096884 1000 . . gene_id "SS.1654"; transcript_id "SS.1654.1"; exon_number "1"; cov "1136.532959"; +CM143128.1 StringTie transcript 2097133 2098048 1000 . . gene_id "SS.1655"; transcript_id "SS.1655.1"; cov "660.561135"; FPKM "32.304412"; TPM "69.078033"; +CM143128.1 StringTie exon 2097133 2098048 1000 . . gene_id "SS.1655"; transcript_id "SS.1655.1"; exon_number "1"; cov "660.561157"; +CM143128.1 StringTie transcript 2098264 2102409 1000 . . gene_id "SS.1656"; transcript_id "SS.1656.1"; cov "482.268693"; FPKM "23.585109"; TPM "50.433141"; +CM143128.1 StringTie exon 2098264 2102409 1000 . . gene_id "SS.1656"; transcript_id "SS.1656.1"; exon_number "1"; cov "482.268707"; +CM143128.1 StringTie transcript 2102640 2103370 1000 . . gene_id "SS.1657"; transcript_id "SS.1657.1"; cov "1626.112175"; FPKM "79.524202"; TPM "170.050318"; +CM143128.1 StringTie exon 2102640 2103370 1000 . . gene_id "SS.1657"; transcript_id "SS.1657.1"; exon_number "1"; cov "1626.112183"; +CM143128.1 StringTie transcript 2149408 2151918 1000 . . gene_id "SS.1658"; transcript_id "SS.1658.1"; cov "217.000000"; FPKM "10.612276"; TPM "22.692727"; +CM143128.1 StringTie exon 2149408 2151918 1000 . . gene_id "SS.1658"; transcript_id "SS.1658.1"; exon_number "1"; cov "217.000000"; +CM143128.1 StringTie transcript 2109468 2111794 1000 - . gene_id "SS.1659"; transcript_id "SS.1659.1"; cov "1158.827986"; FPKM "56.671903"; TPM "121.184178"; +CM143128.1 StringTie exon 2109468 2111557 1000 - . gene_id "SS.1659"; transcript_id "SS.1659.1"; exon_number "1"; cov "1222.202393"; +CM143128.1 StringTie exon 2111641 2111794 1000 - . gene_id "SS.1659"; transcript_id "SS.1659.1"; exon_number "2"; cov "298.746765"; +CM143128.1 StringTie transcript 2115886 2118625 1000 . . gene_id "SS.1660"; transcript_id "SS.1660.1"; cov "559.769343"; FPKM "27.375239"; TPM "58.537754"; +CM143128.1 StringTie exon 2115886 2118625 1000 . . gene_id "SS.1660"; transcript_id "SS.1660.1"; exon_number "1"; cov "559.769348"; +CM143128.1 StringTie transcript 2118812 2124542 1000 . . gene_id "SS.1661"; transcript_id "SS.1661.1"; cov "827.257721"; FPKM "40.456625"; TPM "86.510292"; +CM143128.1 StringTie exon 2118812 2124542 1000 . . gene_id "SS.1661"; transcript_id "SS.1661.1"; exon_number "1"; cov "827.257751"; +CM143128.1 StringTie transcript 2141676 2142842 1000 + . gene_id "SS.1662"; transcript_id "SS.1662.1"; cov "10.794038"; FPKM "0.527877"; TPM "1.128784"; +CM143128.1 StringTie exon 2141676 2141979 1000 + . gene_id "SS.1662"; transcript_id "SS.1662.1"; exon_number "1"; cov "7.805921"; +CM143128.1 StringTie exon 2142040 2142842 1000 + . gene_id "SS.1662"; transcript_id "SS.1662.1"; exon_number "2"; cov "11.925281"; +CM143128.1 StringTie transcript 2143705 2146772 1000 + . gene_id "SS.1663"; transcript_id "SS.1663.1"; cov "175.335000"; FPKM "8.574670"; TPM "18.335619"; +CM143128.1 StringTie exon 2143705 2144132 1000 + . gene_id "SS.1663"; transcript_id "SS.1663.1"; exon_number "1"; cov "45.058411"; +CM143128.1 StringTie exon 2144201 2146772 1000 + . gene_id "SS.1663"; transcript_id "SS.1663.1"; exon_number "2"; cov "197.013992"; +CM143128.1 StringTie transcript 2152171 2156767 1000 . . gene_id "SS.1664"; transcript_id "SS.1664.1"; cov "200.220579"; FPKM "9.791687"; TPM "20.938022"; +CM143128.1 StringTie exon 2152171 2156767 1000 . . gene_id "SS.1664"; transcript_id "SS.1664.1"; exon_number "1"; cov "200.220581"; +CM143128.1 StringTie transcript 2157223 2166352 1000 . . gene_id "SS.1665"; transcript_id "SS.1665.1"; cov "350.780175"; FPKM "17.154729"; TPM "36.682759"; +CM143128.1 StringTie exon 2157223 2166352 1000 . . gene_id "SS.1665"; transcript_id "SS.1665.1"; exon_number "1"; cov "350.780182"; +CM143128.1 StringTie transcript 2175948 2177229 1000 . . gene_id "SS.1666"; transcript_id "SS.1666.1"; cov "4793.218409"; FPKM "234.409947"; TPM "501.249746"; +CM143128.1 StringTie exon 2175948 2177229 1000 . . gene_id "SS.1666"; transcript_id "SS.1666.1"; exon_number "1"; cov "4793.218262"; +CM143128.1 StringTie transcript 2180931 2182258 1000 - . gene_id "SS.1667"; transcript_id "SS.1667.1"; cov "26475.135922"; FPKM "1294.753269"; TPM "2768.631431"; +CM143128.1 StringTie exon 2180931 2181807 1000 - . gene_id "SS.1667"; transcript_id "SS.1667.1"; exon_number "1"; cov "27955.111328"; +CM143128.1 StringTie exon 2182209 2182258 1000 - . gene_id "SS.1667"; transcript_id "SS.1667.1"; exon_number "2"; cov "516.380005"; +CM143128.1 StringTie transcript 2184215 2185389 1000 . . gene_id "SS.1668"; transcript_id "SS.1668.1"; cov "13417.268936"; FPKM "656.164821"; TPM "1403.107905"; +CM143128.1 StringTie exon 2184215 2185389 1000 . . gene_id "SS.1668"; transcript_id "SS.1668.1"; exon_number "1"; cov "13417.268555"; +CM143128.1 StringTie transcript 2187899 2191737 1000 . . gene_id "SS.1669"; transcript_id "SS.1669.1"; cov "2866.374316"; FPKM "140.178601"; TPM "299.750454"; +CM143128.1 StringTie exon 2187899 2191737 1000 . . gene_id "SS.1669"; transcript_id "SS.1669.1"; exon_number "1"; cov "2866.374268"; +CM143128.1 StringTie transcript 2250080 2255115 1000 . . gene_id "SS.1670"; transcript_id "SS.1670.1"; cov "226.932486"; FPKM "11.098020"; TPM "23.731414"; +CM143128.1 StringTie exon 2250080 2255115 1000 . . gene_id "SS.1670"; transcript_id "SS.1670.1"; exon_number "1"; cov "226.932480"; +CM143128.1 StringTie transcript 2192510 2199683 1000 . . gene_id "SS.1671"; transcript_id "SS.1671.1"; cov "425.206858"; FPKM "20.794529"; TPM "44.465912"; +CM143128.1 StringTie exon 2192510 2199683 1000 . . gene_id "SS.1671"; transcript_id "SS.1671.1"; exon_number "1"; cov "425.206848"; +CM143128.1 StringTie transcript 2200119 2201420 1000 . . gene_id "SS.1672"; transcript_id "SS.1672.1"; cov "742.967742"; FPKM "36.334465"; TPM "77.695686"; +CM143128.1 StringTie exon 2200119 2201420 1000 . . gene_id "SS.1672"; transcript_id "SS.1672.1"; exon_number "1"; cov "742.967712"; +CM143128.1 StringTie transcript 2201778 2205214 1000 . . gene_id "SS.1673"; transcript_id "SS.1673.1"; cov "559.459121"; FPKM "27.360068"; TPM "58.505313"; +CM143128.1 StringTie exon 2201778 2205214 1000 . . gene_id "SS.1673"; transcript_id "SS.1673.1"; exon_number "1"; cov "559.459106"; +CM143128.1 StringTie transcript 2205458 2207733 1000 . . gene_id "SS.1674"; transcript_id "SS.1674.1"; cov "354.650264"; FPKM "17.343994"; TPM "37.087472"; +CM143128.1 StringTie exon 2205458 2207733 1000 . . gene_id "SS.1674"; transcript_id "SS.1674.1"; exon_number "1"; cov "354.650269"; +CM143128.1 StringTie transcript 2208000 2209026 1000 . . gene_id "SS.1675"; transcript_id "SS.1675.1"; cov "694.241480"; FPKM "33.951532"; TPM "72.600148"; +CM143128.1 StringTie exon 2208000 2209026 1000 . . gene_id "SS.1675"; transcript_id "SS.1675.1"; exon_number "1"; cov "694.241455"; +CM143128.1 StringTie transcript 2214706 2216350 1000 . . gene_id "SS.1676"; transcript_id "SS.1676.1"; cov "547.906991"; FPKM "26.795117"; TPM "57.297251"; +CM143128.1 StringTie exon 2214706 2216350 1000 . . gene_id "SS.1676"; transcript_id "SS.1676.1"; exon_number "1"; cov "547.906982"; +CM143128.1 StringTie transcript 2216551 2219953 1000 . . gene_id "SS.1677"; transcript_id "SS.1677.1"; cov "1182.010873"; FPKM "57.805650"; TPM "123.608523"; +CM143128.1 StringTie exon 2216551 2219953 1000 . . gene_id "SS.1677"; transcript_id "SS.1677.1"; exon_number "1"; cov "1182.010864"; +CM143128.1 StringTie transcript 2220294 2222150 1000 . . gene_id "SS.1678"; transcript_id "SS.1678.1"; cov "1336.809370"; FPKM "65.375993"; TPM "139.796542"; +CM143128.1 StringTie exon 2220294 2222150 1000 . . gene_id "SS.1678"; transcript_id "SS.1678.1"; exon_number "1"; cov "1336.809326"; +CM143128.1 StringTie transcript 2222516 2224830 1000 . . gene_id "SS.1679"; transcript_id "SS.1679.1"; cov "683.363283"; FPKM "33.419539"; TPM "71.462563"; +CM143128.1 StringTie exon 2222516 2224830 1000 . . gene_id "SS.1679"; transcript_id "SS.1679.1"; exon_number "1"; cov "683.363281"; +CM143128.1 StringTie transcript 2225085 2226584 1000 . . gene_id "SS.1680"; transcript_id "SS.1680.1"; cov "2145.080667"; FPKM "104.904096"; TPM "224.321332"; +CM143128.1 StringTie exon 2225085 2226584 1000 . . gene_id "SS.1680"; transcript_id "SS.1680.1"; exon_number "1"; cov "2145.080566"; +CM143128.1 StringTie transcript 2226881 2228665 1000 . . gene_id "SS.1681"; transcript_id "SS.1681.1"; cov "1213.761345"; FPKM "59.358391"; TPM "126.928822"; +CM143128.1 StringTie exon 2226881 2228665 1000 . . gene_id "SS.1681"; transcript_id "SS.1681.1"; exon_number "1"; cov "1213.761353"; +CM143128.1 StringTie transcript 2228978 2232913 1000 . . gene_id "SS.1682"; transcript_id "SS.1682.1"; cov "3085.379573"; FPKM "150.888943"; TPM "322.652880"; +CM143128.1 StringTie exon 2228978 2232913 1000 . . gene_id "SS.1682"; transcript_id "SS.1682.1"; exon_number "1"; cov "3085.379639"; +CM143128.1 StringTie transcript 2233170 2243555 1000 . . gene_id "SS.1683"; transcript_id "SS.1683.1"; cov "429.575968"; FPKM "21.008198"; TPM "44.922811"; +CM143128.1 StringTie exon 2233170 2243555 1000 . . gene_id "SS.1683"; transcript_id "SS.1683.1"; exon_number "1"; cov "429.575958"; +CM143128.1 StringTie transcript 2249253 2249718 1000 . . gene_id "SS.1684"; transcript_id "SS.1684.1"; cov "6.212446"; FPKM "0.303817"; TPM "0.649665"; +CM143128.1 StringTie exon 2249253 2249718 1000 . . gene_id "SS.1684"; transcript_id "SS.1684.1"; exon_number "1"; cov "6.212446"; +CM143128.1 StringTie transcript 2256186 2265261 1000 + . gene_id "SS.1685"; transcript_id "SS.1685.1"; cov "112.849761"; FPKM "5.518861"; TPM "11.801239"; +CM143128.1 StringTie exon 2256186 2256373 1000 + . gene_id "SS.1685"; transcript_id "SS.1685.1"; exon_number "1"; cov "85.495949"; +CM143128.1 StringTie exon 2257570 2265261 1000 + . gene_id "SS.1685"; transcript_id "SS.1685.1"; exon_number "2"; cov "113.518318"; +CM143128.1 StringTie transcript 2265565 2265971 1000 . . gene_id "SS.1686"; transcript_id "SS.1686.1"; cov "16.496314"; FPKM "0.806744"; TPM "1.725098"; +CM143128.1 StringTie exon 2265565 2265971 1000 . . gene_id "SS.1686"; transcript_id "SS.1686.1"; exon_number "1"; cov "16.496315"; +CM143128.1 StringTie transcript 2267222 2271613 1000 . . gene_id "SS.1687"; transcript_id "SS.1687.1"; cov "7342.290073"; FPKM "359.071020"; TPM "767.818346"; +CM143128.1 StringTie exon 2267222 2271613 1000 . . gene_id "SS.1687"; transcript_id "SS.1687.1"; exon_number "1"; cov "7342.290039"; +CM143128.1 StringTie transcript 2272067 2281780 1000 . . gene_id "SS.1688"; transcript_id "SS.1688.1"; cov "247.606033"; FPKM "12.109049"; TPM "25.893346"; +CM143128.1 StringTie exon 2272067 2281780 1000 . . gene_id "SS.1688"; transcript_id "SS.1688.1"; exon_number "1"; cov "247.606033"; +CM143128.1 StringTie transcript 2286214 2290477 1000 . . gene_id "SS.1689"; transcript_id "SS.1689.1"; cov "298.573171"; FPKM "14.601571"; TPM "31.223223"; +CM143128.1 StringTie exon 2286214 2290477 1000 . . gene_id "SS.1689"; transcript_id "SS.1689.1"; exon_number "1"; cov "298.573181"; +CM143128.1 StringTie transcript 2291156 2293051 1000 . . gene_id "SS.1690"; transcript_id "SS.1690.1"; cov "6154.662975"; FPKM "300.990712"; TPM "643.622507"; +CM143128.1 StringTie exon 2291156 2293051 1000 . . gene_id "SS.1690"; transcript_id "SS.1690.1"; exon_number "1"; cov "6154.663086"; +CM143128.1 StringTie transcript 2293321 2294778 1000 - . gene_id "SS.1691"; transcript_id "SS.1691.1"; cov "1324.792101"; FPKM "64.788295"; TPM "138.539838"; +CM143128.1 StringTie exon 2293321 2294637 1000 - . gene_id "SS.1691"; transcript_id "SS.1691.1"; exon_number "1"; cov "1331.009155"; +CM143128.1 StringTie exon 2294754 2294778 1000 - . gene_id "SS.1691"; transcript_id "SS.1691.1"; exon_number "2"; cov "997.280029"; +CM143128.1 StringTie transcript 2295278 2296110 1000 + . gene_id "SS.1692"; transcript_id "SS.1692.1"; cov "1810.653533"; FPKM "88.549105"; TPM "189.348689"; +CM143128.1 StringTie exon 2295278 2295429 1000 + . gene_id "SS.1692"; transcript_id "SS.1692.1"; exon_number "1"; cov "1135.414429"; +CM143128.1 StringTie exon 2295527 2296110 1000 + . gene_id "SS.1692"; transcript_id "SS.1692.1"; exon_number "2"; cov "1986.400635"; +CM143128.1 StringTie transcript 2297109 2299604 1000 + . gene_id "SS.1693"; transcript_id "SS.1693.1"; cov "11096.098837"; FPKM "542.649159"; TPM "1160.372060"; +CM143128.1 StringTie exon 2297109 2297219 1000 + . gene_id "SS.1693"; transcript_id "SS.1693.1"; exon_number "1"; cov "869.396423"; +CM143128.1 StringTie exon 2298340 2299604 1000 + . gene_id "SS.1693"; transcript_id "SS.1693.1"; exon_number "2"; cov "11993.461914"; +CM143128.1 StringTie transcript 2300032 2302201 1000 + . gene_id "SS.1694"; transcript_id "SS.1694.1"; cov "669.571213"; FPKM "32.745045"; TPM "70.020260"; +CM143128.1 StringTie exon 2300032 2300181 1000 + . gene_id "SS.1694"; transcript_id "SS.1694.1"; exon_number "1"; cov "716.719971"; +CM143128.1 StringTie exon 2300277 2300311 1000 + . gene_id "SS.1694"; transcript_id "SS.1694.1"; exon_number "2"; cov "1464.285767"; +CM143128.1 StringTie exon 2300400 2302201 1000 + . gene_id "SS.1694"; transcript_id "SS.1694.1"; exon_number "3"; cov "650.210876"; +CM143128.1 StringTie transcript 2302419 2305879 1000 . . gene_id "SS.1695"; transcript_id "SS.1695.1"; cov "2007.881537"; FPKM "98.194441"; TPM "209.973764"; +CM143128.1 StringTie exon 2302419 2305879 1000 . . gene_id "SS.1695"; transcript_id "SS.1695.1"; exon_number "1"; cov "2007.881592"; +CM143128.1 StringTie transcript 2306213 2311214 1000 . . gene_id "SS.1696"; transcript_id "SS.1696.1"; cov "524.403838"; FPKM "25.645707"; TPM "54.839414"; +CM143128.1 StringTie exon 2306213 2311214 1000 . . gene_id "SS.1696"; transcript_id "SS.1696.1"; exon_number "1"; cov "524.403809"; +CM143128.1 StringTie transcript 2311671 2315356 1000 . . gene_id "SS.1697"; transcript_id "SS.1697.1"; cov "429.851329"; FPKM "21.021664"; TPM "44.951607"; +CM143128.1 StringTie exon 2311671 2315356 1000 . . gene_id "SS.1697"; transcript_id "SS.1697.1"; exon_number "1"; cov "429.851318"; +CM143128.1 StringTie transcript 2315680 2322284 1000 . . gene_id "SS.1698"; transcript_id "SS.1698.1"; cov "414.198183"; FPKM "20.256155"; TPM "43.314683"; +CM143128.1 StringTie exon 2315680 2322284 1000 . . gene_id "SS.1698"; transcript_id "SS.1698.1"; exon_number "1"; cov "414.198181"; +CM143128.1 StringTie transcript 2322582 2328420 1000 . . gene_id "SS.1699"; transcript_id "SS.1699.1"; cov "763.488611"; FPKM "37.338028"; TPM "79.841651"; +CM143128.1 StringTie exon 2322582 2328420 1000 . . gene_id "SS.1699"; transcript_id "SS.1699.1"; exon_number "1"; cov "763.488586"; +CM143128.1 StringTie transcript 2328646 2337132 1000 . . gene_id "SS.1700"; transcript_id "SS.1700.1"; cov "234.683634"; FPKM "11.477086"; TPM "24.541989"; +CM143128.1 StringTie exon 2328646 2337132 1000 . . gene_id "SS.1700"; transcript_id "SS.1700.1"; exon_number "1"; cov "234.683640"; +CM143128.1 StringTie transcript 2337473 2343917 1000 + . gene_id "SS.1701"; transcript_id "SS.1701.1"; cov "1741.479621"; FPKM "85.166189"; TPM "182.114843"; +CM143128.1 StringTie exon 2337473 2337504 1000 + . gene_id "SS.1701"; transcript_id "SS.1701.1"; exon_number "1"; cov "170.968750"; +CM143128.1 StringTie exon 2338037 2343917 1000 + . gene_id "SS.1701"; transcript_id "SS.1701.1"; exon_number "2"; cov "1750.025146"; +CM143128.1 StringTie transcript 2344356 2347718 1000 - . gene_id "SS.1702"; transcript_id "SS.1702.1"; cov "195.962121"; FPKM "9.583429"; TPM "20.492695"; +CM143128.1 StringTie exon 2344356 2347485 1000 - . gene_id "SS.1702"; transcript_id "SS.1702.1"; exon_number "1"; cov "191.565811"; +CM143128.1 StringTie exon 2347549 2347718 1000 - . gene_id "SS.1702"; transcript_id "SS.1702.1"; exon_number "2"; cov "276.905884"; +CM143128.1 StringTie transcript 2347974 2351675 1000 . . gene_id "SS.1703"; transcript_id "SS.1703.1"; cov "390.607239"; FPKM "19.102451"; TPM "40.847665"; +CM143128.1 StringTie exon 2347974 2351675 1000 . . gene_id "SS.1703"; transcript_id "SS.1703.1"; exon_number "1"; cov "390.607239"; +CM143128.1 StringTie transcript 2371292 2371662 1000 . . gene_id "SS.1704"; transcript_id "SS.1704.1"; cov "11.021563"; FPKM "0.539004"; TPM "1.152577"; +CM143128.1 StringTie exon 2371292 2371662 1000 . . gene_id "SS.1704"; transcript_id "SS.1704.1"; exon_number "1"; cov "11.021564"; +CM143128.1 StringTie transcript 2353258 2355731 1000 . . gene_id "SS.1705"; transcript_id "SS.1705.1"; cov "535.732417"; FPKM "26.199726"; TPM "56.024098"; +CM143128.1 StringTie exon 2353258 2355731 1000 . . gene_id "SS.1705"; transcript_id "SS.1705.1"; exon_number "1"; cov "535.732422"; +CM143128.1 StringTie transcript 2356878 2359587 1000 . . gene_id "SS.1706"; transcript_id "SS.1706.1"; cov "1887.902952"; FPKM "92.326949"; TPM "197.427030"; +CM143128.1 StringTie exon 2356878 2359587 1000 . . gene_id "SS.1706"; transcript_id "SS.1706.1"; exon_number "1"; cov "1887.902954"; +CM143128.1 StringTie transcript 2363581 2370212 1000 . . gene_id "SS.1707"; transcript_id "SS.1707.1"; cov "407.233489"; FPKM "19.915550"; TPM "42.586351"; +CM143128.1 StringTie exon 2363581 2370212 1000 . . gene_id "SS.1707"; transcript_id "SS.1707.1"; exon_number "1"; cov "407.233490"; +CM143128.1 StringTie transcript 2363581 2370212 1000 + . gene_id "SS.1708"; transcript_id "SS.1708.1"; cov "42.592953"; FPKM "2.082987"; TPM "4.454149"; +CM143128.1 StringTie exon 2363581 2364178 1000 + . gene_id "SS.1708"; transcript_id "SS.1708.1"; exon_number "1"; cov "31.556232"; +CM143128.1 StringTie exon 2364281 2370212 1000 + . gene_id "SS.1708"; transcript_id "SS.1708.1"; exon_number "2"; cov "43.705555"; +CM143128.1 StringTie transcript 2371997 2373884 1000 . . gene_id "SS.1709"; transcript_id "SS.1709.1"; cov "3106.166843"; FPKM "151.905535"; TPM "324.826704"; +CM143128.1 StringTie exon 2371997 2373884 1000 . . gene_id "SS.1709"; transcript_id "SS.1709.1"; exon_number "1"; cov "3106.166748"; +CM143128.1 StringTie transcript 2374600 2382339 1000 + . gene_id "SS.1710"; transcript_id "SS.1710.1"; cov "255.034206"; FPKM "12.472320"; TPM "26.670145"; +CM143128.1 StringTie exon 2374600 2377086 1000 + . gene_id "SS.1710"; transcript_id "SS.1710.1"; exon_number "1"; cov "41.556244"; +CM143128.1 StringTie exon 2377182 2382339 1000 + . gene_id "SS.1710"; transcript_id "SS.1710.1"; exon_number "2"; cov "357.965515"; +CM143128.1 StringTie transcript 2374600 2382339 1000 + . gene_id "SS.1710"; transcript_id "SS.1710.2"; cov "33.846458"; FPKM "1.655244"; TPM "3.539486"; +CM143128.1 StringTie exon 2374600 2377086 1000 + . gene_id "SS.1710"; transcript_id "SS.1710.2"; exon_number "1"; cov "5.510100"; +CM143128.1 StringTie exon 2377197 2382339 1000 + . gene_id "SS.1710"; transcript_id "SS.1710.2"; exon_number "2"; cov "47.549068"; +CM143128.1 StringTie transcript 2383035 2386673 1000 . . gene_id "SS.1711"; transcript_id "SS.1711.1"; cov "1540.546029"; FPKM "75.339632"; TPM "161.102257"; +CM143128.1 StringTie exon 2383035 2386673 1000 . . gene_id "SS.1711"; transcript_id "SS.1711.1"; exon_number "1"; cov "1540.546021"; +CM143128.1 StringTie transcript 2387581 2389799 1000 . . gene_id "SS.1712"; transcript_id "SS.1712.1"; cov "394.989635"; FPKM "19.316770"; TPM "41.305953"; +CM143128.1 StringTie exon 2387581 2389799 1000 . . gene_id "SS.1712"; transcript_id "SS.1712.1"; exon_number "1"; cov "394.989624"; +CM143128.1 StringTie transcript 2391213 2392338 1000 . . gene_id "SS.1713"; transcript_id "SS.1713.1"; cov "6192.104796"; FPKM "302.821785"; TPM "647.537977"; +CM143128.1 StringTie exon 2391213 2392338 1000 . . gene_id "SS.1713"; transcript_id "SS.1713.1"; exon_number "1"; cov "6192.104980"; +CM143128.1 StringTie transcript 2405301 2407323 1000 . . gene_id "SS.1714"; transcript_id "SS.1714.1"; cov "484.408799"; FPKM "23.689770"; TPM "50.656942"; +CM143128.1 StringTie exon 2405301 2407323 1000 . . gene_id "SS.1714"; transcript_id "SS.1714.1"; exon_number "1"; cov "484.408813"; +CM143128.1 StringTie transcript 2407776 2409846 1000 . . gene_id "SS.1715"; transcript_id "SS.1715.1"; cov "163.546113"; FPKM "7.998141"; TPM "17.102798"; +CM143128.1 StringTie exon 2407776 2409846 1000 . . gene_id "SS.1715"; transcript_id "SS.1715.1"; exon_number "1"; cov "163.546112"; +CM143128.1 StringTie transcript 2418857 2419154 1000 . . gene_id "SS.1716"; transcript_id "SS.1716.1"; cov "9.137584"; FPKM "0.446869"; TPM "0.955561"; +CM143128.1 StringTie exon 2418857 2419154 1000 . . gene_id "SS.1716"; transcript_id "SS.1716.1"; exon_number "1"; cov "9.137584"; +CM143128.1 StringTie transcript 2419405 2424648 1000 . . gene_id "SS.1717"; transcript_id "SS.1717.1"; cov "281.502884"; FPKM "13.766758"; TPM "29.438101"; +CM143128.1 StringTie exon 2419405 2424648 1000 . . gene_id "SS.1717"; transcript_id "SS.1717.1"; exon_number "1"; cov "281.502899"; +CM143128.1 StringTie transcript 2428068 2432272 1000 . . gene_id "SS.1718"; transcript_id "SS.1718.1"; cov "898.222830"; FPKM "43.927138"; TPM "93.931452"; +CM143128.1 StringTie exon 2428068 2432272 1000 . . gene_id "SS.1718"; transcript_id "SS.1718.1"; exon_number "1"; cov "898.222839"; +CM143128.1 StringTie transcript 2432963 2437290 1000 . . gene_id "SS.1719"; transcript_id "SS.1719.1"; cov "445.357209"; FPKM "21.779971"; TPM "46.573131"; +CM143128.1 StringTie exon 2432963 2437290 1000 . . gene_id "SS.1719"; transcript_id "SS.1719.1"; exon_number "1"; cov "445.357208"; +CM143128.1 StringTie transcript 2437979 2439614 1000 . . gene_id "SS.1720"; transcript_id "SS.1720.1"; cov "158.204156"; FPKM "7.736895"; TPM "16.544164"; +CM143128.1 StringTie exon 2437979 2439614 1000 . . gene_id "SS.1720"; transcript_id "SS.1720.1"; exon_number "1"; cov "158.204163"; +CM143128.1 StringTie transcript 2439858 2442795 1000 . . gene_id "SS.1721"; transcript_id "SS.1721.1"; cov "262.343771"; FPKM "12.829791"; TPM "27.434541"; +CM143128.1 StringTie exon 2439858 2442795 1000 . . gene_id "SS.1721"; transcript_id "SS.1721.1"; exon_number "1"; cov "262.343781"; +CM143128.1 StringTie transcript 2443230 2445395 1000 . . gene_id "SS.1722"; transcript_id "SS.1722.1"; cov "671.300554"; FPKM "32.829618"; TPM "70.201106"; +CM143128.1 StringTie exon 2443230 2445395 1000 . . gene_id "SS.1722"; transcript_id "SS.1722.1"; exon_number "1"; cov "671.300537"; +CM143128.1 StringTie transcript 2445677 2455955 1000 . . gene_id "SS.1723"; transcript_id "SS.1723.1"; cov "595.091935"; FPKM "29.102673"; TPM "62.231606"; +CM143128.1 StringTie exon 2445677 2455955 1000 . . gene_id "SS.1723"; transcript_id "SS.1723.1"; exon_number "1"; cov "595.091919"; +CM143128.1 StringTie transcript 2456287 2461939 1000 . . gene_id "SS.1724"; transcript_id "SS.1724.1"; cov "350.402618"; FPKM "17.136265"; TPM "36.643276"; +CM143128.1 StringTie exon 2456287 2461939 1000 . . gene_id "SS.1724"; transcript_id "SS.1724.1"; exon_number "1"; cov "350.402618"; +CM143128.1 StringTie transcript 2462269 2463095 1000 . . gene_id "SS.1725"; transcript_id "SS.1725.1"; cov "226.946796"; FPKM "11.098719"; TPM "23.732911"; +CM143128.1 StringTie exon 2462269 2463095 1000 . . gene_id "SS.1725"; transcript_id "SS.1725.1"; exon_number "1"; cov "226.946793"; +CM143128.1 StringTie transcript 2464122 2464677 1000 . . gene_id "SS.1726"; transcript_id "SS.1726.1"; cov "135.782374"; FPKM "6.640369"; TPM "14.199411"; +CM143128.1 StringTie exon 2464122 2464677 1000 . . gene_id "SS.1726"; transcript_id "SS.1726.1"; exon_number "1"; cov "135.782379"; +CM143128.1 StringTie transcript 2466345 2470131 1000 . . gene_id "SS.1727"; transcript_id "SS.1727.1"; cov "1529.567204"; FPKM "74.802718"; TPM "159.954149"; +CM143128.1 StringTie exon 2466345 2470131 1000 . . gene_id "SS.1727"; transcript_id "SS.1727.1"; exon_number "1"; cov "1529.567261"; +CM143128.1 StringTie transcript 2470832 2474866 1000 . . gene_id "SS.1728"; transcript_id "SS.1728.1"; cov "571.163569"; FPKM "27.932468"; TPM "59.729303"; +CM143128.1 StringTie exon 2470832 2474866 1000 . . gene_id "SS.1728"; transcript_id "SS.1728.1"; exon_number "1"; cov "571.163574"; +CM143128.1 StringTie transcript 2475262 2477099 1000 . . gene_id "SS.1729"; transcript_id "SS.1729.1"; cov "3329.952122"; FPKM "162.849642"; TPM "348.229000"; +CM143128.1 StringTie exon 2475262 2477099 1000 . . gene_id "SS.1729"; transcript_id "SS.1729.1"; exon_number "1"; cov "3329.952148"; +CM143128.1 StringTie transcript 2477870 2480884 1000 + . gene_id "SS.1730"; transcript_id "SS.1730.1"; cov "16071.348218"; FPKM "785.961239"; TPM "1680.657654"; +CM143128.1 StringTie exon 2477870 2477945 1000 + . gene_id "SS.1730"; transcript_id "SS.1730.1"; exon_number "1"; cov "2292.973633"; +CM143128.1 StringTie exon 2478184 2480884 1000 + . gene_id "SS.1730"; transcript_id "SS.1730.1"; exon_number "2"; cov "16459.041016"; +CM143128.1 StringTie transcript 2481142 2486761 1000 + . gene_id "SS.1731"; transcript_id "SS.1731.1"; cov "416.458747"; FPKM "20.366707"; TPM "43.551081"; +CM143128.1 StringTie exon 2481142 2481503 1000 + . gene_id "SS.1731"; transcript_id "SS.1731.1"; exon_number "1"; cov "191.737564"; +CM143128.1 StringTie exon 2481585 2486761 1000 + . gene_id "SS.1731"; transcript_id "SS.1731.1"; exon_number "2"; cov "432.172302"; +CM143128.1 StringTie transcript 2487577 2491914 1000 + . gene_id "SS.1732"; transcript_id "SS.1732.1"; cov "928.574381"; FPKM "45.411465"; TPM "97.105459"; +CM143128.1 StringTie exon 2487577 2489428 1000 + . gene_id "SS.1732"; transcript_id "SS.1732.1"; exon_number "1"; cov "480.773773"; +CM143128.1 StringTie exon 2489606 2491914 1000 + . gene_id "SS.1732"; transcript_id "SS.1732.1"; exon_number "2"; cov "1287.745728"; +CM143128.1 StringTie transcript 2492390 2500854 1000 . . gene_id "SS.1733"; transcript_id "SS.1733.1"; cov "190.939161"; FPKM "9.337784"; TPM "19.967420"; +CM143128.1 StringTie exon 2492390 2500854 1000 . . gene_id "SS.1733"; transcript_id "SS.1733.1"; exon_number "1"; cov "190.939163"; +CM143128.1 StringTie transcript 2501211 2502304 1000 . . gene_id "SS.1734"; transcript_id "SS.1734.1"; cov "19.670238"; FPKM "0.961963"; TPM "2.057011"; +CM143128.1 StringTie exon 2501211 2502304 1000 . . gene_id "SS.1734"; transcript_id "SS.1734.1"; exon_number "1"; cov "19.670238"; +CM143128.1 StringTie transcript 2510277 2512499 1000 . . gene_id "SS.1735"; transcript_id "SS.1735.1"; cov "1276.469186"; FPKM "62.425087"; TPM "133.486480"; +CM143128.1 StringTie exon 2510277 2512499 1000 . . gene_id "SS.1735"; transcript_id "SS.1735.1"; exon_number "1"; cov "1276.469238"; +CM143128.1 StringTie transcript 2515827 2517273 1000 . . gene_id "SS.1736"; transcript_id "SS.1736.1"; cov "2503.466482"; FPKM "122.430775"; TPM "261.799449"; +CM143128.1 StringTie exon 2515827 2517273 1000 . . gene_id "SS.1736"; transcript_id "SS.1736.1"; exon_number "1"; cov "2503.466553"; +CM143128.1 StringTie transcript 2518449 2520784 1000 . . gene_id "SS.1737"; transcript_id "SS.1737.1"; cov "2839.503853"; FPKM "138.864514"; TPM "296.940482"; +CM143128.1 StringTie exon 2518449 2520784 1000 . . gene_id "SS.1737"; transcript_id "SS.1737.1"; exon_number "1"; cov "2839.503906"; +CM143128.1 StringTie transcript 2521578 2525426 1000 . . gene_id "SS.1738"; transcript_id "SS.1738.1"; cov "971.110158"; FPKM "47.491656"; TPM "101.553628"; +CM143128.1 StringTie exon 2521578 2525426 1000 . . gene_id "SS.1738"; transcript_id "SS.1738.1"; exon_number "1"; cov "971.110168"; +CM143128.1 StringTie transcript 2525639 2527903 1000 . . gene_id "SS.1739"; transcript_id "SS.1739.1"; cov "355.800442"; FPKM "17.400243"; TPM "37.207752"; +CM143128.1 StringTie exon 2525639 2527903 1000 . . gene_id "SS.1739"; transcript_id "SS.1739.1"; exon_number "1"; cov "355.800446"; +CM143128.1 StringTie transcript 2528363 2536991 1000 . . gene_id "SS.1740"; transcript_id "SS.1740.1"; cov "413.095144"; FPKM "20.202211"; TPM "43.199333"; +CM143128.1 StringTie exon 2528363 2536991 1000 . . gene_id "SS.1740"; transcript_id "SS.1740.1"; exon_number "1"; cov "413.095154"; +CM143128.1 StringTie transcript 2537305 2542529 1000 . . gene_id "SS.1741"; transcript_id "SS.1741.1"; cov "1021.882679"; FPKM "49.974661"; TPM "106.863153"; +CM143128.1 StringTie exon 2537305 2542529 1000 . . gene_id "SS.1741"; transcript_id "SS.1741.1"; exon_number "1"; cov "1021.882690"; +CM143128.1 StringTie transcript 2542967 2543970 1000 . . gene_id "SS.1742"; transcript_id "SS.1742.1"; cov "2450.728088"; FPKM "119.851630"; TPM "256.284343"; +CM143128.1 StringTie exon 2542967 2543970 1000 . . gene_id "SS.1742"; transcript_id "SS.1742.1"; exon_number "1"; cov "2450.728027"; +CM143128.1 StringTie transcript 2544328 2545829 1000 - . gene_id "SS.1743"; transcript_id "SS.1743.1"; cov "1057.330561"; FPKM "51.708222"; TPM "110.570107"; +CM143128.1 StringTie exon 2544328 2545621 1000 - . gene_id "SS.1743"; transcript_id "SS.1743.1"; exon_number "1"; cov "1152.887939"; +CM143128.1 StringTie exon 2545681 2545829 1000 - . gene_id "SS.1743"; transcript_id "SS.1743.1"; exon_number "2"; cov "227.456375"; +CM143128.1 StringTie transcript 2546279 2548188 1000 . . gene_id "SS.1744"; transcript_id "SS.1744.1"; cov "446.152880"; FPKM "21.818883"; TPM "46.656338"; +CM143128.1 StringTie exon 2546279 2548188 1000 . . gene_id "SS.1744"; transcript_id "SS.1744.1"; exon_number "1"; cov "446.152893"; +CM143128.1 StringTie transcript 2548503 2549393 1000 . . gene_id "SS.1745"; transcript_id "SS.1745.1"; cov "593.969697"; FPKM "29.047791"; TPM "62.114249"; +CM143128.1 StringTie exon 2548503 2549393 1000 . . gene_id "SS.1745"; transcript_id "SS.1745.1"; exon_number "1"; cov "593.969727"; +CM143128.1 StringTie transcript 2552649 2554066 1000 + . gene_id "SS.1746"; transcript_id "SS.1746.1"; cov "28159.275551"; FPKM "1377.115274"; TPM "2944.749957"; +CM143128.1 StringTie exon 2552649 2552700 1000 + . gene_id "SS.1746"; transcript_id "SS.1746.1"; exon_number "1"; cov "1494.788452"; +CM143128.1 StringTie exon 2553121 2554066 1000 + . gene_id "SS.1746"; transcript_id "SS.1746.1"; exon_number "2"; cov "29624.976562"; +CM143128.1 StringTie transcript 2562543 2563081 1000 . . gene_id "SS.1747"; transcript_id "SS.1747.1"; cov "2031.866419"; FPKM "99.367410"; TPM "212.481977"; +CM143128.1 StringTie exon 2562543 2563081 1000 . . gene_id "SS.1747"; transcript_id "SS.1747.1"; exon_number "1"; cov "2031.866455"; +CM143128.1 StringTie transcript 2563662 2564983 1000 . . gene_id "SS.1748"; transcript_id "SS.1748.1"; cov "1541.649017"; FPKM "75.393573"; TPM "161.217602"; +CM143128.1 StringTie exon 2563662 2564983 1000 . . gene_id "SS.1748"; transcript_id "SS.1748.1"; exon_number "1"; cov "1541.649048"; +CM143128.1 StringTie transcript 2563703 2566797 1000 + . gene_id "SS.1749"; transcript_id "SS.1749.1"; cov "958.111443"; FPKM "46.855960"; TPM "100.194290"; +CM143128.1 StringTie exon 2563703 2565683 1000 + . gene_id "SS.1749"; transcript_id "SS.1749.1"; exon_number "1"; cov "592.302856"; +CM143128.1 StringTie exon 2565764 2566797 1000 + . gene_id "SS.1749"; transcript_id "SS.1749.1"; exon_number "2"; cov "1658.949707"; +CM143128.1 StringTie transcript 2573276 2574515 1000 - . gene_id "SS.1750"; transcript_id "SS.1750.1"; cov "19977.935120"; FPKM "977.010916"; TPM "2089.188107"; +CM143128.1 StringTie exon 2573276 2573861 1000 - . gene_id "SS.1750"; transcript_id "SS.1750.1"; exon_number "1"; cov "23122.216797"; +CM143128.1 StringTie exon 2574393 2574515 1000 - . gene_id "SS.1750"; transcript_id "SS.1750.1"; exon_number "2"; cov "4997.861816"; +CM143128.1 StringTie transcript 2575239 2576134 1000 . . gene_id "SS.1751"; transcript_id "SS.1751.1"; cov "115.518973"; FPKM "5.649398"; TPM "12.080371"; +CM143128.1 StringTie exon 2575239 2576134 1000 . . gene_id "SS.1751"; transcript_id "SS.1751.1"; exon_number "1"; cov "115.518974"; +CM143128.1 StringTie transcript 2576740 2577327 1000 . . gene_id "SS.1752"; transcript_id "SS.1752.1"; cov "67.122449"; FPKM "3.282590"; TPM "7.019315"; +CM143128.1 StringTie exon 2576740 2577327 1000 . . gene_id "SS.1752"; transcript_id "SS.1752.1"; exon_number "1"; cov "67.122452"; +CM143128.1 StringTie transcript 2577934 2579187 1000 . . gene_id "SS.1753"; transcript_id "SS.1753.1"; cov "2591.661085"; FPKM "126.743888"; TPM "271.022380"; +CM143128.1 StringTie exon 2577934 2579187 1000 . . gene_id "SS.1753"; transcript_id "SS.1753.1"; exon_number "1"; cov "2591.661133"; +CM143128.1 StringTie transcript 2580147 2584654 1000 . . gene_id "SS.1754"; transcript_id "SS.1754.1"; cov "450.461402"; FPKM "22.029589"; TPM "47.106901"; +CM143128.1 StringTie exon 2580147 2584654 1000 . . gene_id "SS.1754"; transcript_id "SS.1754.1"; exon_number "1"; cov "450.461395"; +CM143128.1 StringTie transcript 2615394 2615743 1000 + . gene_id "SS.1755"; transcript_id "SS.1755.1"; cov "6.000000"; FPKM "0.293427"; TPM "0.627449"; +CM143128.1 StringTie exon 2615394 2615513 1000 + . gene_id "SS.1755"; transcript_id "SS.1755.1"; exon_number "1"; cov "6.000000"; +CM143128.1 StringTie exon 2615585 2615743 1000 + . gene_id "SS.1755"; transcript_id "SS.1755.1"; exon_number "2"; cov "6.000000"; +CM143128.1 StringTie transcript 2585554 2587856 1000 . . gene_id "SS.1756"; transcript_id "SS.1756.1"; cov "9414.349978"; FPKM "460.404073"; TPM "984.503548"; +CM143128.1 StringTie exon 2585554 2587856 1000 . . gene_id "SS.1756"; transcript_id "SS.1756.1"; exon_number "1"; cov "9414.349609"; +CM143128.1 StringTie transcript 2591293 2591782 1000 . . gene_id "SS.1757"; transcript_id "SS.1757.1"; cov "79758.824490"; FPKM "3900.565384"; TPM "8340.761273"; +CM143128.1 StringTie exon 2591293 2591782 1000 . . gene_id "SS.1757"; transcript_id "SS.1757.1"; exon_number "1"; cov "79758.828125"; +CM143128.1 StringTie transcript 2593284 2595298 1000 . . gene_id "SS.1758"; transcript_id "SS.1758.1"; cov "78.840695"; FPKM "3.855665"; TPM "8.244748"; +CM143128.1 StringTie exon 2593284 2595298 1000 . . gene_id "SS.1758"; transcript_id "SS.1758.1"; exon_number "1"; cov "78.840698"; +CM143128.1 StringTie transcript 2595755 2598784 1000 . . gene_id "SS.1759"; transcript_id "SS.1759.1"; cov "444.222442"; FPKM "21.724476"; TPM "46.454463"; +CM143128.1 StringTie exon 2595755 2598784 1000 . . gene_id "SS.1759"; transcript_id "SS.1759.1"; exon_number "1"; cov "444.222443"; +CM143128.1 StringTie transcript 2599107 2602895 1000 . . gene_id "SS.1760"; transcript_id "SS.1760.1"; cov "1074.495645"; FPKM "52.547672"; TPM "112.365142"; +CM143128.1 StringTie exon 2599107 2602895 1000 . . gene_id "SS.1760"; transcript_id "SS.1760.1"; exon_number "1"; cov "1074.495605"; +CM143128.1 StringTie transcript 2603237 2606415 1000 . . gene_id "SS.1761"; transcript_id "SS.1761.1"; cov "570.050016"; FPKM "27.878011"; TPM "59.612853"; +CM143128.1 StringTie exon 2603237 2606415 1000 . . gene_id "SS.1761"; transcript_id "SS.1761.1"; exon_number "1"; cov "570.049988"; +CM143128.1 StringTie transcript 2607259 2609874 1000 . . gene_id "SS.1762"; transcript_id "SS.1762.1"; cov "1734.625000"; FPKM "84.830967"; TPM "181.398022"; +CM143128.1 StringTie exon 2607259 2609874 1000 . . gene_id "SS.1762"; transcript_id "SS.1762.1"; exon_number "1"; cov "1734.625000"; +CM143128.1 StringTie transcript 2610278 2615083 1000 . . gene_id "SS.1763"; transcript_id "SS.1763.1"; cov "198.721390"; FPKM "9.718370"; TPM "20.781245"; +CM143128.1 StringTie exon 2610278 2615083 1000 . . gene_id "SS.1763"; transcript_id "SS.1763.1"; exon_number "1"; cov "198.721390"; +CM143128.1 StringTie transcript 2616203 2616612 1000 . . gene_id "SS.1764"; transcript_id "SS.1764.1"; cov "18.890244"; FPKM "0.923818"; TPM "1.975443"; +CM143128.1 StringTie exon 2616203 2616612 1000 . . gene_id "SS.1764"; transcript_id "SS.1764.1"; exon_number "1"; cov "18.890244"; +CM143128.1 StringTie transcript 2616915 2623191 1000 . . gene_id "SS.1765"; transcript_id "SS.1765.1"; cov "396.309383"; FPKM "19.381312"; TPM "41.443965"; +CM143128.1 StringTie exon 2616915 2623191 1000 . . gene_id "SS.1765"; transcript_id "SS.1765.1"; exon_number "1"; cov "396.309387"; +CM143128.1 StringTie transcript 2623510 2626063 1000 . . gene_id "SS.1766"; transcript_id "SS.1766.1"; cov "368.705951"; FPKM "18.031380"; TPM "38.557343"; +CM143128.1 StringTie exon 2623510 2626063 1000 . . gene_id "SS.1766"; transcript_id "SS.1766.1"; exon_number "1"; cov "368.705963"; +CM143128.1 StringTie transcript 2634764 2636805 1000 - . gene_id "SS.1767"; transcript_id "SS.1767.1"; cov "8199.097619"; FPKM "400.972765"; TPM "857.418804"; +CM143128.1 StringTie exon 2634764 2636139 1000 - . gene_id "SS.1767"; transcript_id "SS.1767.1"; exon_number "1"; cov "8062.854492"; +CM143128.1 StringTie exon 2636712 2636805 1000 - . gene_id "SS.1767"; transcript_id "SS.1767.1"; exon_number "2"; cov "10193.462891"; +CM143128.1 StringTie transcript 2637320 2639140 1000 . . gene_id "SS.1768"; transcript_id "SS.1768.1"; cov "3194.857770"; FPKM "156.242920"; TPM "334.101538"; +CM143128.1 StringTie exon 2637320 2639140 1000 . . gene_id "SS.1768"; transcript_id "SS.1768.1"; exon_number "1"; cov "3194.857666"; +CM143128.1 StringTie transcript 2639397 2643986 1000 . . gene_id "SS.1769"; transcript_id "SS.1769.1"; cov "1034.791939"; FPKM "50.605982"; TPM "108.213136"; +CM143128.1 StringTie exon 2639397 2643986 1000 . . gene_id "SS.1769"; transcript_id "SS.1769.1"; exon_number "1"; cov "1034.791992"; +CM143128.1 StringTie transcript 2647074 2647996 1000 . . gene_id "SS.1770"; transcript_id "SS.1770.1"; cov "3802.564464"; FPKM "185.962512"; TPM "397.652330"; +CM143128.1 StringTie exon 2647074 2647996 1000 . . gene_id "SS.1770"; transcript_id "SS.1770.1"; exon_number "1"; cov "3802.564453"; +CM143128.1 StringTie transcript 2648853 2649987 1000 . . gene_id "SS.1771"; transcript_id "SS.1771.1"; cov "627.005507"; FPKM "30.663390"; TPM "65.568961"; +CM143128.1 StringTie exon 2648853 2649987 1000 . . gene_id "SS.1771"; transcript_id "SS.1771.1"; exon_number "1"; cov "627.005493"; +CM143128.1 StringTie transcript 2648853 2657810 1000 - . gene_id "SS.1772"; transcript_id "SS.1772.1"; cov "647.436768"; FPKM "31.662571"; TPM "67.705556"; +CM143128.1 StringTie exon 2648853 2653812 1000 - . gene_id "SS.1772"; transcript_id "SS.1772.1"; exon_number "1"; cov "334.227295"; +CM143128.1 StringTie exon 2653905 2657189 1000 - . gene_id "SS.1772"; transcript_id "SS.1772.1"; exon_number "2"; cov "1214.915771"; +CM143128.1 StringTie exon 2657320 2657810 1000 - . gene_id "SS.1772"; transcript_id "SS.1772.1"; exon_number "3"; cov "14.749445"; +CM143128.1 StringTie transcript 2652919 2653978 1000 - . gene_id "SS.1772"; transcript_id "SS.1772.2"; cov "2333.880369"; FPKM "114.137251"; TPM "244.065019"; +CM143128.1 StringTie exon 2652919 2653812 1000 - . gene_id "SS.1772"; transcript_id "SS.1772.2"; exon_number "1"; cov "2492.367188"; +CM143128.1 StringTie exon 2653905 2653978 1000 - . gene_id "SS.1772"; transcript_id "SS.1772.2"; exon_number "2"; cov "419.188477"; +CM143128.1 StringTie transcript 2656130 2657373 1000 - . gene_id "SS.1772"; transcript_id "SS.1772.3"; cov "4071.222642"; FPKM "199.101105"; TPM "425.747199"; +CM143128.1 StringTie exon 2656130 2657189 1000 - . gene_id "SS.1772"; transcript_id "SS.1772.3"; exon_number "1"; cov "4239.040039"; +CM143128.1 StringTie exon 2657320 2657373 1000 - . gene_id "SS.1772"; transcript_id "SS.1772.3"; exon_number "2"; cov "777.028198"; +CM143128.1 StringTie transcript 2659479 2662691 1000 . . gene_id "SS.1773"; transcript_id "SS.1773.1"; cov "4495.229381"; FPKM "219.836943"; TPM "470.087609"; +CM143128.1 StringTie exon 2659479 2662691 1000 . . gene_id "SS.1773"; transcript_id "SS.1773.1"; exon_number "1"; cov "4495.229492"; +CM143128.1 StringTie transcript 2663025 2665732 1000 . . gene_id "SS.1774"; transcript_id "SS.1774.1"; cov "173.060192"; FPKM "8.463422"; TPM "18.097731"; +CM143128.1 StringTie exon 2663025 2665732 1000 . . gene_id "SS.1774"; transcript_id "SS.1774.1"; exon_number "1"; cov "173.060196"; +CM143128.1 StringTie transcript 2666028 2667162 1000 . . gene_id "SS.1775"; transcript_id "SS.1775.1"; cov "2143.017621"; FPKM "104.803204"; TPM "224.105590"; +CM143128.1 StringTie exon 2666028 2667162 1000 . . gene_id "SS.1775"; transcript_id "SS.1775.1"; exon_number "1"; cov "2143.017578"; +CM143128.1 StringTie transcript 2685091 2685786 1000 . . gene_id "SS.1776"; transcript_id "SS.1776.1"; cov "12.816092"; FPKM "0.626765"; TPM "1.340240"; +CM143128.1 StringTie exon 2685091 2685786 1000 . . gene_id "SS.1776"; transcript_id "SS.1776.1"; exon_number "1"; cov "12.816092"; +CM143128.1 StringTie transcript 2667552 2670707 1000 . . gene_id "SS.1777"; transcript_id "SS.1777.1"; cov "398.383397"; FPKM "19.482741"; TPM "41.660855"; +CM143128.1 StringTie exon 2667552 2670707 1000 . . gene_id "SS.1777"; transcript_id "SS.1777.1"; exon_number "1"; cov "398.383392"; +CM143128.1 StringTie transcript 2670978 2673620 1000 . . gene_id "SS.1778"; transcript_id "SS.1778.1"; cov "325.678396"; FPKM "15.927139"; TPM "34.057746"; +CM143128.1 StringTie exon 2670978 2673620 1000 . . gene_id "SS.1778"; transcript_id "SS.1778.1"; exon_number "1"; cov "325.678406"; +CM143128.1 StringTie transcript 2673906 2682945 1000 . . gene_id "SS.1779"; transcript_id "SS.1779.1"; cov "112.027102"; FPKM "5.478629"; TPM "11.715209"; +CM143128.1 StringTie exon 2673906 2682945 1000 . . gene_id "SS.1779"; transcript_id "SS.1779.1"; exon_number "1"; cov "112.027100"; +CM143128.1 StringTie transcript 2683559 2684436 1000 . . gene_id "SS.1780"; transcript_id "SS.1780.1"; cov "633.921412"; FPKM "31.001609"; TPM "66.292190"; +CM143128.1 StringTie exon 2683559 2684436 1000 . . gene_id "SS.1780"; transcript_id "SS.1780.1"; exon_number "1"; cov "633.921387"; +CM143128.1 StringTie transcript 2686625 2689301 1000 . . gene_id "SS.1781"; transcript_id "SS.1781.1"; cov "39.883078"; FPKM "1.950462"; TPM "4.170764"; +CM143128.1 StringTie exon 2686625 2689301 1000 . . gene_id "SS.1781"; transcript_id "SS.1781.1"; exon_number "1"; cov "39.883080"; +CM143128.1 StringTie transcript 2714805 2715316 1000 . . gene_id "SS.1782"; transcript_id "SS.1782.1"; cov "5.871094"; FPKM "0.287123"; TPM "0.613968"; +CM143128.1 StringTie exon 2714805 2715316 1000 . . gene_id "SS.1782"; transcript_id "SS.1782.1"; exon_number "1"; cov "5.871094"; +CM143128.1 StringTie transcript 2717276 2717556 1000 . . gene_id "SS.1783"; transcript_id "SS.1783.1"; cov "5.000000"; FPKM "0.244522"; TPM "0.522874"; +CM143128.1 StringTie exon 2717276 2717556 1000 . . gene_id "SS.1783"; transcript_id "SS.1783.1"; exon_number "1"; cov "5.000000"; +CM143128.1 StringTie transcript 2718224 2718760 1000 . . gene_id "SS.1784"; transcript_id "SS.1784.1"; cov "7.639653"; FPKM "0.373613"; TPM "0.798915"; +CM143128.1 StringTie exon 2718224 2718760 1000 . . gene_id "SS.1784"; transcript_id "SS.1784.1"; exon_number "1"; cov "7.639653"; +CM143128.1 StringTie transcript 2721220 2721475 1000 . . gene_id "SS.1785"; transcript_id "SS.1785.1"; cov "5.000000"; FPKM "0.244522"; TPM "0.522874"; +CM143128.1 StringTie exon 2721220 2721475 1000 . . gene_id "SS.1785"; transcript_id "SS.1785.1"; exon_number "1"; cov "5.000000"; +CM143128.1 StringTie transcript 2722929 2723248 1000 . . gene_id "SS.1786"; transcript_id "SS.1786.1"; cov "6.575000"; FPKM "0.321547"; TPM "0.687579"; +CM143128.1 StringTie exon 2722929 2723248 1000 . . gene_id "SS.1786"; transcript_id "SS.1786.1"; exon_number "1"; cov "6.575000"; +CM143128.1 StringTie transcript 2744144 2746826 1000 . . gene_id "SS.1787"; transcript_id "SS.1787.1"; cov "128.338637"; FPKM "6.276337"; TPM "13.420984"; +CM143128.1 StringTie exon 2744144 2746826 1000 . . gene_id "SS.1787"; transcript_id "SS.1787.1"; exon_number "1"; cov "128.338638"; +CM143128.1 StringTie transcript 2699026 2702152 1000 . . gene_id "SS.1788"; transcript_id "SS.1788.1"; cov "593.919691"; FPKM "29.045345"; TPM "62.109019"; +CM143128.1 StringTie exon 2699026 2702152 1000 . . gene_id "SS.1788"; transcript_id "SS.1788.1"; exon_number "1"; cov "593.919678"; +CM143128.1 StringTie transcript 2702567 2703272 1000 . . gene_id "SS.1789"; transcript_id "SS.1789.1"; cov "22014.199717"; FPKM "1076.593417"; TPM "2302.130023"; +CM143128.1 StringTie exon 2702567 2703272 1000 . . gene_id "SS.1789"; transcript_id "SS.1789.1"; exon_number "1"; cov "22014.199219"; +CM143128.1 StringTie transcript 2706737 2708020 1000 . . gene_id "SS.1790"; transcript_id "SS.1790.1"; cov "555.660436"; FPKM "27.174295"; TPM "58.108066"; +CM143128.1 StringTie exon 2706737 2708020 1000 . . gene_id "SS.1790"; transcript_id "SS.1790.1"; exon_number "1"; cov "555.660461"; +CM143128.1 StringTie transcript 2708177 2710827 1000 . . gene_id "SS.1791"; transcript_id "SS.1791.1"; cov "762.264051"; FPKM "37.278142"; TPM "79.713593"; +CM143128.1 StringTie exon 2708177 2710827 1000 . . gene_id "SS.1791"; transcript_id "SS.1791.1"; exon_number "1"; cov "762.264038"; +CM143128.1 StringTie transcript 2711283 2712118 1000 . . gene_id "SS.1792"; transcript_id "SS.1792.1"; cov "36.113636"; FPKM "1.766119"; TPM "3.776575"; +CM143128.1 StringTie exon 2711283 2712118 1000 . . gene_id "SS.1792"; transcript_id "SS.1792.1"; exon_number "1"; cov "36.113636"; +CM143128.1 StringTie transcript 2712523 2712727 1000 . . gene_id "SS.1793"; transcript_id "SS.1793.1"; cov "6.000000"; FPKM "0.293427"; TPM "0.627449"; +CM143128.1 StringTie exon 2712523 2712727 1000 . . gene_id "SS.1793"; transcript_id "SS.1793.1"; exon_number "1"; cov "6.000000"; +CM143128.1 StringTie transcript 2788837 2790864 1000 . . gene_id "SS.1794"; transcript_id "SS.1794.1"; cov "314.819034"; FPKM "15.396067"; TPM "32.922130"; +CM143128.1 StringTie exon 2788837 2790864 1000 . . gene_id "SS.1794"; transcript_id "SS.1794.1"; exon_number "1"; cov "314.819031"; +CM143128.1 StringTie transcript 2748129 2750572 1000 . . gene_id "SS.1795"; transcript_id "SS.1795.1"; cov "912.155483"; FPKM "44.608507"; TPM "95.388456"; +CM143128.1 StringTie exon 2748129 2750572 1000 . . gene_id "SS.1795"; transcript_id "SS.1795.1"; exon_number "1"; cov "912.155457"; +CM143128.1 StringTie transcript 2751427 2763814 1000 . . gene_id "SS.1796"; transcript_id "SS.1796.1"; cov "452.923232"; FPKM "22.149984"; TPM "47.364346"; +CM143128.1 StringTie exon 2751427 2763814 1000 . . gene_id "SS.1796"; transcript_id "SS.1796.1"; exon_number "1"; cov "452.923218"; +CM143128.1 StringTie transcript 2764464 2772319 1000 . . gene_id "SS.1797"; transcript_id "SS.1797.1"; cov "3742.798371"; FPKM "183.039681"; TPM "391.402304"; +CM143128.1 StringTie exon 2764464 2772319 1000 . . gene_id "SS.1797"; transcript_id "SS.1797.1"; exon_number "1"; cov "3742.798340"; +CM143128.1 StringTie transcript 2774056 2775729 1000 . . gene_id "SS.1798"; transcript_id "SS.1798.1"; cov "5569.226404"; FPKM "272.360229"; TPM "582.400608"; +CM143128.1 StringTie exon 2774056 2775729 1000 . . gene_id "SS.1798"; transcript_id "SS.1798.1"; exon_number "1"; cov "5569.226562"; +CM143128.1 StringTie transcript 2776904 2781692 1000 . . gene_id "SS.1799"; transcript_id "SS.1799.1"; cov "220.623930"; FPKM "10.789503"; TPM "23.071698"; +CM143128.1 StringTie exon 2776904 2781692 1000 . . gene_id "SS.1799"; transcript_id "SS.1799.1"; exon_number "1"; cov "220.623932"; +CM143128.1 StringTie transcript 2782352 2786520 1000 . . gene_id "SS.1800"; transcript_id "SS.1800.1"; cov "1775.437035"; FPKM "86.826859"; TPM "185.665932"; +CM143128.1 StringTie exon 2782352 2786520 1000 . . gene_id "SS.1800"; transcript_id "SS.1800.1"; exon_number "1"; cov "1775.437012"; +CM143128.1 StringTie transcript 2791278 2794503 1000 . . gene_id "SS.1801"; transcript_id "SS.1801.1"; cov "4938.342839"; FPKM "241.507184"; TPM "516.426100"; +CM143128.1 StringTie exon 2791278 2794503 1000 . . gene_id "SS.1801"; transcript_id "SS.1801.1"; exon_number "1"; cov "4938.342773"; +CM143128.1 StringTie transcript 2795224 2795553 1000 . . gene_id "SS.1802"; transcript_id "SS.1802.1"; cov "5.060606"; FPKM "0.247486"; TPM "0.529212"; +CM143128.1 StringTie exon 2795224 2795553 1000 . . gene_id "SS.1802"; transcript_id "SS.1802.1"; exon_number "1"; cov "5.060606"; +CM143128.1 StringTie transcript 2795964 2797393 1000 . . gene_id "SS.1803"; transcript_id "SS.1803.1"; cov "2597.336364"; FPKM "127.021435"; TPM "271.615871"; +CM143128.1 StringTie exon 2795964 2797393 1000 . . gene_id "SS.1803"; transcript_id "SS.1803.1"; exon_number "1"; cov "2597.336426"; +CM143128.1 StringTie transcript 2797789 2798880 1000 . . gene_id "SS.1804"; transcript_id "SS.1804.1"; cov "1786.300366"; FPKM "87.358125"; TPM "186.801962"; +CM143128.1 StringTie exon 2797789 2798880 1000 . . gene_id "SS.1804"; transcript_id "SS.1804.1"; exon_number "1"; cov "1786.300415"; +CM143128.1 StringTie transcript 2799190 2801860 1000 . . gene_id "SS.1805"; transcript_id "SS.1805.1"; cov "850.067765"; FPKM "41.572139"; TPM "88.895647"; +CM143128.1 StringTie exon 2799190 2801860 1000 . . gene_id "SS.1805"; transcript_id "SS.1805.1"; exon_number "1"; cov "850.067749"; +CM143128.1 StringTie transcript 2812751 2815491 1000 . . gene_id "SS.1806"; transcript_id "SS.1806.1"; cov "4086.338927"; FPKM "199.840360"; TPM "427.327981"; +CM143128.1 StringTie exon 2812751 2815491 1000 . . gene_id "SS.1806"; transcript_id "SS.1806.1"; exon_number "1"; cov "4086.338867"; +CM143128.1 StringTie transcript 2816340 2818703 1000 . . gene_id "SS.1807"; transcript_id "SS.1807.1"; cov "1832.326565"; FPKM "89.609013"; TPM "191.615142"; +CM143128.1 StringTie exon 2816340 2818703 1000 . . gene_id "SS.1807"; transcript_id "SS.1807.1"; exon_number "1"; cov "1832.326538"; +CM143128.1 StringTie transcript 2819000 2822106 1000 . . gene_id "SS.1808"; transcript_id "SS.1808.1"; cov "335.048278"; FPKM "16.385368"; TPM "35.037599"; +CM143128.1 StringTie exon 2819000 2822106 1000 . . gene_id "SS.1808"; transcript_id "SS.1808.1"; exon_number "1"; cov "335.048279"; +CM143128.1 StringTie transcript 2822620 2829300 1000 . . gene_id "SS.1809"; transcript_id "SS.1809.1"; cov "466.349274"; FPKM "22.806578"; TPM "48.768371"; +CM143128.1 StringTie exon 2822620 2829300 1000 . . gene_id "SS.1809"; transcript_id "SS.1809.1"; exon_number "1"; cov "466.349274"; +CM143128.1 StringTie transcript 2829599 2834640 1000 . . gene_id "SS.1810"; transcript_id "SS.1810.1"; cov "314.163130"; FPKM "15.363991"; TPM "32.853539"; +CM143128.1 StringTie exon 2829599 2834640 1000 . . gene_id "SS.1810"; transcript_id "SS.1810.1"; exon_number "1"; cov "314.163116"; +CM143128.1 StringTie transcript 2836313 2845486 1000 . . gene_id "SS.1811"; transcript_id "SS.1811.1"; cov "1208.860802"; FPKM "59.118732"; TPM "126.416349"; +CM143128.1 StringTie exon 2836313 2845486 1000 . . gene_id "SS.1811"; transcript_id "SS.1811.1"; exon_number "1"; cov "1208.860840"; +CM143128.1 StringTie transcript 2847954 2849926 1000 . . gene_id "SS.1812"; transcript_id "SS.1812.1"; cov "533.269640"; FPKM "26.079285"; TPM "55.766554"; +CM143128.1 StringTie exon 2847954 2849926 1000 . . gene_id "SS.1812"; transcript_id "SS.1812.1"; exon_number "1"; cov "533.269653"; +CM143128.1 StringTie transcript 2853568 2855448 1000 . . gene_id "SS.1813"; transcript_id "SS.1813.1"; cov "314.608719"; FPKM "15.385782"; TPM "32.900137"; +CM143128.1 StringTie exon 2853568 2855448 1000 . . gene_id "SS.1813"; transcript_id "SS.1813.1"; exon_number "1"; cov "314.608704"; +CM143128.1 StringTie transcript 2855800 2857409 1000 . . gene_id "SS.1814"; transcript_id "SS.1814.1"; cov "1802.567702"; FPKM "88.153671"; TPM "188.503115"; +CM143128.1 StringTie exon 2855800 2857409 1000 . . gene_id "SS.1814"; transcript_id "SS.1814.1"; exon_number "1"; cov "1802.567749"; +CM143128.1 StringTie transcript 2858240 2861826 1000 . . gene_id "SS.1815"; transcript_id "SS.1815.1"; cov "296.877056"; FPKM "14.518624"; TPM "31.045852"; +CM143128.1 StringTie exon 2858240 2861826 1000 . . gene_id "SS.1815"; transcript_id "SS.1815.1"; exon_number "1"; cov "296.877045"; +CM143128.1 StringTie transcript 2862760 2864055 1000 . . gene_id "SS.1816"; transcript_id "SS.1816.1"; cov "87.265432"; FPKM "4.267672"; TPM "9.125763"; +CM143128.1 StringTie exon 2862760 2864055 1000 . . gene_id "SS.1816"; transcript_id "SS.1816.1"; exon_number "1"; cov "87.265434"; +CM143128.1 StringTie transcript 2864851 2868434 1000 . . gene_id "SS.1817"; transcript_id "SS.1817.1"; cov "167.184152"; FPKM "8.176057"; TPM "17.483245"; +CM143128.1 StringTie exon 2864851 2868434 1000 . . gene_id "SS.1817"; transcript_id "SS.1817.1"; exon_number "1"; cov "167.184158"; +CM143128.1 StringTie transcript 2868696 2875911 1000 . . gene_id "SS.1818"; transcript_id "SS.1818.1"; cov "193.630682"; FPKM "9.469412"; TPM "20.248885"; +CM143128.1 StringTie exon 2868696 2875911 1000 . . gene_id "SS.1818"; transcript_id "SS.1818.1"; exon_number "1"; cov "193.630676"; +CM143128.1 StringTie transcript 2876273 2887311 1000 . . gene_id "SS.1819"; transcript_id "SS.1819.1"; cov "407.670894"; FPKM "19.936941"; TPM "42.632093"; +CM143128.1 StringTie exon 2876273 2887311 1000 . . gene_id "SS.1819"; transcript_id "SS.1819.1"; exon_number "1"; cov "407.670898"; +CM143128.1 StringTie transcript 2887581 2891856 1000 . . gene_id "SS.1820"; transcript_id "SS.1820.1"; cov "267.282741"; FPKM "13.071329"; TPM "27.951033"; +CM143128.1 StringTie exon 2887581 2891856 1000 . . gene_id "SS.1820"; transcript_id "SS.1820.1"; exon_number "1"; cov "267.282745"; +CM143128.1 StringTie transcript 2892377 2894134 1000 . . gene_id "SS.1821"; transcript_id "SS.1821.1"; cov "1017.098976"; FPKM "49.740716"; TPM "106.362898"; +CM143128.1 StringTie exon 2892377 2894134 1000 . . gene_id "SS.1821"; transcript_id "SS.1821.1"; exon_number "1"; cov "1017.098999"; +CM143128.1 StringTie transcript 2897556 2898981 1000 . . gene_id "SS.1822"; transcript_id "SS.1822.1"; cov "376.173913"; FPKM "18.396597"; TPM "39.338303"; +CM143128.1 StringTie exon 2897556 2898981 1000 . . gene_id "SS.1822"; transcript_id "SS.1822.1"; exon_number "1"; cov "376.173920"; +CM143128.1 StringTie transcript 2903276 2907232 1000 . . gene_id "SS.1823"; transcript_id "SS.1823.1"; cov "1266.251959"; FPKM "61.925418"; TPM "132.418016"; +CM143128.1 StringTie exon 2903276 2907232 1000 . . gene_id "SS.1823"; transcript_id "SS.1823.1"; exon_number "1"; cov "1266.251953"; +CM143128.1 StringTie transcript 2907475 2908359 1000 . . gene_id "SS.1824"; transcript_id "SS.1824.1"; cov "1638.192090"; FPKM "80.114964"; TPM "171.313572"; +CM143128.1 StringTie exon 2907475 2908359 1000 . . gene_id "SS.1824"; transcript_id "SS.1824.1"; exon_number "1"; cov "1638.192139"; +CM143128.1 StringTie transcript 2909306 2916154 1000 . . gene_id "SS.1825"; transcript_id "SS.1825.1"; cov "334.039860"; FPKM "16.336052"; TPM "34.932144"; +CM143128.1 StringTie exon 2909306 2916154 1000 . . gene_id "SS.1825"; transcript_id "SS.1825.1"; exon_number "1"; cov "334.039856"; +CM143128.1 StringTie transcript 2916472 2919644 1000 . . gene_id "SS.1826"; transcript_id "SS.1826.1"; cov "914.763000"; FPKM "44.736027"; TPM "95.661137"; +CM143128.1 StringTie exon 2916472 2919644 1000 . . gene_id "SS.1826"; transcript_id "SS.1826.1"; exon_number "1"; cov "914.763000"; +CM143128.1 StringTie transcript 2920795 2923376 1000 . . gene_id "SS.1827"; transcript_id "SS.1827.1"; cov "910.751743"; FPKM "44.539858"; TPM "95.241660"; +CM143128.1 StringTie exon 2920795 2923376 1000 . . gene_id "SS.1827"; transcript_id "SS.1827.1"; exon_number "1"; cov "910.751770"; +CM143128.1 StringTie transcript 2923643 2926721 1000 . . gene_id "SS.1828"; transcript_id "SS.1828.1"; cov "1156.917181"; FPKM "56.578456"; TPM "120.984356"; +CM143128.1 StringTie exon 2923643 2926721 1000 . . gene_id "SS.1828"; transcript_id "SS.1828.1"; exon_number "1"; cov "1156.917236"; +CM143128.1 StringTie transcript 2930065 2935327 1000 . . gene_id "SS.1829"; transcript_id "SS.1829.1"; cov "675.822915"; FPKM "33.050781"; TPM "70.674031"; +CM143128.1 StringTie exon 2930065 2935327 1000 . . gene_id "SS.1829"; transcript_id "SS.1829.1"; exon_number "1"; cov "675.822937"; +CM143128.1 StringTie transcript 2935654 2940496 1000 . . gene_id "SS.1830"; transcript_id "SS.1830.1"; cov "645.493083"; FPKM "31.567516"; TPM "67.502295"; +CM143128.1 StringTie exon 2935654 2940496 1000 . . gene_id "SS.1830"; transcript_id "SS.1830.1"; exon_number "1"; cov "645.493103"; +CM143128.1 StringTie transcript 2940991 2948180 1000 . . gene_id "SS.1831"; transcript_id "SS.1831.1"; cov "148.049791"; FPKM "7.240301"; TPM "15.482274"; +CM143128.1 StringTie exon 2940991 2948180 1000 . . gene_id "SS.1831"; transcript_id "SS.1831.1"; exon_number "1"; cov "148.049789"; +CM143128.1 StringTie transcript 2948521 2956608 1000 . . gene_id "SS.1832"; transcript_id "SS.1832.1"; cov "217.747651"; FPKM "10.648840"; TPM "22.770912"; +CM143128.1 StringTie exon 2948521 2956608 1000 . . gene_id "SS.1832"; transcript_id "SS.1832.1"; exon_number "1"; cov "217.747650"; +CM143128.1 StringTie transcript 2957798 2962686 1000 + . gene_id "SS.1833"; transcript_id "SS.1833.1"; cov "176.454999"; FPKM "8.629443"; TPM "18.452742"; +CM143128.1 StringTie exon 2957798 2957928 1000 + . gene_id "SS.1833"; transcript_id "SS.1833.1"; exon_number "1"; cov "86.801529"; +CM143128.1 StringTie exon 2958007 2962686 1000 + . gene_id "SS.1833"; transcript_id "SS.1833.1"; exon_number "2"; cov "178.964523"; +CM143128.1 StringTie transcript 3004274 3004907 1000 - . gene_id "SS.1834"; transcript_id "SS.1834.1"; cov "1694.245217"; FPKM "82.856214"; TPM "177.175316"; +CM143128.1 StringTie exon 3004274 3004725 1000 - . gene_id "SS.1834"; transcript_id "SS.1834.1"; exon_number "1"; cov "1840.028809"; +CM143128.1 StringTie exon 3004785 3004907 1000 - . gene_id "SS.1834"; transcript_id "SS.1834.1"; exon_number "2"; cov "1158.520386"; +CM143128.1 StringTie transcript 3005119 3007964 1000 . . gene_id "SS.1835"; transcript_id "SS.1835.1"; cov "300.809557"; FPKM "14.710941"; TPM "31.457092"; +CM143128.1 StringTie exon 3005119 3007964 1000 . . gene_id "SS.1835"; transcript_id "SS.1835.1"; exon_number "1"; cov "300.809570"; +CM143128.1 StringTie transcript 2966586 2972016 1000 . . gene_id "SS.1836"; transcript_id "SS.1836.1"; cov "1298.480759"; FPKM "63.501551"; TPM "135.788336"; +CM143128.1 StringTie exon 2966586 2972016 1000 . . gene_id "SS.1836"; transcript_id "SS.1836.1"; exon_number "1"; cov "1298.480713"; +CM143128.1 StringTie transcript 2979772 2985517 1000 . . gene_id "SS.1837"; transcript_id "SS.1837.1"; cov "520.907849"; FPKM "25.474738"; TPM "54.473822"; +CM143128.1 StringTie exon 2979772 2985517 1000 . . gene_id "SS.1837"; transcript_id "SS.1837.1"; exon_number "1"; cov "520.907837"; +CM143128.1 StringTie transcript 2988089 2988964 1000 . . gene_id "SS.1838"; transcript_id "SS.1838.1"; cov "1426.350457"; FPKM "69.754955"; TPM "149.160281"; +CM143128.1 StringTie exon 2988089 2988964 1000 . . gene_id "SS.1838"; transcript_id "SS.1838.1"; exon_number "1"; cov "1426.350464"; +CM143128.1 StringTie transcript 2989731 2991787 1000 . . gene_id "SS.1839"; transcript_id "SS.1839.1"; cov "740.436558"; FPKM "36.210679"; TPM "77.430988"; +CM143128.1 StringTie exon 2989731 2991787 1000 . . gene_id "SS.1839"; transcript_id "SS.1839.1"; exon_number "1"; cov "740.436584"; +CM143128.1 StringTie transcript 2992236 2993468 1000 . . gene_id "SS.1840"; transcript_id "SS.1840.1"; cov "3626.201135"; FPKM "177.337551"; TPM "379.209175"; +CM143128.1 StringTie exon 2992236 2993468 1000 . . gene_id "SS.1840"; transcript_id "SS.1840.1"; exon_number "1"; cov "3626.201172"; +CM143128.1 StringTie transcript 2994277 2995158 1000 . . gene_id "SS.1841"; transcript_id "SS.1841.1"; cov "25389.764172"; FPKM "1241.673707"; TPM "2655.128923"; +CM143128.1 StringTie exon 2994277 2995158 1000 . . gene_id "SS.1841"; transcript_id "SS.1841.1"; exon_number "1"; cov "25389.763672"; +CM143128.1 StringTie transcript 2995562 2996601 1000 . . gene_id "SS.1842"; transcript_id "SS.1842.1"; cov "1685.376923"; FPKM "82.422515"; TPM "176.247916"; +CM143128.1 StringTie exon 2995562 2996601 1000 . . gene_id "SS.1842"; transcript_id "SS.1842.1"; exon_number "1"; cov "1685.376953"; +CM143128.1 StringTie transcript 2996897 2998056 1000 . . gene_id "SS.1843"; transcript_id "SS.1843.1"; cov "2592.083621"; FPKM "126.764552"; TPM "271.066566"; +CM143128.1 StringTie exon 2996897 2998056 1000 . . gene_id "SS.1843"; transcript_id "SS.1843.1"; exon_number "1"; cov "2592.083740"; +CM143128.1 StringTie transcript 2998344 3001233 1000 . . gene_id "SS.1844"; transcript_id "SS.1844.1"; cov "287.774048"; FPKM "14.073446"; TPM "30.093907"; +CM143128.1 StringTie exon 2998344 3001233 1000 . . gene_id "SS.1844"; transcript_id "SS.1844.1"; exon_number "1"; cov "287.774048"; +CM143128.1 StringTie transcript 3019554 3020035 1000 . . gene_id "SS.1845"; transcript_id "SS.1845.1"; cov "11.852697"; FPKM "0.579650"; TPM "1.239493"; +CM143128.1 StringTie exon 3019554 3020035 1000 . . gene_id "SS.1845"; transcript_id "SS.1845.1"; exon_number "1"; cov "11.852697"; +CM143128.1 StringTie transcript 3008345 3011516 1000 . . gene_id "SS.1846"; transcript_id "SS.1846.1"; cov "336.124212"; FPKM "16.437986"; TPM "35.150114"; +CM143128.1 StringTie exon 3008345 3011516 1000 . . gene_id "SS.1846"; transcript_id "SS.1846.1"; exon_number "1"; cov "336.124207"; +CM143128.1 StringTie transcript 3011822 3018567 1000 . . gene_id "SS.1847"; transcript_id "SS.1847.1"; cov "256.621257"; FPKM "12.549934"; TPM "26.836111"; +CM143128.1 StringTie exon 3011822 3018567 1000 . . gene_id "SS.1847"; transcript_id "SS.1847.1"; exon_number "1"; cov "256.621246"; +CM143128.1 StringTie transcript 3020947 3027449 1000 . . gene_id "SS.1848"; transcript_id "SS.1848.1"; cov "454.705828"; FPKM "22.237161"; TPM "47.550760"; +CM143128.1 StringTie exon 3020947 3027449 1000 . . gene_id "SS.1848"; transcript_id "SS.1848.1"; exon_number "1"; cov "454.705841"; +CM143128.1 StringTie transcript 3028568 3035236 1000 + . gene_id "SS.1849"; transcript_id "SS.1849.1"; cov "917.062004"; FPKM "44.848458"; TPM "95.901554"; +CM143128.1 StringTie exon 3028568 3028651 1000 + . gene_id "SS.1849"; transcript_id "SS.1849.1"; exon_number "1"; cov "355.666656"; +CM143128.1 StringTie exon 3028765 3035236 1000 + . gene_id "SS.1849"; transcript_id "SS.1849.1"; exon_number "2"; cov "924.348328"; +CM143128.1 StringTie transcript 3032631 3035236 1000 . . gene_id "SS.1850"; transcript_id "SS.1850.1"; cov "3795.405219"; FPKM "185.612392"; TPM "396.903654"; +CM143128.1 StringTie exon 3032631 3035236 1000 . . gene_id "SS.1850"; transcript_id "SS.1850.1"; exon_number "1"; cov "3795.405273"; +CM143128.1 StringTie transcript 3046081 3047178 1000 + . gene_id "SS.1851"; transcript_id "SS.1851.1"; cov "1461.430484"; FPKM "71.470526"; TPM "152.828767"; +CM143128.1 StringTie exon 3046081 3046197 1000 + . gene_id "SS.1851"; transcript_id "SS.1851.1"; exon_number "1"; cov "194.965805"; +CM143128.1 StringTie exon 3046325 3047178 1000 + . gene_id "SS.1851"; transcript_id "SS.1851.1"; exon_number "2"; cov "1634.939087"; +CM143128.1 StringTie transcript 3047519 3048350 1000 . . gene_id "SS.1852"; transcript_id "SS.1852.1"; cov "6336.835337"; FPKM "309.899760"; TPM "662.673141"; +CM143128.1 StringTie exon 3047519 3048350 1000 . . gene_id "SS.1852"; transcript_id "SS.1852.1"; exon_number "1"; cov "6336.835449"; +CM143128.1 StringTie transcript 3048619 3053752 1000 . . gene_id "SS.1853"; transcript_id "SS.1853.1"; cov "964.029996"; FPKM "47.145404"; TPM "100.813222"; +CM143128.1 StringTie exon 3048619 3053752 1000 . . gene_id "SS.1853"; transcript_id "SS.1853.1"; exon_number "1"; cov "964.029968"; +CM143128.1 StringTie transcript 3054305 3063576 1000 . . gene_id "SS.1854"; transcript_id "SS.1854.1"; cov "816.652826"; FPKM "39.937998"; TPM "85.401287"; +CM143128.1 StringTie exon 3054305 3063576 1000 . . gene_id "SS.1854"; transcript_id "SS.1854.1"; exon_number "1"; cov "816.652832"; +CM143128.1 StringTie transcript 3063900 3066069 1000 . . gene_id "SS.1855"; transcript_id "SS.1855.1"; cov "47.457604"; FPKM "2.320890"; TPM "4.962868"; +CM143128.1 StringTie exon 3063900 3066069 1000 . . gene_id "SS.1855"; transcript_id "SS.1855.1"; exon_number "1"; cov "47.457603"; +CM143128.1 StringTie transcript 3066336 3069501 1000 . . gene_id "SS.1856"; transcript_id "SS.1856.1"; cov "311.267530"; FPKM "15.222383"; TPM "32.550732"; +CM143128.1 StringTie exon 3066336 3069501 1000 . . gene_id "SS.1856"; transcript_id "SS.1856.1"; exon_number "1"; cov "311.267517"; +CM143128.1 StringTie transcript 3069925 3071383 1000 . . gene_id "SS.1857"; transcript_id "SS.1857.1"; cov "552.755312"; FPKM "27.032222"; TPM "57.804263"; +CM143128.1 StringTie exon 3069925 3071383 1000 . . gene_id "SS.1857"; transcript_id "SS.1857.1"; exon_number "1"; cov "552.755310"; +CM143128.1 StringTie transcript 3071808 3072874 1000 . . gene_id "SS.1858"; transcript_id "SS.1858.1"; cov "376.434864"; FPKM "18.409359"; TPM "39.365592"; +CM143128.1 StringTie exon 3071808 3072874 1000 . . gene_id "SS.1858"; transcript_id "SS.1858.1"; exon_number "1"; cov "376.434875"; +CM143128.1 StringTie transcript 3073216 3075592 1000 . . gene_id "SS.1859"; transcript_id "SS.1859.1"; cov "207.002103"; FPKM "10.123334"; TPM "21.647199"; +CM143128.1 StringTie exon 3073216 3075592 1000 . . gene_id "SS.1859"; transcript_id "SS.1859.1"; exon_number "1"; cov "207.002106"; +CM143128.1 StringTie transcript 3075855 3078395 1000 . . gene_id "SS.1860"; transcript_id "SS.1860.1"; cov "121.869736"; FPKM "5.959978"; TPM "12.744500"; +CM143128.1 StringTie exon 3075855 3078395 1000 . . gene_id "SS.1860"; transcript_id "SS.1860.1"; exon_number "1"; cov "121.869736"; +CM143128.1 StringTie transcript 3078704 3080606 1000 . . gene_id "SS.1861"; transcript_id "SS.1861.1"; cov "149.768786"; FPKM "7.324368"; TPM "15.662037"; +CM143128.1 StringTie exon 3078704 3080606 1000 . . gene_id "SS.1861"; transcript_id "SS.1861.1"; exon_number "1"; cov "149.768784"; +CM143128.1 StringTie transcript 3080895 3084074 1000 . . gene_id "SS.1862"; transcript_id "SS.1862.1"; cov "520.391195"; FPKM "25.449471"; TPM "54.419793"; +CM143128.1 StringTie exon 3080895 3084074 1000 . . gene_id "SS.1862"; transcript_id "SS.1862.1"; exon_number "1"; cov "520.391174"; +CM143128.1 StringTie transcript 3088475 3089024 1000 . . gene_id "SS.1863"; transcript_id "SS.1863.1"; cov "7.085455"; FPKM "0.346511"; TPM "0.740960"; +CM143128.1 StringTie exon 3088475 3089024 1000 . . gene_id "SS.1863"; transcript_id "SS.1863.1"; exon_number "1"; cov "7.085454"; +CM143128.1 StringTie transcript 3085537 3088137 1000 . . gene_id "SS.1864"; transcript_id "SS.1864.1"; cov "640.595925"; FPKM "31.328023"; TPM "66.990176"; +CM143128.1 StringTie exon 3085537 3088137 1000 . . gene_id "SS.1864"; transcript_id "SS.1864.1"; exon_number "1"; cov "640.595947"; +CM143128.1 StringTie transcript 3089682 3093592 1000 . . gene_id "SS.1865"; transcript_id "SS.1865.1"; cov "58.203784"; FPKM "2.846427"; TPM "6.086648"; +CM143128.1 StringTie exon 3089682 3093592 1000 . . gene_id "SS.1865"; transcript_id "SS.1865.1"; exon_number "1"; cov "58.203785"; +CM143128.1 StringTie transcript 3094308 3094807 1000 . . gene_id "SS.1866"; transcript_id "SS.1866.1"; cov "5.694000"; FPKM "0.278462"; TPM "0.595449"; +CM143128.1 StringTie exon 3094308 3094807 1000 . . gene_id "SS.1866"; transcript_id "SS.1866.1"; exon_number "1"; cov "5.694000"; +CM143128.1 StringTie transcript 3095097 3095653 1000 . . gene_id "SS.1867"; transcript_id "SS.1867.1"; cov "12.843806"; FPKM "0.628120"; TPM "1.343138"; +CM143128.1 StringTie exon 3095097 3095653 1000 . . gene_id "SS.1867"; transcript_id "SS.1867.1"; exon_number "1"; cov "12.843806"; +CM143128.1 StringTie transcript 3096008 3096630 1000 . . gene_id "SS.1868"; transcript_id "SS.1868.1"; cov "5.536116"; FPKM "0.270741"; TPM "0.578938"; +CM143128.1 StringTie exon 3096008 3096630 1000 . . gene_id "SS.1868"; transcript_id "SS.1868.1"; exon_number "1"; cov "5.536116"; +CM143128.1 StringTie transcript 3097949 3102865 1000 . . gene_id "SS.1869"; transcript_id "SS.1869.1"; cov "1834.748424"; FPKM "89.727453"; TPM "191.868407"; +CM143128.1 StringTie exon 3097949 3102865 1000 . . gene_id "SS.1869"; transcript_id "SS.1869.1"; exon_number "1"; cov "1834.748413"; +CM143128.1 StringTie transcript 3104038 3105810 1000 . . gene_id "SS.1870"; transcript_id "SS.1870.1"; cov "45.556617"; FPKM "2.227924"; TPM "4.764073"; +CM143128.1 StringTie exon 3104038 3105810 1000 . . gene_id "SS.1870"; transcript_id "SS.1870.1"; exon_number "1"; cov "45.556618"; +CM143128.1 StringTie transcript 3104038 3105810 1000 + . gene_id "SS.1871"; transcript_id "SS.1871.1"; cov "18.251412"; FPKM "0.892576"; TPM "1.908637"; +CM143128.1 StringTie exon 3104038 3104350 1000 + . gene_id "SS.1871"; transcript_id "SS.1871.1"; exon_number "1"; cov "14.577880"; +CM143128.1 StringTie exon 3104445 3105810 1000 + . gene_id "SS.1871"; transcript_id "SS.1871.1"; exon_number "2"; cov "19.093151"; +CM143128.1 StringTie transcript 3108322 3109418 1000 . . gene_id "SS.1872"; transcript_id "SS.1872.1"; cov "321.074749"; FPKM "15.702000"; TPM "33.576320"; +CM143128.1 StringTie exon 3108322 3109418 1000 . . gene_id "SS.1872"; transcript_id "SS.1872.1"; exon_number "1"; cov "321.074738"; +CM143128.1 StringTie transcript 3109729 3113067 1000 . . gene_id "SS.1873"; transcript_id "SS.1873.1"; cov "66.045803"; FPKM "3.229937"; TPM "6.906725"; +CM143128.1 StringTie exon 3109729 3113067 1000 . . gene_id "SS.1873"; transcript_id "SS.1873.1"; exon_number "1"; cov "66.045807"; +CM143128.1 StringTie transcript 3113693 3115074 1000 . . gene_id "SS.1874"; transcript_id "SS.1874.1"; cov "12.438992"; FPKM "0.608323"; TPM "1.300805"; +CM143128.1 StringTie exon 3113693 3115074 1000 . . gene_id "SS.1874"; transcript_id "SS.1874.1"; exon_number "1"; cov "12.438993"; +CM143128.1 StringTie transcript 3117492 3121442 1000 . . gene_id "SS.1875"; transcript_id "SS.1875.1"; cov "131.207289"; FPKM "6.416627"; TPM "13.720973"; +CM143128.1 StringTie exon 3117492 3121442 1000 . . gene_id "SS.1875"; transcript_id "SS.1875.1"; exon_number "1"; cov "131.207291"; +CM143128.1 StringTie transcript 3121834 3127149 1000 . . gene_id "SS.1876"; transcript_id "SS.1876.1"; cov "433.624342"; FPKM "21.206181"; TPM "45.346169"; +CM143128.1 StringTie exon 3121834 3127149 1000 . . gene_id "SS.1876"; transcript_id "SS.1876.1"; exon_number "1"; cov "433.624329"; +CM143128.1 StringTie transcript 3127554 3129837 1000 . . gene_id "SS.1877"; transcript_id "SS.1877.1"; cov "466.338004"; FPKM "22.806027"; TPM "48.767193"; +CM143128.1 StringTie exon 3127554 3129837 1000 . . gene_id "SS.1877"; transcript_id "SS.1877.1"; exon_number "1"; cov "466.338013"; +CM143128.1 StringTie transcript 3131308 3133476 1000 . . gene_id "SS.1878"; transcript_id "SS.1878.1"; cov "1230.038728"; FPKM "60.154428"; TPM "128.631026"; +CM143128.1 StringTie exon 3131308 3133476 1000 . . gene_id "SS.1878"; transcript_id "SS.1878.1"; exon_number "1"; cov "1230.038696"; +CM143128.1 StringTie transcript 3134868 3137184 1000 . . gene_id "SS.1879"; transcript_id "SS.1879.1"; cov "59.158826"; FPKM "2.893133"; TPM "6.186521"; +CM143128.1 StringTie exon 3134868 3137184 1000 . . gene_id "SS.1879"; transcript_id "SS.1879.1"; exon_number "1"; cov "59.158825"; +CM143128.1 StringTie transcript 3138055 3138295 1000 . . gene_id "SS.1880"; transcript_id "SS.1880.1"; cov "6.000000"; FPKM "0.293427"; TPM "0.627449"; +CM143128.1 StringTie exon 3138055 3138295 1000 . . gene_id "SS.1880"; transcript_id "SS.1880.1"; exon_number "1"; cov "6.000000"; +CM143128.1 StringTie transcript 3139035 3140283 1000 . . gene_id "SS.1881"; transcript_id "SS.1881.1"; cov "95.489191"; FPKM "4.669851"; TPM "9.985761"; +CM143128.1 StringTie exon 3139035 3140283 1000 . . gene_id "SS.1881"; transcript_id "SS.1881.1"; exon_number "1"; cov "95.489189"; +CM143128.1 StringTie transcript 3140650 3141410 1000 . . gene_id "SS.1882"; transcript_id "SS.1882.1"; cov "21.901445"; FPKM "1.071079"; TPM "2.290339"; +CM143128.1 StringTie exon 3140650 3141410 1000 . . gene_id "SS.1882"; transcript_id "SS.1882.1"; exon_number "1"; cov "21.901445"; +CM143128.1 StringTie transcript 3142865 3144145 1000 . . gene_id "SS.1883"; transcript_id "SS.1883.1"; cov "9.694770"; FPKM "0.474118"; TPM "1.013828"; +CM143128.1 StringTie exon 3142865 3144145 1000 . . gene_id "SS.1883"; transcript_id "SS.1883.1"; exon_number "1"; cov "9.694770"; +CM143128.1 StringTie transcript 3144857 3145181 1000 . . gene_id "SS.1884"; transcript_id "SS.1884.1"; cov "24.713846"; FPKM "1.208618"; TPM "2.584445"; +CM143128.1 StringTie exon 3144857 3145181 1000 . . gene_id "SS.1884"; transcript_id "SS.1884.1"; exon_number "1"; cov "24.713846"; +CM143128.1 StringTie transcript 3145440 3145739 1000 . . gene_id "SS.1885"; transcript_id "SS.1885.1"; cov "13.820000"; FPKM "0.675860"; TPM "1.445223"; +CM143128.1 StringTie exon 3145440 3145739 1000 . . gene_id "SS.1885"; transcript_id "SS.1885.1"; exon_number "1"; cov "13.820000"; +CM143128.1 StringTie transcript 3148648 3149753 1000 . . gene_id "SS.1886"; transcript_id "SS.1886.1"; cov "25.212477"; FPKM "1.233004"; TPM "2.636589"; +CM143128.1 StringTie exon 3148648 3149753 1000 . . gene_id "SS.1886"; transcript_id "SS.1886.1"; exon_number "1"; cov "25.212477"; +CM143128.1 StringTie transcript 3150545 3151229 1000 . . gene_id "SS.1887"; transcript_id "SS.1887.1"; cov "10.683212"; FPKM "0.522457"; TPM "1.117195"; +CM143128.1 StringTie exon 3150545 3151229 1000 . . gene_id "SS.1887"; transcript_id "SS.1887.1"; exon_number "1"; cov "10.683211"; +CM143128.1 StringTie transcript 3158509 3159574 1000 . . gene_id "SS.1888"; transcript_id "SS.1888.1"; cov "10.809568"; FPKM "0.528637"; TPM "1.130408"; +CM143128.1 StringTie exon 3158509 3159574 1000 . . gene_id "SS.1888"; transcript_id "SS.1888.1"; exon_number "1"; cov "10.809568"; +CM143128.1 StringTie transcript 3160928 3161355 1000 . . gene_id "SS.1889"; transcript_id "SS.1889.1"; cov "32.829439"; FPKM "1.605507"; TPM "3.433131"; +CM143128.1 StringTie exon 3160928 3161355 1000 . . gene_id "SS.1889"; transcript_id "SS.1889.1"; exon_number "1"; cov "32.829441"; +CM143128.1 StringTie transcript 3161645 3162288 1000 . . gene_id "SS.1890"; transcript_id "SS.1890.1"; cov "16.920807"; FPKM "0.827504"; TPM "1.769490"; +CM143128.1 StringTie exon 3161645 3162288 1000 . . gene_id "SS.1890"; transcript_id "SS.1890.1"; exon_number "1"; cov "16.920807"; +CM143128.1 StringTie transcript 3162503 3162775 1000 . . gene_id "SS.1891"; transcript_id "SS.1891.1"; cov "6.000000"; FPKM "0.293427"; TPM "0.627449"; +CM143128.1 StringTie exon 3162503 3162775 1000 . . gene_id "SS.1891"; transcript_id "SS.1891.1"; exon_number "1"; cov "6.000000"; +CM143128.1 StringTie transcript 3163255 3163504 1000 . . gene_id "SS.1892"; transcript_id "SS.1892.1"; cov "4.956000"; FPKM "0.242371"; TPM "0.518273"; +CM143128.1 StringTie exon 3163255 3163504 1000 . . gene_id "SS.1892"; transcript_id "SS.1892.1"; exon_number "1"; cov "4.956000"; +CM143128.1 StringTie transcript 3164470 3164782 1000 . . gene_id "SS.1893"; transcript_id "SS.1893.1"; cov "5.571885"; FPKM "0.272490"; TPM "0.582679"; +CM143128.1 StringTie exon 3164470 3164782 1000 . . gene_id "SS.1893"; transcript_id "SS.1893.1"; exon_number "1"; cov "5.571885"; +CM143128.1 StringTie transcript 3165076 3165413 1000 . . gene_id "SS.1894"; transcript_id "SS.1894.1"; cov "7.130178"; FPKM "0.348698"; TPM "0.745637"; +CM143128.1 StringTie exon 3165076 3165413 1000 . . gene_id "SS.1894"; transcript_id "SS.1894.1"; exon_number "1"; cov "7.130177"; +CM143128.1 StringTie transcript 3165720 3166025 1000 . . gene_id "SS.1895"; transcript_id "SS.1895.1"; cov "4.816993"; FPKM "0.235573"; TPM "0.503736"; +CM143128.1 StringTie exon 3165720 3166025 1000 . . gene_id "SS.1895"; transcript_id "SS.1895.1"; exon_number "1"; cov "4.816993"; +CM143128.1 StringTie transcript 3166304 3169109 1000 . . gene_id "SS.1896"; transcript_id "SS.1896.1"; cov "18.937121"; FPKM "0.926110"; TPM "1.980345"; +CM143128.1 StringTie exon 3166304 3169109 1000 . . gene_id "SS.1896"; transcript_id "SS.1896.1"; exon_number "1"; cov "18.937120"; +CM143129.1 StringTie transcript 41987 47583 1000 . . gene_id "SS.1897"; transcript_id "SS.1897.1"; cov "464.822584"; FPKM "22.731916"; TPM "48.608718"; +CM143129.1 StringTie exon 41987 47583 1000 . . gene_id "SS.1897"; transcript_id "SS.1897.1"; exon_number "1"; cov "464.822571"; +CM143129.1 StringTie transcript 48179 48454 1000 . . gene_id "SS.1898"; transcript_id "SS.1898.1"; cov "9.880435"; FPKM "0.483198"; TPM "1.033244"; +CM143129.1 StringTie exon 48179 48454 1000 . . gene_id "SS.1898"; transcript_id "SS.1898.1"; exon_number "1"; cov "9.880435"; +CM143129.1 StringTie transcript 49925 52071 1000 . . gene_id "SS.1899"; transcript_id "SS.1899.1"; cov "1044.572892"; FPKM "51.084314"; TPM "109.235977"; +CM143129.1 StringTie exon 49925 52071 1000 . . gene_id "SS.1899"; transcript_id "SS.1899.1"; exon_number "1"; cov "1044.572876"; +CM143129.1 StringTie transcript 52438 53197 1000 . . gene_id "SS.1900"; transcript_id "SS.1900.1"; cov "620.482895"; FPKM "30.344405"; TPM "64.886860"; +CM143129.1 StringTie exon 52438 53197 1000 . . gene_id "SS.1900"; transcript_id "SS.1900.1"; exon_number "1"; cov "620.482910"; +CM143129.1 StringTie transcript 738 1122 1000 . . gene_id "SS.1901"; transcript_id "SS.1901.1"; cov "255.811161"; FPKM "12.510317"; TPM "26.751395"; +CM143129.1 StringTie exon 738 1122 1000 . . gene_id "SS.1901"; transcript_id "SS.1901.1"; exon_number "1"; cov "255.811157"; +CM143129.1 StringTie transcript 5943 18863 1000 + . gene_id "SS.1902"; transcript_id "SS.1902.1"; cov "28.780602"; FPKM "1.407501"; TPM "3.009725"; +CM143129.1 StringTie exon 5943 6118 1000 + . gene_id "SS.1902"; transcript_id "SS.1902.1"; exon_number "1"; cov "6.907581"; +CM143129.1 StringTie exon 11104 18863 1000 + . gene_id "SS.1902"; transcript_id "SS.1902.1"; exon_number "2"; cov "29.276691"; +CM143129.1 StringTie transcript 5969 11276 1000 . . gene_id "SS.1903"; transcript_id "SS.1903.1"; cov "30.375006"; FPKM "1.485474"; TPM "3.176459"; +CM143129.1 StringTie exon 5969 11276 1000 . . gene_id "SS.1903"; transcript_id "SS.1903.1"; exon_number "1"; cov "30.375006"; +CM143129.1 StringTie transcript 19318 32771 1000 . . gene_id "SS.1904"; transcript_id "SS.1904.1"; cov "256.777891"; FPKM "12.557594"; TPM "26.852491"; +CM143129.1 StringTie exon 19318 32771 1000 . . gene_id "SS.1904"; transcript_id "SS.1904.1"; exon_number "1"; cov "256.777893"; +CM143129.1 StringTie transcript 34456 37520 1000 . . gene_id "SS.1905"; transcript_id "SS.1905.1"; cov "42729.459054"; FPKM "2089.662805"; TPM "4468.423646"; +CM143129.1 StringTie exon 34456 37520 1000 . . gene_id "SS.1905"; transcript_id "SS.1905.1"; exon_number "1"; cov "42729.460938"; +CM143129.1 StringTie transcript 56155 56597 1000 . . gene_id "SS.1906"; transcript_id "SS.1906.1"; cov "382.769117"; FPKM "18.719132"; TPM "40.027995"; +CM143129.1 StringTie exon 56155 56597 1000 . . gene_id "SS.1906"; transcript_id "SS.1906.1"; exon_number "1"; cov "382.769104"; +CM143129.1 StringTie transcript 57464 57968 1000 . . gene_id "SS.1907"; transcript_id "SS.1907.1"; cov "1849.740842"; FPKM "90.460650"; TPM "193.436236"; +CM143129.1 StringTie exon 57464 57968 1000 . . gene_id "SS.1907"; transcript_id "SS.1907.1"; exon_number "1"; cov "1849.740845"; +CM143129.1 StringTie transcript 60901 63062 1000 . . gene_id "SS.1908"; transcript_id "SS.1908.1"; cov "24702.190564"; FPKM "1208.048264"; TPM "2583.226066"; +CM143129.1 StringTie exon 60901 63062 1000 . . gene_id "SS.1908"; transcript_id "SS.1908.1"; exon_number "1"; cov "24702.191406"; +CM143129.1 StringTie transcript 65519 70307 1000 . . gene_id "SS.1909"; transcript_id "SS.1909.1"; cov "840.754437"; FPKM "41.116675"; TPM "87.921708"; +CM143129.1 StringTie exon 65519 70307 1000 . . gene_id "SS.1909"; transcript_id "SS.1909.1"; exon_number "1"; cov "840.754456"; +CM143129.1 StringTie transcript 77724 79527 1000 . . gene_id "SS.1910"; transcript_id "SS.1910.1"; cov "828.667960"; FPKM "40.525592"; TPM "86.657767"; +CM143129.1 StringTie exon 77724 79527 1000 . . gene_id "SS.1910"; transcript_id "SS.1910.1"; exon_number "1"; cov "828.667969"; +CM143129.1 StringTie transcript 84914 86199 1000 . . gene_id "SS.1911"; transcript_id "SS.1911.1"; cov "97693.766719"; FPKM "4777.664756"; TPM "10216.303855"; +CM143129.1 StringTie exon 84914 86199 1000 . . gene_id "SS.1911"; transcript_id "SS.1911.1"; exon_number "1"; cov "97693.765625"; +CM143129.1 StringTie transcript 87247 89206 1000 . . gene_id "SS.1912"; transcript_id "SS.1912.1"; cov "3073.065306"; FPKM "150.286720"; TPM "321.365119"; +CM143129.1 StringTie exon 87247 89206 1000 . . gene_id "SS.1912"; transcript_id "SS.1912.1"; exon_number "1"; cov "3073.065186"; +CM143129.1 StringTie transcript 95187 96659 1000 . . gene_id "SS.1913"; transcript_id "SS.1913.1"; cov "809.177868"; FPKM "39.572439"; TPM "84.619595"; +CM143129.1 StringTie exon 95187 96659 1000 . . gene_id "SS.1913"; transcript_id "SS.1913.1"; exon_number "1"; cov "809.177856"; +CM143129.1 StringTie transcript 98237 100446 1000 . . gene_id "SS.1914"; transcript_id "SS.1914.1"; cov "705.059729"; FPKM "34.480593"; TPM "73.731464"; +CM143129.1 StringTie exon 98237 100446 1000 . . gene_id "SS.1914"; transcript_id "SS.1914.1"; exon_number "1"; cov "705.059753"; +CM143129.1 StringTie transcript 107420 111010 1000 + . gene_id "SS.1915"; transcript_id "SS.1915.1"; cov "1116.286650"; FPKM "54.591440"; TPM "116.735427"; +CM143129.1 StringTie exon 107420 107655 1000 + . gene_id "SS.1915"; transcript_id "SS.1915.1"; exon_number "1"; cov "569.949158"; +CM143129.1 StringTie exon 107734 111010 1000 + . gene_id "SS.1915"; transcript_id "SS.1915.1"; exon_number "2"; cov "1155.632324"; +CM143129.1 StringTie transcript 113923 119691 1000 . . gene_id "SS.1916"; transcript_id "SS.1916.1"; cov "363.305772"; FPKM "17.767287"; TPM "37.992620"; +CM143129.1 StringTie exon 113923 119691 1000 . . gene_id "SS.1916"; transcript_id "SS.1916.1"; exon_number "1"; cov "363.305786"; +CM143129.1 StringTie transcript 120094 123285 1000 + . gene_id "SS.1917"; transcript_id "SS.1917.1"; cov "734.825052"; FPKM "35.936251"; TPM "76.844166"; +CM143129.1 StringTie exon 120094 120265 1000 + . gene_id "SS.1917"; transcript_id "SS.1917.1"; exon_number "1"; cov "507.126221"; +CM143129.1 StringTie exon 120384 123285 1000 + . gene_id "SS.1917"; transcript_id "SS.1917.1"; exon_number "2"; cov "748.320618"; +CM143129.1 StringTie transcript 124704 126640 1000 . . gene_id "SS.1918"; transcript_id "SS.1918.1"; cov "2634.811048"; FPKM "128.854115"; TPM "275.534777"; +CM143129.1 StringTie exon 124704 126640 1000 . . gene_id "SS.1918"; transcript_id "SS.1918.1"; exon_number "1"; cov "2634.811035"; +CM143129.1 StringTie transcript 128769 138275 1000 . . gene_id "SS.1919"; transcript_id "SS.1919.1"; cov "259.555275"; FPKM "12.693421"; TPM "27.142935"; +CM143129.1 StringTie exon 128769 138275 1000 . . gene_id "SS.1919"; transcript_id "SS.1919.1"; exon_number "1"; cov "259.555267"; +CM143129.1 StringTie transcript 139540 142461 1000 + . gene_id "SS.1920"; transcript_id "SS.1920.1"; cov "2306.678098"; FPKM "112.806938"; TPM "241.220347"; +CM143129.1 StringTie exon 139540 139636 1000 + . gene_id "SS.1920"; transcript_id "SS.1920.1"; exon_number "1"; cov "1214.608276"; +CM143129.1 StringTie exon 140372 142461 1000 + . gene_id "SS.1920"; transcript_id "SS.1920.1"; exon_number "2"; cov "2357.362793"; +CM143129.1 StringTie transcript 142795 143723 1000 . . gene_id "SS.1921"; transcript_id "SS.1921.1"; cov "860.515608"; FPKM "42.083085"; TPM "89.988228"; +CM143129.1 StringTie exon 142795 143723 1000 . . gene_id "SS.1921"; transcript_id "SS.1921.1"; exon_number "1"; cov "860.515625"; +CM143129.1 StringTie transcript 144316 145776 1000 . . gene_id "SS.1922"; transcript_id "SS.1922.1"; cov "2293.522245"; FPKM "112.163557"; TPM "239.844577"; +CM143129.1 StringTie exon 144316 145776 1000 . . gene_id "SS.1922"; transcript_id "SS.1922.1"; exon_number "1"; cov "2293.522217"; +CM143129.1 StringTie transcript 150112 152617 1000 . . gene_id "SS.1923"; transcript_id "SS.1923.1"; cov "549.350758"; FPKM "26.865724"; TPM "57.448233"; +CM143129.1 StringTie exon 150112 152617 1000 . . gene_id "SS.1923"; transcript_id "SS.1923.1"; exon_number "1"; cov "549.350769"; +CM143129.1 StringTie transcript 152860 154880 1000 + . gene_id "SS.1924"; transcript_id "SS.1924.1"; cov "23.167554"; FPKM "1.132998"; TPM "2.422742"; +CM143129.1 StringTie exon 152860 153922 1000 + . gene_id "SS.1924"; transcript_id "SS.1924.1"; exon_number "1"; cov "28.891586"; +CM143129.1 StringTie exon 153999 154880 1000 + . gene_id "SS.1924"; transcript_id "SS.1924.1"; exon_number "2"; cov "16.268862"; +CM143129.1 StringTie transcript 152860 154880 1000 + . gene_id "SS.1924"; transcript_id "SS.1924.2"; cov "6.715426"; FPKM "0.328415"; TPM "0.702264"; +CM143129.1 StringTie exon 152860 153922 1000 + . gene_id "SS.1924"; transcript_id "SS.1924.2"; exon_number "1"; cov "8.390635"; +CM143129.1 StringTie exon 153999 154175 1000 + . gene_id "SS.1924"; transcript_id "SS.1924.2"; exon_number "2"; cov "3.977283"; +CM143129.1 StringTie exon 154273 154880 1000 + . gene_id "SS.1924"; transcript_id "SS.1924.2"; exon_number "3"; cov "4.583691"; +CM143129.1 StringTie transcript 160884 165310 1000 . . gene_id "SS.1925"; transcript_id "SS.1925.1"; cov "831.712220"; FPKM "40.674470"; TPM "86.976120"; +CM143129.1 StringTie exon 160884 165310 1000 . . gene_id "SS.1925"; transcript_id "SS.1925.1"; exon_number "1"; cov "831.712219"; +CM143129.1 StringTie transcript 167558 176929 1000 - . gene_id "SS.1926"; transcript_id "SS.1926.1"; cov "958.511791"; FPKM "46.875539"; TPM "100.236157"; +CM143129.1 StringTie exon 167558 168107 1000 - . gene_id "SS.1926"; transcript_id "SS.1926.1"; exon_number "1"; cov "1773.760010"; +CM143129.1 StringTie exon 168193 176929 1000 - . gene_id "SS.1926"; transcript_id "SS.1926.1"; exon_number "2"; cov "907.191345"; +CM143129.1 StringTie transcript 174128 176929 1000 . . gene_id "SS.1927"; transcript_id "SS.1927.1"; cov "347.899425"; FPKM "17.013847"; TPM "36.381505"; +CM143129.1 StringTie exon 174128 176929 1000 . . gene_id "SS.1927"; transcript_id "SS.1927.1"; exon_number "1"; cov "347.899414"; +CM143129.1 StringTie transcript 177435 185283 1000 . . gene_id "SS.1928"; transcript_id "SS.1928.1"; cov "565.510893"; FPKM "27.656027"; TPM "59.138175"; +CM143129.1 StringTie exon 177435 185283 1000 . . gene_id "SS.1928"; transcript_id "SS.1928.1"; exon_number "1"; cov "565.510864"; +CM143129.1 StringTie transcript 197140 199473 1000 - . gene_id "SS.1929"; transcript_id "SS.1929.1"; cov "4995.985574"; FPKM "244.326173"; TPM "522.454077"; +CM143129.1 StringTie exon 197140 198668 1000 - . gene_id "SS.1929"; transcript_id "SS.1929.1"; exon_number "1"; cov "2846.529785"; +CM143129.1 StringTie exon 199062 199473 1000 - . gene_id "SS.1929"; transcript_id "SS.1929.1"; exon_number "2"; cov "12972.970703"; +CM143129.1 StringTie transcript 202286 202765 1000 . . gene_id "SS.1930"; transcript_id "SS.1930.1"; cov "16059.645833"; FPKM "785.388940"; TPM "1679.433879"; +CM143129.1 StringTie exon 202286 202765 1000 . . gene_id "SS.1930"; transcript_id "SS.1930.1"; exon_number "1"; cov "16059.645508"; +CM143129.1 StringTie transcript 205978 206579 1000 . . gene_id "SS.1931"; transcript_id "SS.1931.1"; cov "72335.109635"; FPKM "3537.512326"; TPM "7564.427949"; +CM143129.1 StringTie exon 205978 206579 1000 . . gene_id "SS.1931"; transcript_id "SS.1931.1"; exon_number "1"; cov "72335.109375"; +CM143129.1 StringTie transcript 211641 212803 1000 . . gene_id "SS.1932"; transcript_id "SS.1932.1"; cov "3055.496131"; FPKM "149.427509"; TPM "319.527826"; +CM143129.1 StringTie exon 211641 212803 1000 . . gene_id "SS.1932"; transcript_id "SS.1932.1"; exon_number "1"; cov "3055.496094"; +CM143129.1 StringTie transcript 213511 215541 1000 . . gene_id "SS.1933"; transcript_id "SS.1933.1"; cov "2539.363860"; FPKM "124.186318"; TPM "265.553409"; +CM143129.1 StringTie exon 213511 215541 1000 . . gene_id "SS.1933"; transcript_id "SS.1933.1"; exon_number "1"; cov "2539.363770"; +CM143129.1 StringTie transcript 215980 218374 1000 . . gene_id "SS.1934"; transcript_id "SS.1934.1"; cov "1533.717745"; FPKM "75.005699"; TPM "160.388191"; +CM143129.1 StringTie exon 215980 218374 1000 . . gene_id "SS.1934"; transcript_id "SS.1934.1"; exon_number "1"; cov "1533.717773"; +CM143129.1 StringTie transcript 218724 222097 1000 . . gene_id "SS.1935"; transcript_id "SS.1935.1"; cov "700.430943"; FPKM "34.254225"; TPM "73.247410"; +CM143129.1 StringTie exon 218724 222097 1000 . . gene_id "SS.1935"; transcript_id "SS.1935.1"; exon_number "1"; cov "700.430969"; +CM143129.1 StringTie transcript 222416 226069 1000 . . gene_id "SS.1936"; transcript_id "SS.1936.1"; cov "139.261357"; FPKM "6.810507"; TPM "14.563225"; +CM143129.1 StringTie exon 222416 226069 1000 . . gene_id "SS.1936"; transcript_id "SS.1936.1"; exon_number "1"; cov "139.261353"; +CM143129.1 StringTie transcript 249892 251440 1000 . . gene_id "SS.1937"; transcript_id "SS.1937.1"; cov "20.555197"; FPKM "1.005242"; TPM "2.149555"; +CM143129.1 StringTie exon 249892 251440 1000 . . gene_id "SS.1937"; transcript_id "SS.1937.1"; exon_number "1"; cov "20.555197"; +CM143129.1 StringTie transcript 226525 226950 1000 . . gene_id "SS.1938"; transcript_id "SS.1938.1"; cov "2067.246479"; FPKM "101.097654"; TPM "216.181839"; +CM143129.1 StringTie exon 226525 226950 1000 . . gene_id "SS.1938"; transcript_id "SS.1938.1"; exon_number "1"; cov "2067.246582"; +CM143129.1 StringTie transcript 227371 234775 1000 . . gene_id "SS.1939"; transcript_id "SS.1939.1"; cov "516.202836"; FPKM "25.244641"; TPM "53.981796"; +CM143129.1 StringTie exon 227371 234775 1000 . . gene_id "SS.1939"; transcript_id "SS.1939.1"; exon_number "1"; cov "516.202820"; +CM143129.1 StringTie transcript 235027 240286 1000 . . gene_id "SS.1940"; transcript_id "SS.1940.1"; cov "354.357414"; FPKM "17.329672"; TPM "37.056847"; +CM143129.1 StringTie exon 235027 240286 1000 . . gene_id "SS.1940"; transcript_id "SS.1940.1"; exon_number "1"; cov "354.357422"; +CM143129.1 StringTie transcript 240520 241784 1000 . . gene_id "SS.1941"; transcript_id "SS.1941.1"; cov "1264.428458"; FPKM "61.836241"; TPM "132.227324"; +CM143129.1 StringTie exon 240520 241784 1000 . . gene_id "SS.1941"; transcript_id "SS.1941.1"; exon_number "1"; cov "1264.428467"; +CM143129.1 StringTie transcript 242232 243647 1000 . . gene_id "SS.1942"; transcript_id "SS.1942.1"; cov "317.266949"; FPKM "15.515781"; TPM "33.178120"; +CM143129.1 StringTie exon 242232 243647 1000 . . gene_id "SS.1942"; transcript_id "SS.1942.1"; exon_number "1"; cov "317.266937"; +CM143129.1 StringTie transcript 243935 246133 1000 . . gene_id "SS.1943"; transcript_id "SS.1943.1"; cov "193.408367"; FPKM "9.458539"; TPM "20.225637"; +CM143129.1 StringTie exon 243935 246133 1000 . . gene_id "SS.1943"; transcript_id "SS.1943.1"; exon_number "1"; cov "193.408371"; +CM143129.1 StringTie transcript 246352 249619 1000 . . gene_id "SS.1944"; transcript_id "SS.1944.1"; cov "780.667687"; FPKM "38.178162"; TPM "81.638149"; +CM143129.1 StringTie exon 246352 249619 1000 . . gene_id "SS.1944"; transcript_id "SS.1944.1"; exon_number "1"; cov "780.667664"; +CM143129.1 StringTie transcript 262526 263210 1000 . . gene_id "SS.1945"; transcript_id "SS.1945.1"; cov "24495.474453"; FPKM "1197.938916"; TPM "2561.608775"; +CM143129.1 StringTie exon 262526 263210 1000 . . gene_id "SS.1945"; transcript_id "SS.1945.1"; exon_number "1"; cov "24495.474609"; +CM143129.1 StringTie transcript 281804 291984 1000 . . gene_id "SS.1946"; transcript_id "SS.1946.1"; cov "173.525096"; FPKM "8.486158"; TPM "18.146348"; +CM143129.1 StringTie exon 281804 291984 1000 . . gene_id "SS.1946"; transcript_id "SS.1946.1"; exon_number "1"; cov "173.525101"; +CM143129.1 StringTie transcript 269828 270506 1000 . . gene_id "SS.1947"; transcript_id "SS.1947.1"; cov "113300.618557"; FPKM "5540.910032"; TPM "11848.386903"; +CM143129.1 StringTie exon 269828 270506 1000 . . gene_id "SS.1947"; transcript_id "SS.1947.1"; exon_number "1"; cov "113300.617188"; +CM143129.1 StringTie transcript 270770 272696 1000 . . gene_id "SS.1948"; transcript_id "SS.1948.1"; cov "32.033212"; FPKM "1.566568"; TPM "3.349866"; +CM143129.1 StringTie exon 270770 272696 1000 . . gene_id "SS.1948"; transcript_id "SS.1948.1"; exon_number "1"; cov "32.033211"; +CM143129.1 StringTie transcript 273066 273300 1000 . . gene_id "SS.1949"; transcript_id "SS.1949.1"; cov "5.140426"; FPKM "0.251390"; TPM "0.537559"; +CM143129.1 StringTie exon 273066 273300 1000 . . gene_id "SS.1949"; transcript_id "SS.1949.1"; exon_number "1"; cov "5.140426"; +CM143129.1 StringTie transcript 273855 274390 1000 . . gene_id "SS.1950"; transcript_id "SS.1950.1"; cov "130324.567164"; FPKM "6373.457717"; TPM "13628.662530"; +CM143129.1 StringTie exon 273855 274390 1000 . . gene_id "SS.1950"; transcript_id "SS.1950.1"; exon_number "1"; cov "130324.570312"; +CM143129.1 StringTie transcript 279843 280430 1000 . . gene_id "SS.1951"; transcript_id "SS.1951.1"; cov "9634.598639"; FPKM "471.175223"; TPM "1007.536003"; +CM143129.1 StringTie exon 279843 280430 1000 . . gene_id "SS.1951"; transcript_id "SS.1951.1"; exon_number "1"; cov "9634.598633"; +CM143129.1 StringTie transcript 280681 281109 1000 . . gene_id "SS.1952"; transcript_id "SS.1952.1"; cov "17.613054"; FPKM "0.861358"; TPM "1.841881"; +CM143129.1 StringTie exon 280681 281109 1000 . . gene_id "SS.1952"; transcript_id "SS.1952.1"; exon_number "1"; cov "17.613054"; +CM143129.1 StringTie transcript 292222 296177 1000 . . gene_id "SS.1953"; transcript_id "SS.1953.1"; cov "667.679221"; FPKM "32.652518"; TPM "69.822406"; +CM143129.1 StringTie exon 292222 296177 1000 . . gene_id "SS.1953"; transcript_id "SS.1953.1"; exon_number "1"; cov "667.679199"; +CM143129.1 StringTie transcript 296422 298933 1000 . . gene_id "SS.1954"; transcript_id "SS.1954.1"; cov "196.339968"; FPKM "9.601908"; TPM "20.532208"; +CM143129.1 StringTie exon 296422 298933 1000 . . gene_id "SS.1954"; transcript_id "SS.1954.1"; exon_number "1"; cov "196.339966"; +CM143129.1 StringTie transcript 299148 300555 1000 . . gene_id "SS.1955"; transcript_id "SS.1955.1"; cov "1128.635653"; FPKM "55.195362"; TPM "118.026822"; +CM143129.1 StringTie exon 299148 300555 1000 . . gene_id "SS.1955"; transcript_id "SS.1955.1"; exon_number "1"; cov "1128.635620"; +CM143129.1 StringTie transcript 300941 306420 1000 . . gene_id "SS.1956"; transcript_id "SS.1956.1"; cov "3697.537226"; FPKM "180.826207"; TPM "386.669130"; +CM143129.1 StringTie exon 300941 306420 1000 . . gene_id "SS.1956"; transcript_id "SS.1956.1"; exon_number "1"; cov "3697.537109"; +CM143129.1 StringTie transcript 309151 311316 1000 . . gene_id "SS.1957"; transcript_id "SS.1957.1"; cov "1795.288550"; FPKM "87.797688"; TPM "187.741900"; +CM143129.1 StringTie exon 309151 311316 1000 . . gene_id "SS.1957"; transcript_id "SS.1957.1"; exon_number "1"; cov "1795.288574"; +CM143129.1 StringTie transcript 311951 312469 1000 . . gene_id "SS.1958"; transcript_id "SS.1958.1"; cov "55.868979"; FPKM "2.732244"; TPM "5.842486"; +CM143129.1 StringTie exon 311951 312469 1000 . . gene_id "SS.1958"; transcript_id "SS.1958.1"; exon_number "1"; cov "55.868980"; +CM143129.1 StringTie transcript 312964 314063 1000 . . gene_id "SS.1959"; transcript_id "SS.1959.1"; cov "78.596186"; FPKM "3.843707"; TPM "8.219179"; +CM143129.1 StringTie exon 312964 314063 1000 . . gene_id "SS.1959"; transcript_id "SS.1959.1"; exon_number "1"; cov "78.596184"; +CM143129.1 StringTie transcript 315343 317694 1000 . . gene_id "SS.1960"; transcript_id "SS.1960.1"; cov "412.363919"; FPKM "20.166451"; TPM "43.122865"; +CM143129.1 StringTie exon 315343 317694 1000 . . gene_id "SS.1960"; transcript_id "SS.1960.1"; exon_number "1"; cov "412.363922"; +CM143129.1 StringTie transcript 318225 324914 1000 . . gene_id "SS.1961"; transcript_id "SS.1961.1"; cov "2680.504634"; FPKM "131.088737"; TPM "280.313174"; +CM143129.1 StringTie exon 318225 324914 1000 . . gene_id "SS.1961"; transcript_id "SS.1961.1"; exon_number "1"; cov "2680.504639"; +CM143129.1 StringTie transcript 330709 331602 1000 . . gene_id "SS.1962"; transcript_id "SS.1962.1"; cov "34747.288591"; FPKM "1699.298754"; TPM "3633.689951"; +CM143129.1 StringTie exon 330709 331602 1000 . . gene_id "SS.1962"; transcript_id "SS.1962.1"; exon_number "1"; cov "34747.289062"; +CM143129.1 StringTie transcript 332454 334050 1000 . . gene_id "SS.1963"; transcript_id "SS.1963.1"; cov "2241.088604"; FPKM "109.599316"; TPM "234.361341"; +CM143129.1 StringTie exon 332454 334050 1000 . . gene_id "SS.1963"; transcript_id "SS.1963.1"; exon_number "1"; cov "2241.088623"; +CM143129.1 StringTie transcript 332454 336115 1000 - . gene_id "SS.1964"; transcript_id "SS.1964.1"; cov "1450.010475"; FPKM "70.912036"; TPM "151.634522"; +CM143129.1 StringTie exon 332454 335794 1000 - . gene_id "SS.1964"; transcript_id "SS.1964.1"; exon_number "1"; cov "1472.630249"; +CM143129.1 StringTie exon 335877 336115 1000 - . gene_id "SS.1964"; transcript_id "SS.1964.1"; exon_number "2"; cov "1133.807495"; +CM143129.1 StringTie transcript 336671 347233 1000 . . gene_id "SS.1965"; transcript_id "SS.1965.1"; cov "710.609770"; FPKM "34.752015"; TPM "74.311858"; +CM143129.1 StringTie exon 336671 347233 1000 . . gene_id "SS.1965"; transcript_id "SS.1965.1"; exon_number "1"; cov "710.609741"; +CM143129.1 StringTie transcript 347549 354143 1000 . . gene_id "SS.1966"; transcript_id "SS.1966.1"; cov "300.877180"; FPKM "14.714248"; TPM "31.464164"; +CM143129.1 StringTie exon 347549 354143 1000 . . gene_id "SS.1966"; transcript_id "SS.1966.1"; exon_number "1"; cov "300.877167"; +CM143129.1 StringTie transcript 359287 360748 1000 . . gene_id "SS.1967"; transcript_id "SS.1967.1"; cov "21102.530780"; FPKM "1032.008704"; TPM "2206.792447"; +CM143129.1 StringTie exon 359287 360748 1000 . . gene_id "SS.1967"; transcript_id "SS.1967.1"; exon_number "1"; cov "21102.531250"; +CM143129.1 StringTie transcript 361152 368146 1000 . . gene_id "SS.1968"; transcript_id "SS.1968.1"; cov "858.623302"; FPKM "41.990543"; TPM "89.790340"; +CM143129.1 StringTie exon 361152 368146 1000 . . gene_id "SS.1968"; transcript_id "SS.1968.1"; exon_number "1"; cov "858.623291"; +CM143129.1 StringTie transcript 368393 370287 1000 . . gene_id "SS.1969"; transcript_id "SS.1969.1"; cov "8269.718206"; FPKM "404.426429"; TPM "864.803936"; +CM143129.1 StringTie exon 368393 370287 1000 . . gene_id "SS.1969"; transcript_id "SS.1969.1"; exon_number "1"; cov "8269.717773"; +CM143129.1 StringTie transcript 371021 380040 1000 . . gene_id "SS.1970"; transcript_id "SS.1970.1"; cov "960.986253"; FPKM "46.996552"; TPM "100.494923"; +CM143129.1 StringTie exon 371021 380040 1000 . . gene_id "SS.1970"; transcript_id "SS.1970.1"; exon_number "1"; cov "960.986267"; +CM143129.1 StringTie transcript 380739 382598 1000 . . gene_id "SS.1971"; transcript_id "SS.1971.1"; cov "8100.901075"; FPKM "396.170512"; TPM "847.149922"; +CM143129.1 StringTie exon 380739 382598 1000 . . gene_id "SS.1971"; transcript_id "SS.1971.1"; exon_number "1"; cov "8100.900879"; +CM143129.1 StringTie transcript 384424 386722 1000 . . gene_id "SS.1972"; transcript_id "SS.1972.1"; cov "5435.976077"; FPKM "265.843689"; TPM "568.465985"; +CM143129.1 StringTie exon 384424 386722 1000 . . gene_id "SS.1972"; transcript_id "SS.1972.1"; exon_number "1"; cov "5435.976074"; +CM143129.1 StringTie transcript 387103 388968 1000 . . gene_id "SS.1973"; transcript_id "SS.1973.1"; cov "302.598071"; FPKM "14.798407"; TPM "31.644126"; +CM143129.1 StringTie exon 387103 388968 1000 . . gene_id "SS.1973"; transcript_id "SS.1973.1"; exon_number "1"; cov "302.598083"; +CM143129.1 StringTie transcript 389288 395082 1000 . . gene_id "SS.1974"; transcript_id "SS.1974.1"; cov "913.811907"; FPKM "44.689514"; TPM "95.561676"; +CM143129.1 StringTie exon 389288 395082 1000 . . gene_id "SS.1974"; transcript_id "SS.1974.1"; exon_number "1"; cov "913.811890"; +CM143129.1 StringTie transcript 397279 400094 1000 . . gene_id "SS.1975"; transcript_id "SS.1975.1"; cov "489.494318"; FPKM "23.938475"; TPM "51.188759"; +CM143129.1 StringTie exon 397279 400094 1000 . . gene_id "SS.1975"; transcript_id "SS.1975.1"; exon_number "1"; cov "489.494324"; +CM143129.1 StringTie transcript 400403 412780 1000 . . gene_id "SS.1976"; transcript_id "SS.1976.1"; cov "126.843957"; FPKM "6.203240"; TPM "13.264678"; +CM143129.1 StringTie exon 400403 412780 1000 . . gene_id "SS.1976"; transcript_id "SS.1976.1"; exon_number "1"; cov "126.843956"; +CM143129.1 StringTie transcript 413981 415068 1000 . . gene_id "SS.1977"; transcript_id "SS.1977.1"; cov "5244.171875"; FPKM "256.463600"; TPM "548.408104"; +CM143129.1 StringTie exon 413981 415068 1000 . . gene_id "SS.1977"; transcript_id "SS.1977.1"; exon_number "1"; cov "5244.171875"; +CM143129.1 StringTie transcript 416621 417569 1000 . . gene_id "SS.1978"; transcript_id "SS.1978.1"; cov "1072.573235"; FPKM "52.453657"; TPM "112.164107"; +CM143129.1 StringTie exon 416621 417569 1000 . . gene_id "SS.1978"; transcript_id "SS.1978.1"; exon_number "1"; cov "1072.573242"; +CM143129.1 StringTie transcript 418093 418746 1000 . . gene_id "SS.1979"; transcript_id "SS.1979.1"; cov "355.970948"; FPKM "17.408581"; TPM "37.225582"; +CM143129.1 StringTie exon 418093 418746 1000 . . gene_id "SS.1979"; transcript_id "SS.1979.1"; exon_number "1"; cov "355.970947"; +CM143129.1 StringTie transcript 419017 419862 1000 + . gene_id "SS.1980"; transcript_id "SS.1980.1"; cov "563.357616"; FPKM "27.550722"; TPM "58.912997"; +CM143129.1 StringTie exon 419017 419078 1000 + . gene_id "SS.1980"; transcript_id "SS.1980.1"; exon_number "1"; cov "282.822571"; +CM143129.1 StringTie exon 419174 419264 1000 + . gene_id "SS.1980"; transcript_id "SS.1980.1"; exon_number "2"; cov "585.428589"; +CM143129.1 StringTie exon 419384 419507 1000 + . gene_id "SS.1980"; transcript_id "SS.1980.1"; exon_number "3"; cov "802.306458"; +CM143129.1 StringTie exon 419623 419691 1000 + . gene_id "SS.1980"; transcript_id "SS.1980.1"; exon_number "4"; cov "693.869568"; +CM143129.1 StringTie exon 419756 419862 1000 + . gene_id "SS.1980"; transcript_id "SS.1980.1"; exon_number "5"; cov "346.065430"; +CM143129.1 StringTie transcript 483659 484889 1000 . . gene_id "SS.1981"; transcript_id "SS.1981.1"; cov "56.413079"; FPKM "2.758853"; TPM "5.899385"; +CM143129.1 StringTie exon 483659 484889 1000 . . gene_id "SS.1981"; transcript_id "SS.1981.1"; exon_number "1"; cov "56.413078"; +CM143129.1 StringTie transcript 469005 473478 1000 + . gene_id "SS.1982"; transcript_id "SS.1982.1"; cov "85.236298"; FPKM "4.168438"; TPM "8.913567"; +CM143129.1 StringTie exon 469005 472227 1000 + . gene_id "SS.1982"; transcript_id "SS.1982.1"; exon_number "1"; cov "73.041283"; +CM143129.1 StringTie exon 472445 473478 1000 + . gene_id "SS.1982"; transcript_id "SS.1982.1"; exon_number "2"; cov "123.248428"; +CM143129.1 StringTie transcript 469005 473478 1000 + . gene_id "SS.1982"; transcript_id "SS.1982.2"; cov "30.284687"; FPKM "1.481057"; TPM "3.167014"; +CM143129.1 StringTie exon 469005 470243 1000 + . gene_id "SS.1982"; transcript_id "SS.1982.2"; exon_number "1"; cov "25.278103"; +CM143129.1 StringTie exon 470336 472227 1000 + . gene_id "SS.1982"; transcript_id "SS.1982.2"; exon_number "2"; cov "26.057213"; +CM143129.1 StringTie exon 472445 473478 1000 + . gene_id "SS.1982"; transcript_id "SS.1982.2"; exon_number "3"; cov "44.019253"; +CM143129.1 StringTie transcript 473679 474606 1000 . . gene_id "SS.1983"; transcript_id "SS.1983.1"; cov "37.335466"; FPKM "1.825872"; TPM "3.904348"; +CM143129.1 StringTie exon 473679 474606 1000 . . gene_id "SS.1983"; transcript_id "SS.1983.1"; exon_number "1"; cov "37.335464"; +CM143129.1 StringTie transcript 485926 486704 1000 . . gene_id "SS.1984"; transcript_id "SS.1984.1"; cov "204.724005"; FPKM "10.011925"; TPM "21.408967"; +CM143129.1 StringTie exon 485926 486704 1000 . . gene_id "SS.1984"; transcript_id "SS.1984.1"; exon_number "1"; cov "204.723999"; +CM143129.1 StringTie transcript 487454 487699 1000 . . gene_id "SS.1985"; transcript_id "SS.1985.1"; cov "11.044715"; FPKM "0.540136"; TPM "1.154999"; +CM143129.1 StringTie exon 487454 487699 1000 . . gene_id "SS.1985"; transcript_id "SS.1985.1"; exon_number "1"; cov "11.044716"; +CM143129.1 StringTie transcript 503375 504795 1000 . . gene_id "SS.1986"; transcript_id "SS.1986.1"; cov "40.888860"; FPKM "1.999649"; TPM "4.275943"; +CM143129.1 StringTie exon 503375 504795 1000 . . gene_id "SS.1986"; transcript_id "SS.1986.1"; exon_number "1"; cov "40.888859"; +CM143129.1 StringTie transcript 513657 515192 1000 . . gene_id "SS.1987"; transcript_id "SS.1987.1"; cov "42.720571"; FPKM "2.089228"; TPM "4.467494"; +CM143129.1 StringTie exon 513657 515192 1000 . . gene_id "SS.1987"; transcript_id "SS.1987.1"; exon_number "1"; cov "42.720570"; +CM143129.1 StringTie transcript 420582 421855 1000 . . gene_id "SS.1988"; transcript_id "SS.1988.1"; cov "1047.025903"; FPKM "51.204278"; TPM "109.492500"; +CM143129.1 StringTie exon 420582 421855 1000 . . gene_id "SS.1988"; transcript_id "SS.1988.1"; exon_number "1"; cov "1047.025879"; +CM143129.1 StringTie transcript 422810 424078 1000 . . gene_id "SS.1989"; transcript_id "SS.1989.1"; cov "16870.502758"; FPKM "825.043492"; TPM "1764.229061"; +CM143129.1 StringTie exon 422810 424078 1000 . . gene_id "SS.1989"; transcript_id "SS.1989.1"; exon_number "1"; cov "16870.501953"; +CM143129.1 StringTie transcript 425669 426148 1000 . . gene_id "SS.1990"; transcript_id "SS.1990.1"; cov "36700.408333"; FPKM "1794.815097"; TPM "3837.937012"; +CM143129.1 StringTie exon 425669 426148 1000 . . gene_id "SS.1990"; transcript_id "SS.1990.1"; exon_number "1"; cov "36700.410156"; +CM143129.1 StringTie transcript 429374 430346 1000 . . gene_id "SS.1991"; transcript_id "SS.1991.1"; cov "23903.810894"; FPKM "1169.003905"; TPM "2499.735690"; +CM143129.1 StringTie exon 429374 430346 1000 . . gene_id "SS.1991"; transcript_id "SS.1991.1"; exon_number "1"; cov "23903.810547"; +CM143129.1 StringTie transcript 431722 432802 1000 . . gene_id "SS.1992"; transcript_id "SS.1992.1"; cov "9110.102683"; FPKM "445.525011"; TPM "952.686955"; +CM143129.1 StringTie exon 431722 432802 1000 . . gene_id "SS.1992"; transcript_id "SS.1992.1"; exon_number "1"; cov "9110.102539"; +CM143129.1 StringTie transcript 438025 439302 1000 . . gene_id "SS.1993"; transcript_id "SS.1993.1"; cov "1146.679969"; FPKM "56.077810"; TPM "119.913802"; +CM143129.1 StringTie exon 438025 439302 1000 . . gene_id "SS.1993"; transcript_id "SS.1993.1"; exon_number "1"; cov "1146.679932"; +CM143129.1 StringTie transcript 439593 441142 1000 . . gene_id "SS.1994"; transcript_id "SS.1994.1"; cov "145.295484"; FPKM "7.105603"; TPM "15.194243"; +CM143129.1 StringTie exon 439593 441142 1000 . . gene_id "SS.1994"; transcript_id "SS.1994.1"; exon_number "1"; cov "145.295486"; +CM143129.1 StringTie transcript 442138 443362 1000 . . gene_id "SS.1995"; transcript_id "SS.1995.1"; cov "21893.095510"; FPKM "1070.670876"; TPM "2289.465578"; +CM143129.1 StringTie exon 442138 443362 1000 . . gene_id "SS.1995"; transcript_id "SS.1995.1"; exon_number "1"; cov "21893.095703"; +CM143129.1 StringTie transcript 448401 452079 1000 . . gene_id "SS.1996"; transcript_id "SS.1996.1"; cov "1116.906225"; FPKM "54.621740"; TPM "116.800219"; +CM143129.1 StringTie exon 448401 452079 1000 . . gene_id "SS.1996"; transcript_id "SS.1996.1"; exon_number "1"; cov "1116.906250"; +CM143129.1 StringTie transcript 452821 456794 1000 + . gene_id "SS.1997"; transcript_id "SS.1997.1"; cov "2421.848822"; FPKM "118.439304"; TPM "253.264300"; +CM143129.1 StringTie exon 452821 452918 1000 + . gene_id "SS.1997"; transcript_id "SS.1997.1"; exon_number "1"; cov "2635.244873"; +CM143129.1 StringTie exon 453030 456794 1000 + . gene_id "SS.1997"; transcript_id "SS.1997.1"; exon_number "2"; cov "2416.294189"; +CM143129.1 StringTie transcript 547005 547496 1000 . . gene_id "SS.1998"; transcript_id "SS.1998.1"; cov "6.219512"; FPKM "0.304162"; TPM "0.650404"; +CM143129.1 StringTie exon 547005 547496 1000 . . gene_id "SS.1998"; transcript_id "SS.1998.1"; exon_number "1"; cov "6.219512"; +CM143129.1 StringTie transcript 547909 548136 1000 . . gene_id "SS.1999"; transcript_id "SS.1999.1"; cov "5.807018"; FPKM "0.283989"; TPM "0.607268"; +CM143129.1 StringTie exon 547909 548136 1000 . . gene_id "SS.1999"; transcript_id "SS.1999.1"; exon_number "1"; cov "5.807017"; +CM143129.1 StringTie transcript 522696 524063 1000 . . gene_id "SS.2000"; transcript_id "SS.2000.1"; cov "16.934942"; FPKM "0.828195"; TPM "1.770968"; +CM143129.1 StringTie exon 522696 524063 1000 . . gene_id "SS.2000"; transcript_id "SS.2000.1"; exon_number "1"; cov "16.934942"; +CM143129.1 StringTie transcript 528841 532491 1000 . . gene_id "SS.2001"; transcript_id "SS.2001.1"; cov "142.652492"; FPKM "6.976349"; TPM "14.917853"; +CM143129.1 StringTie exon 528841 532491 1000 . . gene_id "SS.2001"; transcript_id "SS.2001.1"; exon_number "1"; cov "142.652496"; +CM143129.1 StringTie transcript 533930 536977 1000 - . gene_id "SS.2002"; transcript_id "SS.2002.1"; cov "31.664080"; FPKM "1.548516"; TPM "3.311264"; +CM143129.1 StringTie exon 533930 536634 1000 - . gene_id "SS.2002"; transcript_id "SS.2002.1"; exon_number "1"; cov "32.889286"; +CM143129.1 StringTie exon 536693 536977 1000 - . gene_id "SS.2002"; transcript_id "SS.2002.1"; exon_number "2"; cov "20.035385"; +CM143129.1 StringTie transcript 533980 536977 1000 - . gene_id "SS.2002"; transcript_id "SS.2002.2"; cov "159.825391"; FPKM "7.816181"; TPM "16.713705"; +CM143129.1 StringTie exon 533980 536090 1000 - . gene_id "SS.2002"; transcript_id "SS.2002.2"; exon_number "1"; cov "175.584656"; +CM143129.1 StringTie exon 536296 536634 1000 - . gene_id "SS.2002"; transcript_id "SS.2002.2"; exon_number "2"; cov "113.594940"; +CM143129.1 StringTie exon 536693 536977 1000 - . gene_id "SS.2002"; transcript_id "SS.2002.2"; exon_number "3"; cov "98.086105"; +CM143129.1 StringTie transcript 537337 541519 1000 . . gene_id "SS.2003"; transcript_id "SS.2003.1"; cov "87.773264"; FPKM "4.292508"; TPM "9.178869"; +CM143129.1 StringTie exon 537337 541519 1000 . . gene_id "SS.2003"; transcript_id "SS.2003.1"; exon_number "1"; cov "87.773262"; +CM143129.1 StringTie transcript 541758 542781 1000 . . gene_id "SS.2004"; transcript_id "SS.2004.1"; cov "21.435059"; FPKM "1.048271"; TPM "2.241567"; +CM143129.1 StringTie exon 541758 542781 1000 . . gene_id "SS.2004"; transcript_id "SS.2004.1"; exon_number "1"; cov "21.435059"; +CM143129.1 StringTie transcript 550918 551709 1000 + . gene_id "SS.2005"; transcript_id "SS.2005.1"; cov "1805.462833"; FPKM "88.295256"; TPM "188.805873"; +CM143129.1 StringTie exon 550918 551147 1000 + . gene_id "SS.2005"; transcript_id "SS.2005.1"; exon_number "1"; cov "992.608704"; +CM143129.1 StringTie exon 551227 551709 1000 + . gene_id "SS.2005"; transcript_id "SS.2005.1"; exon_number "2"; cov "2192.536133"; +CM143129.1 StringTie transcript 553053 553787 1000 . . gene_id "SS.2006"; transcript_id "SS.2006.1"; cov "329.382313"; FPKM "16.108277"; TPM "34.445082"; +CM143129.1 StringTie exon 553053 553787 1000 . . gene_id "SS.2006"; transcript_id "SS.2006.1"; exon_number "1"; cov "329.382324"; +CM143129.1 StringTie transcript 562400 563518 1000 - . gene_id "SS.2007"; transcript_id "SS.2007.1"; cov "9299.484375"; FPKM "454.786628"; TPM "972.491503"; +CM143129.1 StringTie exon 562400 562882 1000 - . gene_id "SS.2007"; transcript_id "SS.2007.1"; exon_number "1"; cov "10687.495117"; +CM143129.1 StringTie exon 563426 563518 1000 - . gene_id "SS.2007"; transcript_id "SS.2007.1"; exon_number "2"; cov "2090.784912"; +CM143129.1 StringTie transcript 563764 567486 1000 . . gene_id "SS.2008"; transcript_id "SS.2008.1"; cov "650.092130"; FPKM "31.792430"; TPM "67.983239"; +CM143129.1 StringTie exon 563764 567486 1000 . . gene_id "SS.2008"; transcript_id "SS.2008.1"; exon_number "1"; cov "650.092102"; +CM143129.1 StringTie transcript 567835 585884 1000 . . gene_id "SS.2009"; transcript_id "SS.2009.1"; cov "319.984377"; FPKM "15.648676"; TPM "33.462295"; +CM143129.1 StringTie exon 567835 585884 1000 . . gene_id "SS.2009"; transcript_id "SS.2009.1"; exon_number "1"; cov "319.984375"; +CM143129.1 StringTie transcript 586224 591697 1000 . . gene_id "SS.2010"; transcript_id "SS.2010.1"; cov "588.309828"; FPKM "28.770998"; TPM "61.522369"; +CM143129.1 StringTie exon 586224 591697 1000 . . gene_id "SS.2010"; transcript_id "SS.2010.1"; exon_number "1"; cov "588.309814"; +CM143129.1 StringTie transcript 593231 602659 1000 . . gene_id "SS.2011"; transcript_id "SS.2011.1"; cov "563.074875"; FPKM "27.536895"; TPM "58.883429"; +CM143129.1 StringTie exon 593231 602659 1000 . . gene_id "SS.2011"; transcript_id "SS.2011.1"; exon_number "1"; cov "563.074890"; +CM143129.1 StringTie transcript 602930 617431 1000 . . gene_id "SS.2012"; transcript_id "SS.2012.1"; cov "157.410219"; FPKM "7.698068"; TPM "16.461139"; +CM143129.1 StringTie exon 602930 617431 1000 . . gene_id "SS.2012"; transcript_id "SS.2012.1"; exon_number "1"; cov "157.410217"; +CM143129.1 StringTie transcript 617659 619008 1000 . . gene_id "SS.2013"; transcript_id "SS.2013.1"; cov "474.509630"; FPKM "23.205656"; TPM "49.621739"; +CM143129.1 StringTie exon 617659 619008 1000 . . gene_id "SS.2013"; transcript_id "SS.2013.1"; exon_number "1"; cov "474.509644"; +CM143129.1 StringTie transcript 620773 622611 1000 . . gene_id "SS.2014"; transcript_id "SS.2014.1"; cov "2078.070147"; FPKM "101.626980"; TPM "217.313722"; +CM143129.1 StringTie exon 620773 622611 1000 . . gene_id "SS.2014"; transcript_id "SS.2014.1"; exon_number "1"; cov "2078.070068"; +CM143129.1 StringTie transcript 623011 627959 1000 . . gene_id "SS.2015"; transcript_id "SS.2015.1"; cov "408.748434"; FPKM "19.989638"; TPM "42.744776"; +CM143129.1 StringTie exon 623011 627959 1000 . . gene_id "SS.2015"; transcript_id "SS.2015.1"; exon_number "1"; cov "408.748444"; +CM143129.1 StringTie transcript 628186 629059 1000 . . gene_id "SS.2016"; transcript_id "SS.2016.1"; cov "392.568650"; FPKM "19.198373"; TPM "41.052779"; +CM143129.1 StringTie exon 628186 629059 1000 . . gene_id "SS.2016"; transcript_id "SS.2016.1"; exon_number "1"; cov "392.568665"; +CM143129.1 StringTie transcript 629497 634193 1000 . . gene_id "SS.2017"; transcript_id "SS.2017.1"; cov "444.370023"; FPKM "21.731694"; TPM "46.469896"; +CM143129.1 StringTie exon 629497 634193 1000 . . gene_id "SS.2017"; transcript_id "SS.2017.1"; exon_number "1"; cov "444.370026"; +CM143129.1 StringTie transcript 634450 635758 1000 . . gene_id "SS.2018"; transcript_id "SS.2018.1"; cov "8530.934301"; FPKM "417.201071"; TPM "892.120551"; +CM143129.1 StringTie exon 634450 635758 1000 . . gene_id "SS.2018"; transcript_id "SS.2018.1"; exon_number "1"; cov "8530.934570"; +CM143129.1 StringTie transcript 637773 641340 1000 . . gene_id "SS.2019"; transcript_id "SS.2019.1"; cov "2155.494675"; FPKM "105.413388"; TPM "225.410375"; +CM143129.1 StringTie exon 637773 641340 1000 . . gene_id "SS.2019"; transcript_id "SS.2019.1"; exon_number "1"; cov "2155.494629"; +CM143129.1 StringTie transcript 642088 644521 1000 . . gene_id "SS.2020"; transcript_id "SS.2020.1"; cov "477.205834"; FPKM "23.337512"; TPM "49.903694"; +CM143129.1 StringTie exon 642088 644521 1000 . . gene_id "SS.2020"; transcript_id "SS.2020.1"; exon_number "1"; cov "477.205841"; +CM143129.1 StringTie transcript 644764 649574 1000 . . gene_id "SS.2021"; transcript_id "SS.2021.1"; cov "684.413220"; FPKM "33.470886"; TPM "71.572360"; +CM143129.1 StringTie exon 644764 649574 1000 . . gene_id "SS.2021"; transcript_id "SS.2021.1"; exon_number "1"; cov "684.413208"; +CM143129.1 StringTie transcript 651183 654516 1000 . . gene_id "SS.2022"; transcript_id "SS.2022.1"; cov "3143.585783"; FPKM "153.735489"; TPM "328.739782"; +CM143129.1 StringTie exon 651183 654516 1000 . . gene_id "SS.2022"; transcript_id "SS.2022.1"; exon_number "1"; cov "3143.585693"; +CM143129.1 StringTie transcript 662121 665220 1000 + . gene_id "SS.2023"; transcript_id "SS.2023.1"; cov "832.623943"; FPKM "40.719057"; TPM "87.071463"; +CM143129.1 StringTie exon 662121 662270 1000 + . gene_id "SS.2023"; transcript_id "SS.2023.1"; exon_number "1"; cov "295.426666"; +CM143129.1 StringTie exon 662414 665220 1000 + . gene_id "SS.2023"; transcript_id "SS.2023.1"; exon_number "2"; cov "861.330627"; +CM143129.1 StringTie transcript 667812 670668 1000 . . gene_id "SS.2024"; transcript_id "SS.2024.1"; cov "5025.766538"; FPKM "245.782597"; TPM "525.568414"; +CM143129.1 StringTie exon 667812 670668 1000 . . gene_id "SS.2024"; transcript_id "SS.2024.1"; exon_number "1"; cov "5025.766602"; +CM143129.1 StringTie transcript 671123 674265 1000 . . gene_id "SS.2025"; transcript_id "SS.2025.1"; cov "1350.420299"; FPKM "66.041629"; TPM "141.219901"; +CM143129.1 StringTie exon 671123 674265 1000 . . gene_id "SS.2025"; transcript_id "SS.2025.1"; exon_number "1"; cov "1350.420288"; +CM143129.1 StringTie transcript 676713 680122 1000 - . gene_id "SS.2026"; transcript_id "SS.2026.1"; cov "403.831423"; FPKM "19.749174"; TPM "42.230581"; +CM143129.1 StringTie exon 676713 678480 1000 - . gene_id "SS.2026"; transcript_id "SS.2026.1"; exon_number "1"; cov "106.449997"; +CM143129.1 StringTie exon 678560 680122 1000 - . gene_id "SS.2026"; transcript_id "SS.2026.1"; exon_number "2"; cov "740.216797"; +CM143129.1 StringTie transcript 676713 680122 1000 - . gene_id "SS.2026"; transcript_id "SS.2026.2"; cov "242.497867"; FPKM "11.859237"; TPM "25.359160"; +CM143129.1 StringTie exon 676713 678480 1000 - . gene_id "SS.2026"; transcript_id "SS.2026.2"; exon_number "1"; cov "62.969688"; +CM143129.1 StringTie exon 678560 678695 1000 - . gene_id "SS.2026"; transcript_id "SS.2026.2"; exon_number "2"; cov "66.131477"; +CM143129.1 StringTie exon 678762 680122 1000 - . gene_id "SS.2026"; transcript_id "SS.2026.2"; exon_number "3"; cov "493.336700"; +CM143129.1 StringTie transcript 680655 682696 1000 . . gene_id "SS.2027"; transcript_id "SS.2027.1"; cov "829.208619"; FPKM "40.552032"; TPM "86.714306"; +CM143129.1 StringTie exon 680655 682696 1000 . . gene_id "SS.2027"; transcript_id "SS.2027.1"; exon_number "1"; cov "829.208618"; +CM143129.1 StringTie transcript 683057 683588 1000 . . gene_id "SS.2028"; transcript_id "SS.2028.1"; cov "667.646617"; FPKM "32.650924"; TPM "69.818996"; +CM143129.1 StringTie exon 683057 683588 1000 . . gene_id "SS.2028"; transcript_id "SS.2028.1"; exon_number "1"; cov "667.646606"; +CM143129.1 StringTie transcript 684228 685955 1000 . . gene_id "SS.2029"; transcript_id "SS.2029.1"; cov "1969.335069"; FPKM "96.309346"; TPM "205.942775"; +CM143129.1 StringTie exon 684228 685955 1000 . . gene_id "SS.2029"; transcript_id "SS.2029.1"; exon_number "1"; cov "1969.335083"; +CM143129.1 StringTie transcript 688813 689820 1000 - . gene_id "SS.2030"; transcript_id "SS.2030.1"; cov "2417.779121"; FPKM "118.240278"; TPM "252.838712"; +CM143129.1 StringTie exon 688813 689498 1000 - . gene_id "SS.2030"; transcript_id "SS.2030.1"; exon_number "1"; cov "2760.736084"; +CM143129.1 StringTie exon 689597 689820 1000 - . gene_id "SS.2030"; transcript_id "SS.2030.1"; exon_number "2"; cov "1367.473267"; +CM143129.1 StringTie transcript 704143 704542 1000 . . gene_id "SS.2031"; transcript_id "SS.2031.1"; cov "265.570000"; FPKM "12.987568"; TPM "27.771923"; +CM143129.1 StringTie exon 704143 704542 1000 . . gene_id "SS.2031"; transcript_id "SS.2031.1"; exon_number "1"; cov "265.570007"; +CM143129.1 StringTie transcript 692429 697341 1000 + . gene_id "SS.2032"; transcript_id "SS.2032.1"; cov "1007.538904"; FPKM "49.273186"; TPM "105.363156"; +CM143129.1 StringTie exon 692429 695973 1000 + . gene_id "SS.2032"; transcript_id "SS.2032.1"; exon_number "1"; cov "121.364456"; +CM143129.1 StringTie exon 696196 697341 1000 + . gene_id "SS.2032"; transcript_id "SS.2032.1"; exon_number "2"; cov "3748.802734"; +CM143129.1 StringTie transcript 697701 700565 1000 . . gene_id "SS.2033"; transcript_id "SS.2033.1"; cov "307.473298"; FPKM "15.036828"; TPM "32.153952"; +CM143129.1 StringTie exon 697701 700565 1000 . . gene_id "SS.2033"; transcript_id "SS.2033.1"; exon_number "1"; cov "307.473297"; +CM143129.1 StringTie transcript 701011 703033 1000 . . gene_id "SS.2034"; transcript_id "SS.2034.1"; cov "134.469105"; FPKM "6.576144"; TPM "14.062077"; +CM143129.1 StringTie exon 701011 703033 1000 . . gene_id "SS.2034"; transcript_id "SS.2034.1"; exon_number "1"; cov "134.469101"; +CM143129.1 StringTie transcript 704824 706711 1000 . . gene_id "SS.2035"; transcript_id "SS.2035.1"; cov "58.344367"; FPKM "2.853302"; TPM "6.101349"; +CM143129.1 StringTie exon 704824 706711 1000 . . gene_id "SS.2035"; transcript_id "SS.2035.1"; exon_number "1"; cov "58.344368"; +CM143129.1 StringTie transcript 704824 706711 1000 + . gene_id "SS.2036"; transcript_id "SS.2036.1"; cov "7.388964"; FPKM "0.361354"; TPM "0.772699"; +CM143129.1 StringTie exon 704824 704875 1000 + . gene_id "SS.2036"; transcript_id "SS.2036.1"; exon_number "1"; cov "15.712758"; +CM143129.1 StringTie exon 705209 706711 1000 + . gene_id "SS.2036"; transcript_id "SS.2036.1"; exon_number "2"; cov "7.100982"; +CM143129.1 StringTie transcript 707026 710024 1000 . . gene_id "SS.2037"; transcript_id "SS.2037.1"; cov "340.157052"; FPKM "16.635210"; TPM "35.571848"; +CM143129.1 StringTie exon 707026 710024 1000 . . gene_id "SS.2037"; transcript_id "SS.2037.1"; exon_number "1"; cov "340.157043"; +CM143129.1 StringTie transcript 710442 732562 1000 . . gene_id "SS.2038"; transcript_id "SS.2038.1"; cov "333.223136"; FPKM "16.296111"; TPM "34.846735"; +CM143129.1 StringTie exon 710442 732562 1000 . . gene_id "SS.2038"; transcript_id "SS.2038.1"; exon_number "1"; cov "333.223145"; +CM143129.1 StringTie transcript 733773 734543 1000 . . gene_id "SS.2039"; transcript_id "SS.2039.1"; cov "28675.818418"; FPKM "1402.376545"; TPM "2998.767312"; +CM143129.1 StringTie exon 733773 734543 1000 . . gene_id "SS.2039"; transcript_id "SS.2039.1"; exon_number "1"; cov "28675.818359"; +CM143129.1 StringTie transcript 800975 801202 1000 . . gene_id "SS.2040"; transcript_id "SS.2040.1"; cov "11.000000"; FPKM "0.537949"; TPM "1.150323"; +CM143129.1 StringTie exon 800975 801202 1000 . . gene_id "SS.2040"; transcript_id "SS.2040.1"; exon_number "1"; cov "11.000000"; +CM143129.1 StringTie transcript 744509 747826 1000 . . gene_id "SS.2041"; transcript_id "SS.2041.1"; cov "86.169078"; FPKM "4.214056"; TPM "9.011112"; +CM143129.1 StringTie exon 744509 747826 1000 . . gene_id "SS.2041"; transcript_id "SS.2041.1"; exon_number "1"; cov "86.169075"; +CM143129.1 StringTie transcript 748035 748626 1000 . . gene_id "SS.2042"; transcript_id "SS.2042.1"; cov "2460.253378"; FPKM "120.317460"; TPM "257.280448"; +CM143129.1 StringTie exon 748035 748626 1000 . . gene_id "SS.2042"; transcript_id "SS.2042.1"; exon_number "1"; cov "2460.253418"; +CM143129.1 StringTie transcript 748968 750445 1000 . . gene_id "SS.2043"; transcript_id "SS.2043.1"; cov "389.298376"; FPKM "19.038442"; TPM "40.710791"; +CM143129.1 StringTie exon 748968 750445 1000 . . gene_id "SS.2043"; transcript_id "SS.2043.1"; exon_number "1"; cov "389.298370"; +CM143129.1 StringTie transcript 750782 753176 1000 . . gene_id "SS.2044"; transcript_id "SS.2044.1"; cov "1077.351148"; FPKM "52.687319"; TPM "112.663756"; +CM143129.1 StringTie exon 750782 753176 1000 . . gene_id "SS.2044"; transcript_id "SS.2044.1"; exon_number "1"; cov "1077.351196"; +CM143129.1 StringTie transcript 753769 760181 1000 . . gene_id "SS.2045"; transcript_id "SS.2045.1"; cov "374.778731"; FPKM "18.328366"; TPM "39.192402"; +CM143129.1 StringTie exon 753769 760181 1000 . . gene_id "SS.2045"; transcript_id "SS.2045.1"; exon_number "1"; cov "374.778717"; +CM143129.1 StringTie transcript 760281 777494 1000 . . gene_id "SS.2046"; transcript_id "SS.2046.1"; cov "289.889799"; FPKM "14.176916"; TPM "30.315161"; +CM143129.1 StringTie exon 760281 777494 1000 . . gene_id "SS.2046"; transcript_id "SS.2046.1"; exon_number "1"; cov "289.889801"; +CM143129.1 StringTie transcript 777889 779412 1000 . . gene_id "SS.2047"; transcript_id "SS.2047.1"; cov "18531.931759"; FPKM "906.294846"; TPM "1937.972628"; +CM143129.1 StringTie exon 777889 779412 1000 . . gene_id "SS.2047"; transcript_id "SS.2047.1"; exon_number "1"; cov "18531.931641"; +CM143129.1 StringTie transcript 784159 787361 1000 . . gene_id "SS.2048"; transcript_id "SS.2048.1"; cov "115.413675"; FPKM "5.644248"; TPM "12.069359"; +CM143129.1 StringTie exon 784159 787361 1000 . . gene_id "SS.2048"; transcript_id "SS.2048.1"; exon_number "1"; cov "115.413673"; +CM143129.1 StringTie transcript 790412 792607 1000 . . gene_id "SS.2049"; transcript_id "SS.2049.1"; cov "4680.789162"; FPKM "228.911651"; TPM "489.492482"; +CM143129.1 StringTie exon 790412 792607 1000 . . gene_id "SS.2049"; transcript_id "SS.2049.1"; exon_number "1"; cov "4680.789062"; +CM143129.1 StringTie transcript 797265 799712 1000 . . gene_id "SS.2050"; transcript_id "SS.2050.1"; cov "314.062908"; FPKM "15.359089"; TPM "32.843059"; +CM143129.1 StringTie exon 797265 799712 1000 . . gene_id "SS.2050"; transcript_id "SS.2050.1"; exon_number "1"; cov "314.062897"; +CM143129.1 StringTie transcript 800161 800640 1000 . . gene_id "SS.2051"; transcript_id "SS.2051.1"; cov "6.479167"; FPKM "0.316860"; TPM "0.677557"; +CM143129.1 StringTie exon 800161 800640 1000 . . gene_id "SS.2051"; transcript_id "SS.2051.1"; exon_number "1"; cov "6.479167"; +CM143129.1 StringTie transcript 834105 834757 1000 . . gene_id "SS.2052"; transcript_id "SS.2052.1"; cov "107.638591"; FPKM "5.264011"; TPM "11.256282"; +CM143129.1 StringTie exon 834105 834757 1000 . . gene_id "SS.2052"; transcript_id "SS.2052.1"; exon_number "1"; cov "107.638588"; +CM143129.1 StringTie transcript 901379 902122 1000 . . gene_id "SS.2053"; transcript_id "SS.2053.1"; cov "914.606183"; FPKM "44.728358"; TPM "95.644737"; +CM143129.1 StringTie exon 901379 902122 1000 . . gene_id "SS.2053"; transcript_id "SS.2053.1"; exon_number "1"; cov "914.606201"; +CM143129.1 StringTie transcript 902409 903677 1000 + . gene_id "SS.2054"; transcript_id "SS.2054.1"; cov "306.623342"; FPKM "14.995261"; TPM "32.065068"; +CM143129.1 StringTie exon 902409 902499 1000 + . gene_id "SS.2054"; transcript_id "SS.2054.1"; exon_number "1"; cov "118.318680"; +CM143129.1 StringTie exon 902638 903677 1000 + . gene_id "SS.2054"; transcript_id "SS.2054.1"; exon_number "2"; cov "323.100006"; +CM143129.1 StringTie transcript 835184 837142 1000 . . gene_id "SS.2055"; transcript_id "SS.2055.1"; cov "584.673813"; FPKM "28.593180"; TPM "61.142134"; +CM143129.1 StringTie exon 835184 837142 1000 . . gene_id "SS.2055"; transcript_id "SS.2055.1"; exon_number "1"; cov "584.673828"; +CM143129.1 StringTie transcript 837453 840819 1000 . . gene_id "SS.2056"; transcript_id "SS.2056.1"; cov "986.869320"; FPKM "48.262350"; TPM "103.201639"; +CM143129.1 StringTie exon 837453 840819 1000 . . gene_id "SS.2056"; transcript_id "SS.2056.1"; exon_number "1"; cov "986.869324"; +CM143129.1 StringTie transcript 841067 844682 1000 . . gene_id "SS.2057"; transcript_id "SS.2057.1"; cov "389.532909"; FPKM "19.049912"; TPM "40.735317"; +CM143129.1 StringTie exon 841067 844682 1000 . . gene_id "SS.2057"; transcript_id "SS.2057.1"; exon_number "1"; cov "389.532898"; +CM143129.1 StringTie transcript 844904 846034 1000 . . gene_id "SS.2058"; transcript_id "SS.2058.1"; cov "1361.517241"; FPKM "66.584319"; TPM "142.380362"; +CM143129.1 StringTie exon 844904 846034 1000 . . gene_id "SS.2058"; transcript_id "SS.2058.1"; exon_number "1"; cov "1361.517212"; +CM143129.1 StringTie transcript 846504 848184 1000 . . gene_id "SS.2059"; transcript_id "SS.2059.1"; cov "4058.657347"; FPKM "198.486606"; TPM "424.433186"; +CM143129.1 StringTie exon 846504 848184 1000 . . gene_id "SS.2059"; transcript_id "SS.2059.1"; exon_number "1"; cov "4058.657227"; +CM143129.1 StringTie transcript 848701 851407 1000 . . gene_id "SS.2060"; transcript_id "SS.2060.1"; cov "5528.599187"; FPKM "270.373376"; TPM "578.152026"; +CM143129.1 StringTie exon 848701 851407 1000 . . gene_id "SS.2060"; transcript_id "SS.2060.1"; exon_number "1"; cov "5528.599121"; +CM143129.1 StringTie transcript 858743 859839 1000 - . gene_id "SS.2061"; transcript_id "SS.2061.1"; cov "1093.273956"; FPKM "53.466016"; TPM "114.328880"; +CM143129.1 StringTie exon 858743 859506 1000 - . gene_id "SS.2061"; transcript_id "SS.2061.1"; exon_number "1"; cov "1153.917480"; +CM143129.1 StringTie exon 859790 859839 1000 - . gene_id "SS.2061"; transcript_id "SS.2061.1"; exon_number "2"; cov "166.639999"; +CM143129.1 StringTie transcript 866418 867341 1000 . . gene_id "SS.2062"; transcript_id "SS.2062.1"; cov "1996.152597"; FPKM "97.620843"; TPM "208.747212"; +CM143129.1 StringTie exon 866418 867341 1000 . . gene_id "SS.2062"; transcript_id "SS.2062.1"; exon_number "1"; cov "1996.152588"; +CM143129.1 StringTie transcript 869867 871028 1000 - . gene_id "SS.2063"; transcript_id "SS.2063.1"; cov "15984.187943"; FPKM "781.698710"; TPM "1671.542887"; +CM143129.1 StringTie exon 869867 870404 1000 - . gene_id "SS.2063"; transcript_id "SS.2063.1"; exon_number "1"; cov "16685.851562"; +CM143129.1 StringTie exon 871003 871028 1000 - . gene_id "SS.2063"; transcript_id "SS.2063.1"; exon_number "2"; cov "1465.153809"; +CM143129.1 StringTie transcript 871270 883168 1000 + . gene_id "SS.2064"; transcript_id "SS.2064.1"; cov "317.591785"; FPKM "15.531667"; TPM "33.212090"; +CM143129.1 StringTie exon 871270 879153 1000 + . gene_id "SS.2064"; transcript_id "SS.2064.1"; exon_number "1"; cov "346.276398"; +CM143129.1 StringTie exon 879221 883168 1000 + . gene_id "SS.2064"; transcript_id "SS.2064.1"; exon_number "2"; cov "260.309784"; +CM143129.1 StringTie transcript 876056 883168 1000 + . gene_id "SS.2064"; transcript_id "SS.2064.2"; cov "333.402603"; FPKM "16.304887"; TPM "34.865503"; +CM143129.1 StringTie exon 876056 877650 1000 + . gene_id "SS.2064"; transcript_id "SS.2064.2"; exon_number "1"; cov "115.562698"; +CM143129.1 StringTie exon 877782 879153 1000 + . gene_id "SS.2064"; transcript_id "SS.2064.2"; exon_number "2"; cov "401.823975"; +CM143129.1 StringTie exon 879221 883168 1000 + . gene_id "SS.2064"; transcript_id "SS.2064.2"; exon_number "3"; cov "397.632721"; +CM143129.1 StringTie transcript 883375 885097 1000 . . gene_id "SS.2065"; transcript_id "SS.2065.1"; cov "1616.217644"; FPKM "79.040315"; TPM "169.015599"; +CM143129.1 StringTie exon 883375 885097 1000 . . gene_id "SS.2065"; transcript_id "SS.2065.1"; exon_number "1"; cov "1616.217651"; +CM143129.1 StringTie transcript 886216 893710 1000 . . gene_id "SS.2066"; transcript_id "SS.2066.1"; cov "733.746498"; FPKM "35.883505"; TPM "76.731376"; +CM143129.1 StringTie exon 886216 893710 1000 . . gene_id "SS.2066"; transcript_id "SS.2066.1"; exon_number "1"; cov "733.746521"; +CM143129.1 StringTie transcript 894623 896700 1000 . . gene_id "SS.2067"; transcript_id "SS.2067.1"; cov "130.965351"; FPKM "6.404795"; TPM "13.695672"; +CM143129.1 StringTie exon 894623 896700 1000 . . gene_id "SS.2067"; transcript_id "SS.2067.1"; exon_number "1"; cov "130.965347"; +CM143129.1 StringTie transcript 904037 907860 1000 . . gene_id "SS.2068"; transcript_id "SS.2068.1"; cov "1644.912395"; FPKM "80.443617"; TPM "172.016347"; +CM143129.1 StringTie exon 904037 907860 1000 . . gene_id "SS.2068"; transcript_id "SS.2068.1"; exon_number "1"; cov "1644.912354"; +CM143129.1 StringTie transcript 913899 914272 1000 . . gene_id "SS.2069"; transcript_id "SS.2069.1"; cov "58.084830"; FPKM "2.840610"; TPM "6.074208"; +CM143129.1 StringTie exon 913899 914272 1000 . . gene_id "SS.2069"; transcript_id "SS.2069.1"; exon_number "1"; cov "58.084831"; +CM143129.1 StringTie transcript 915087 917286 1000 . . gene_id "SS.2070"; transcript_id "SS.2070.1"; cov "214.480909"; FPKM "10.489081"; TPM "22.429293"; +CM143129.1 StringTie exon 915087 917286 1000 . . gene_id "SS.2070"; transcript_id "SS.2070.1"; exon_number "1"; cov "214.480911"; +CM143129.1 StringTie transcript 917498 918343 1000 . . gene_id "SS.2071"; transcript_id "SS.2071.1"; cov "4.932624"; FPKM "0.241228"; TPM "0.515828"; +CM143129.1 StringTie exon 917498 918343 1000 . . gene_id "SS.2071"; transcript_id "SS.2071.1"; exon_number "1"; cov "4.932624"; +CM143129.1 StringTie transcript 918723 920198 1000 . . gene_id "SS.2072"; transcript_id "SS.2072.1"; cov "475.116531"; FPKM "23.235336"; TPM "49.685205"; +CM143129.1 StringTie exon 918723 920198 1000 . . gene_id "SS.2072"; transcript_id "SS.2072.1"; exon_number "1"; cov "475.116516"; +CM143129.1 StringTie transcript 920688 921964 1000 . . gene_id "SS.2073"; transcript_id "SS.2073.1"; cov "808.039154"; FPKM "39.516750"; TPM "84.500514"; +CM143129.1 StringTie exon 920688 921964 1000 . . gene_id "SS.2073"; transcript_id "SS.2073.1"; exon_number "1"; cov "808.039185"; +CM143129.1 StringTie transcript 931589 933019 1000 . . gene_id "SS.2074"; transcript_id "SS.2074.1"; cov "9125.058700"; FPKM "446.256428"; TPM "954.250977"; +CM143129.1 StringTie exon 931589 933019 1000 . . gene_id "SS.2074"; transcript_id "SS.2074.1"; exon_number "1"; cov "9125.058594"; +CM143129.1 StringTie transcript 934347 942346 1000 . . gene_id "SS.2075"; transcript_id "SS.2075.1"; cov "302.682375"; FPKM "14.802530"; TPM "31.652942"; +CM143129.1 StringTie exon 934347 942346 1000 . . gene_id "SS.2075"; transcript_id "SS.2075.1"; exon_number "1"; cov "302.682373"; +CM143129.1 StringTie transcript 942562 949463 1000 . . gene_id "SS.2076"; transcript_id "SS.2076.1"; cov "378.990727"; FPKM "18.534352"; TPM "39.632871"; +CM143129.1 StringTie exon 942562 949463 1000 . . gene_id "SS.2076"; transcript_id "SS.2076.1"; exon_number "1"; cov "378.990723"; +CM143129.1 StringTie transcript 950205 957106 1000 . . gene_id "SS.2077"; transcript_id "SS.2077.1"; cov "293.573747"; FPKM "14.357077"; TPM "30.700409"; +CM143129.1 StringTie exon 950205 957106 1000 . . gene_id "SS.2077"; transcript_id "SS.2077.1"; exon_number "1"; cov "293.573761"; +CM143129.1 StringTie transcript 960179 961720 1000 + . gene_id "SS.2078"; transcript_id "SS.2078.1"; cov "1763.667343"; FPKM "86.251269"; TPM "184.435119"; +CM143129.1 StringTie exon 960179 960276 1000 + . gene_id "SS.2078"; transcript_id "SS.2078.1"; exon_number "1"; cov "178.551025"; +CM143129.1 StringTie exon 960340 961720 1000 + . gene_id "SS.2078"; transcript_id "SS.2078.1"; exon_number "2"; cov "1876.152100"; +CM143129.1 StringTie transcript 962012 964638 1000 . . gene_id "SS.2079"; transcript_id "SS.2079.1"; cov "376.703083"; FPKM "18.422476"; TPM "39.393641"; +CM143129.1 StringTie exon 962012 964638 1000 . . gene_id "SS.2079"; transcript_id "SS.2079.1"; exon_number "1"; cov "376.703094"; +CM143129.1 StringTie transcript 964968 965823 1000 . . gene_id "SS.2080"; transcript_id "SS.2080.1"; cov "1353.675234"; FPKM "66.200810"; TPM "141.560286"; +CM143129.1 StringTie exon 964968 965823 1000 . . gene_id "SS.2080"; transcript_id "SS.2080.1"; exon_number "1"; cov "1353.675293"; +CM143129.1 StringTie transcript 966386 975195 1000 . . gene_id "SS.2081"; transcript_id "SS.2081.1"; cov "372.027015"; FPKM "18.193795"; TPM "38.904642"; +CM143129.1 StringTie exon 966386 975195 1000 . . gene_id "SS.2081"; transcript_id "SS.2081.1"; exon_number "1"; cov "372.027008"; +CM143129.1 StringTie transcript 977854 979553 1000 . . gene_id "SS.2082"; transcript_id "SS.2082.1"; cov "603.465882"; FPKM "29.512197"; TPM "63.107310"; +CM143129.1 StringTie exon 977854 979553 1000 . . gene_id "SS.2082"; transcript_id "SS.2082.1"; exon_number "1"; cov "603.465881"; +CM143129.1 StringTie transcript 980229 981958 1000 . . gene_id "SS.2083"; transcript_id "SS.2083.1"; cov "345.601734"; FPKM "16.901480"; TPM "36.141224"; +CM143129.1 StringTie exon 980229 981958 1000 . . gene_id "SS.2083"; transcript_id "SS.2083.1"; exon_number "1"; cov "345.601746"; +CM143129.1 StringTie transcript 985554 986825 1000 . . gene_id "SS.2084"; transcript_id "SS.2084.1"; cov "4256.709119"; FPKM "208.172229"; TPM "445.144406"; +CM143129.1 StringTie exon 985554 986825 1000 . . gene_id "SS.2084"; transcript_id "SS.2084.1"; exon_number "1"; cov "4256.708984"; +CM143129.1 StringTie transcript 985554 987907 1000 + . gene_id "SS.2085"; transcript_id "SS.2085.1"; cov "3043.093386"; FPKM "148.820959"; TPM "318.230812"; +CM143129.1 StringTie exon 985554 987154 1000 + . gene_id "SS.2085"; transcript_id "SS.2085.1"; exon_number "1"; cov "2556.683594"; +CM143129.1 StringTie exon 987279 987907 1000 + . gene_id "SS.2085"; transcript_id "SS.2085.1"; exon_number "2"; cov "4281.157227"; +CM143129.1 StringTie transcript 988369 990262 1000 . . gene_id "SS.2086"; transcript_id "SS.2086.1"; cov "7673.586589"; FPKM "375.272911"; TPM "802.463605"; +CM143129.1 StringTie exon 988369 990262 1000 . . gene_id "SS.2086"; transcript_id "SS.2086.1"; exon_number "1"; cov "7673.586426"; +CM143129.1 StringTie transcript 991660 995852 1000 . . gene_id "SS.2087"; transcript_id "SS.2087.1"; cov "253.367994"; FPKM "12.390835"; TPM "26.495901"; +CM143129.1 StringTie exon 991660 995852 1000 . . gene_id "SS.2087"; transcript_id "SS.2087.1"; exon_number "1"; cov "253.367996"; +CM143129.1 StringTie transcript 996207 1003137 1000 . . gene_id "SS.2088"; transcript_id "SS.2088.1"; cov "946.220747"; FPKM "46.274452"; TPM "98.950823"; +CM143129.1 StringTie exon 996207 1003137 1000 . . gene_id "SS.2088"; transcript_id "SS.2088.1"; exon_number "1"; cov "946.220764"; +CM143129.1 StringTie transcript 1003432 1006075 1000 . . gene_id "SS.2089"; transcript_id "SS.2089.1"; cov "839.188351"; FPKM "41.040086"; TPM "87.757935"; +CM143129.1 StringTie exon 1003432 1006075 1000 . . gene_id "SS.2089"; transcript_id "SS.2089.1"; exon_number "1"; cov "839.188354"; +CM143129.1 StringTie transcript 1006475 1014587 1000 . . gene_id "SS.2090"; transcript_id "SS.2090.1"; cov "65.792925"; FPKM "3.217570"; TPM "6.880280"; +CM143129.1 StringTie exon 1006475 1014587 1000 . . gene_id "SS.2090"; transcript_id "SS.2090.1"; exon_number "1"; cov "65.792923"; +CM143129.1 StringTie transcript 1018992 1019502 1000 . . gene_id "SS.2091"; transcript_id "SS.2091.1"; cov "6034.845401"; FPKM "295.131093"; TPM "631.092611"; +CM143129.1 StringTie exon 1018992 1019502 1000 . . gene_id "SS.2091"; transcript_id "SS.2091.1"; exon_number "1"; cov "6034.845215"; +CM143129.1 StringTie transcript 1020927 1022648 1000 - . gene_id "SS.2092"; transcript_id "SS.2092.1"; cov "12499.031108"; FPKM "611.258859"; TPM "1307.083389"; +CM143129.1 StringTie exon 1020927 1022197 1000 - . gene_id "SS.2092"; transcript_id "SS.2092.1"; exon_number "1"; cov "12817.247070"; +CM143129.1 StringTie exon 1022602 1022648 1000 - . gene_id "SS.2092"; transcript_id "SS.2092.1"; exon_number "2"; cov "3893.659668"; +CM143129.1 StringTie transcript 803813 805572 1000 . . gene_id "SS.2093"; transcript_id "SS.2093.1"; cov "133876.572727"; FPKM "6547.166770"; TPM "14000.112719"; +CM143129.1 StringTie exon 803813 805572 1000 . . gene_id "SS.2093"; transcript_id "SS.2093.1"; exon_number "1"; cov "133876.578125"; +CM143129.1 StringTie transcript 806230 813997 1000 . . gene_id "SS.2094"; transcript_id "SS.2094.1"; cov "69558.212152"; FPKM "3401.709544"; TPM "7274.034514"; +CM143129.1 StringTie exon 806230 813997 1000 . . gene_id "SS.2094"; transcript_id "SS.2094.1"; exon_number "1"; cov "69558.210938"; +CM143129.1 StringTie transcript 806230 822422 1000 + . gene_id "SS.2095"; transcript_id "SS.2095.1"; cov "6804.448923"; FPKM "332.768168"; TPM "711.573728"; +CM143129.1 StringTie exon 806230 809498 1000 + . gene_id "SS.2095"; transcript_id "SS.2095.1"; exon_number "1"; cov "7442.205078"; +CM143129.1 StringTie exon 813437 816718 1000 + . gene_id "SS.2095"; transcript_id "SS.2095.1"; exon_number "2"; cov "5676.622070"; +CM143129.1 StringTie exon 816774 817923 1000 + . gene_id "SS.2095"; transcript_id "SS.2095.1"; exon_number "3"; cov "7109.043457"; +CM143129.1 StringTie exon 821862 822422 1000 + . gene_id "SS.2095"; transcript_id "SS.2095.1"; exon_number "4"; cov "9061.880859"; +CM143129.1 StringTie transcript 814654 822422 1000 + . gene_id "SS.2095"; transcript_id "SS.2095.2"; cov "83318.968416"; FPKM "4074.672441"; TPM "8713.062530"; +CM143129.1 StringTie exon 814654 817923 1000 + . gene_id "SS.2095"; transcript_id "SS.2095.2"; exon_number "1"; cov "76886.320312"; +CM143129.1 StringTie exon 821862 822422 1000 + . gene_id "SS.2095"; transcript_id "SS.2095.2"; exon_number "2"; cov "120814.078125"; +CM143129.1 StringTie transcript 814654 829414 1000 + . gene_id "SS.2095"; transcript_id "SS.2095.3"; cov "9670.885773"; FPKM "472.949827"; TPM "1011.330722"; +CM143129.1 StringTie exon 814654 816718 1000 + . gene_id "SS.2095"; transcript_id "SS.2095.3"; exon_number "1"; cov "17675.324219"; +CM143129.1 StringTie exon 816774 817923 1000 + . gene_id "SS.2095"; transcript_id "SS.2095.3"; exon_number "2"; cov "24709.824219"; +CM143129.1 StringTie exon 821862 829414 1000 + . gene_id "SS.2095"; transcript_id "SS.2095.3"; exon_number "3"; cov "5192.672363"; +CM143129.1 StringTie transcript 823078 826747 1000 . . gene_id "SS.2096"; transcript_id "SS.2096.1"; cov "89126.007629"; FPKM "4358.662787"; TPM "9320.332360"; +CM143129.1 StringTie exon 823078 826747 1000 . . gene_id "SS.2096"; transcript_id "SS.2096.1"; exon_number "1"; cov "89126.007812"; +CM143129.1 StringTie transcript 1023201 1032271 1000 . . gene_id "SS.2097"; transcript_id "SS.2097.1"; cov "226.042774"; FPKM "11.054509"; TPM "23.638373"; +CM143129.1 StringTie exon 1023201 1032271 1000 . . gene_id "SS.2097"; transcript_id "SS.2097.1"; exon_number "1"; cov "226.042770"; +CM143129.1 StringTie transcript 1032601 1035138 1000 . . gene_id "SS.2098"; transcript_id "SS.2098.1"; cov "1072.986210"; FPKM "52.473853"; TPM "112.207293"; +CM143129.1 StringTie exon 1032601 1035138 1000 . . gene_id "SS.2098"; transcript_id "SS.2098.1"; exon_number "1"; cov "1072.986206"; +CM143129.1 StringTie transcript 1035885 1040192 1000 - . gene_id "SS.2099"; transcript_id "SS.2099.1"; cov "36.732142"; FPKM "1.796367"; TPM "3.841256"; +CM143129.1 StringTie exon 1035885 1036010 1000 - . gene_id "SS.2099"; transcript_id "SS.2099.1"; exon_number "1"; cov "125.896828"; +CM143129.1 StringTie exon 1037534 1040192 1000 - . gene_id "SS.2099"; transcript_id "SS.2099.1"; exon_number "2"; cov "32.506962"; +CM143129.1 StringTie transcript 1037165 1040192 1000 . . gene_id "SS.2100"; transcript_id "SS.2100.1"; cov "294.243065"; FPKM "14.389810"; TPM "30.770403"; +CM143129.1 StringTie exon 1037165 1040192 1000 . . gene_id "SS.2100"; transcript_id "SS.2100.1"; exon_number "1"; cov "294.243073"; +CM143129.1 StringTie transcript 1040519 1042691 1000 . . gene_id "SS.2101"; transcript_id "SS.2101.1"; cov "559.306374"; FPKM "27.352598"; TPM "58.489339"; +CM143129.1 StringTie exon 1040519 1042691 1000 . . gene_id "SS.2101"; transcript_id "SS.2101.1"; exon_number "1"; cov "559.306396"; +CM143129.1 StringTie transcript 1043114 1044517 1000 . . gene_id "SS.2102"; transcript_id "SS.2102.1"; cov "202.209402"; FPKM "9.888950"; TPM "21.146003"; +CM143129.1 StringTie exon 1043114 1044517 1000 . . gene_id "SS.2102"; transcript_id "SS.2102.1"; exon_number "1"; cov "202.209396"; +CM143129.1 StringTie transcript 1045095 1047835 1000 . . gene_id "SS.2103"; transcript_id "SS.2103.1"; cov "605.167685"; FPKM "29.595423"; TPM "63.285276"; +CM143129.1 StringTie exon 1045095 1047835 1000 . . gene_id "SS.2103"; transcript_id "SS.2103.1"; exon_number "1"; cov "605.167664"; +CM143129.1 StringTie transcript 1045095 1047835 1000 + . gene_id "SS.2104"; transcript_id "SS.2104.1"; cov "238.126157"; FPKM "11.645441"; TPM "24.901990"; +CM143129.1 StringTie exon 1045095 1046859 1000 + . gene_id "SS.2104"; transcript_id "SS.2104.1"; exon_number "1"; cov "107.846176"; +CM143129.1 StringTie exon 1046927 1047835 1000 + . gene_id "SS.2104"; transcript_id "SS.2104.1"; exon_number "2"; cov "491.090027"; +CM143129.1 StringTie transcript 1048114 1048667 1000 . . gene_id "SS.2105"; transcript_id "SS.2105.1"; cov "2557.048736"; FPKM "125.051188"; TPM "267.402801"; +CM143129.1 StringTie exon 1048114 1048667 1000 . . gene_id "SS.2105"; transcript_id "SS.2105.1"; exon_number "1"; cov "2557.048828"; +CM143129.1 StringTie transcript 1048887 1049930 1000 . . gene_id "SS.2106"; transcript_id "SS.2106.1"; cov "451.498084"; FPKM "22.080288"; TPM "47.215311"; +CM143129.1 StringTie exon 1048887 1049930 1000 . . gene_id "SS.2106"; transcript_id "SS.2106.1"; exon_number "1"; cov "451.498077"; +CM143129.1 StringTie transcript 1050303 1052074 1000 . . gene_id "SS.2107"; transcript_id "SS.2107.1"; cov "491.051919"; FPKM "24.014648"; TPM "51.351645"; +CM143129.1 StringTie exon 1050303 1052074 1000 . . gene_id "SS.2107"; transcript_id "SS.2107.1"; exon_number "1"; cov "491.051910"; +CM143129.1 StringTie transcript 1056766 1058316 1000 . . gene_id "SS.2108"; transcript_id "SS.2108.1"; cov "7024.784655"; FPKM "343.543577"; TPM "734.615288"; +CM143129.1 StringTie exon 1056766 1058316 1000 . . gene_id "SS.2108"; transcript_id "SS.2108.1"; exon_number "1"; cov "7024.784668"; +CM143129.1 StringTie transcript 1058596 1065436 1000 . . gene_id "SS.2109"; transcript_id "SS.2109.1"; cov "336.444233"; FPKM "16.453637"; TPM "35.183581"; +CM143129.1 StringTie exon 1058596 1065436 1000 . . gene_id "SS.2109"; transcript_id "SS.2109.1"; exon_number "1"; cov "336.444244"; +CM143129.1 StringTie transcript 1066048 1067259 1000 + . gene_id "SS.2110"; transcript_id "SS.2110.1"; cov "14920.060744"; FPKM "729.658102"; TPM "1560.262023"; +CM143129.1 StringTie exon 1066048 1066268 1000 + . gene_id "SS.2110"; transcript_id "SS.2110.1"; exon_number "1"; cov "9850.458008"; +CM143129.1 StringTie exon 1066769 1067259 1000 + . gene_id "SS.2110"; transcript_id "SS.2110.1"; exon_number "2"; cov "17201.898438"; +CM143129.1 StringTie transcript 1067906 1068735 1000 - . gene_id "SS.2111"; transcript_id "SS.2111.1"; cov "869.552097"; FPKM "42.525010"; TPM "90.933217"; +CM143129.1 StringTie exon 1067906 1068401 1000 - . gene_id "SS.2111"; transcript_id "SS.2111.1"; exon_number "1"; cov "1133.866943"; +CM143129.1 StringTie exon 1068493 1068735 1000 - . gene_id "SS.2111"; transcript_id "SS.2111.1"; exon_number "2"; cov "330.045258"; +CM143129.1 StringTie transcript 1071371 1074636 1000 . . gene_id "SS.2112"; transcript_id "SS.2112.1"; cov "617.243340"; FPKM "30.185977"; TPM "64.548085"; +CM143129.1 StringTie exon 1071371 1074636 1000 . . gene_id "SS.2112"; transcript_id "SS.2112.1"; exon_number "1"; cov "617.243347"; +CM143129.1 StringTie transcript 1071371 1074636 1000 - . gene_id "SS.2113"; transcript_id "SS.2113.1"; cov "509.019035"; FPKM "24.893321"; TPM "53.230552"; +CM143129.1 StringTie exon 1071371 1074284 1000 - . gene_id "SS.2113"; transcript_id "SS.2113.1"; exon_number "1"; cov "477.176056"; +CM143129.1 StringTie exon 1074435 1074636 1000 - . gene_id "SS.2113"; transcript_id "SS.2113.1"; exon_number "2"; cov "968.377808"; +CM143129.1 StringTie transcript 1074851 1076143 1000 . . gene_id "SS.2114"; transcript_id "SS.2114.1"; cov "892.930201"; FPKM "43.668304"; TPM "93.377977"; +CM143129.1 StringTie exon 1074851 1076143 1000 . . gene_id "SS.2114"; transcript_id "SS.2114.1"; exon_number "1"; cov "892.930176"; +CM143129.1 StringTie transcript 1074851 1076159 1000 - . gene_id "SS.2115"; transcript_id "SS.2115.1"; cov "471.433625"; FPKM "23.055225"; TPM "49.300066"; +CM143129.1 StringTie exon 1074851 1075910 1000 - . gene_id "SS.2115"; transcript_id "SS.2115.1"; exon_number "1"; cov "508.378113"; +CM143129.1 StringTie exon 1076034 1076159 1000 - . gene_id "SS.2115"; transcript_id "SS.2115.1"; exon_number "2"; cov "160.630692"; +CM143129.1 StringTie transcript 1076424 1078239 1000 . . gene_id "SS.2116"; transcript_id "SS.2116.1"; cov "1788.753855"; FPKM "87.478112"; TPM "187.058535"; +CM143129.1 StringTie exon 1076424 1078239 1000 . . gene_id "SS.2116"; transcript_id "SS.2116.1"; exon_number "1"; cov "1788.753906"; +CM143129.1 StringTie transcript 1081775 1087344 1000 . . gene_id "SS.2117"; transcript_id "SS.2117.1"; cov "462.236445"; FPKM "22.605442"; TPM "48.338273"; +CM143129.1 StringTie exon 1081775 1087344 1000 . . gene_id "SS.2117"; transcript_id "SS.2117.1"; exon_number "1"; cov "462.236450"; +CM143129.1 StringTie transcript 1088541 1094270 1000 - . gene_id "SS.2118"; transcript_id "SS.2118.1"; cov "954.911584"; FPKM "46.699473"; TPM "99.859666"; +CM143129.1 StringTie exon 1088541 1093020 1000 - . gene_id "SS.2118"; transcript_id "SS.2118.1"; exon_number "1"; cov "1102.483765"; +CM143129.1 StringTie exon 1093098 1093125 1000 - . gene_id "SS.2118"; transcript_id "SS.2118.1"; exon_number "2"; cov "1731.428589"; +CM143129.1 StringTie exon 1093237 1094270 1000 - . gene_id "SS.2118"; transcript_id "SS.2118.1"; exon_number "3"; cov "294.500000"; +CM143129.1 StringTie transcript 1094696 1096721 1000 . . gene_id "SS.2119"; transcript_id "SS.2119.1"; cov "20037.538006"; FPKM "979.925765"; TPM "2095.421066"; +CM143129.1 StringTie exon 1094696 1096721 1000 . . gene_id "SS.2119"; transcript_id "SS.2119.1"; exon_number "1"; cov "20037.537109"; +CM143129.1 StringTie transcript 1104051 1104888 1000 . . gene_id "SS.2120"; transcript_id "SS.2120.1"; cov "4988.236277"; FPKM "243.947198"; TPM "521.643696"; +CM143129.1 StringTie exon 1104051 1104888 1000 . . gene_id "SS.2120"; transcript_id "SS.2120.1"; exon_number "1"; cov "4988.236328"; +CM143129.1 StringTie transcript 1105175 1107967 1000 . . gene_id "SS.2121"; transcript_id "SS.2121.1"; cov "231.609023"; FPKM "11.326723"; TPM "24.220462"; +CM143129.1 StringTie exon 1105175 1107967 1000 . . gene_id "SS.2121"; transcript_id "SS.2121.1"; exon_number "1"; cov "231.609024"; +CM143129.1 StringTie transcript 1108257 1111717 1000 . . gene_id "SS.2122"; transcript_id "SS.2122.1"; cov "1113.574400"; FPKM "54.458799"; TPM "116.451794"; +CM143129.1 StringTie exon 1108257 1111717 1000 . . gene_id "SS.2122"; transcript_id "SS.2122.1"; exon_number "1"; cov "1113.574341"; +CM143129.1 StringTie transcript 1111936 1115025 1000 . . gene_id "SS.2123"; transcript_id "SS.2123.1"; cov "954.205178"; FPKM "46.664927"; TPM "99.785794"; +CM143129.1 StringTie exon 1111936 1115025 1000 . . gene_id "SS.2123"; transcript_id "SS.2123.1"; exon_number "1"; cov "954.205200"; +CM143129.1 StringTie transcript 1115277 1133888 1000 . . gene_id "SS.2124"; transcript_id "SS.2124.1"; cov "419.783957"; FPKM "20.529324"; TPM "43.898814"; +CM143129.1 StringTie exon 1115277 1133888 1000 . . gene_id "SS.2124"; transcript_id "SS.2124.1"; exon_number "1"; cov "419.783966"; +CM143129.1 StringTie transcript 1134110 1141863 1000 . . gene_id "SS.2125"; transcript_id "SS.2125.1"; cov "522.363812"; FPKM "25.545941"; TPM "54.626079"; +CM143129.1 StringTie exon 1134110 1141863 1000 . . gene_id "SS.2125"; transcript_id "SS.2125.1"; exon_number "1"; cov "522.363831"; +CM143129.1 StringTie transcript 1142177 1147502 1000 . . gene_id "SS.2126"; transcript_id "SS.2126.1"; cov "634.791025"; FPKM "31.044137"; TPM "66.383130"; +CM143129.1 StringTie exon 1142177 1147502 1000 . . gene_id "SS.2126"; transcript_id "SS.2126.1"; exon_number "1"; cov "634.791016"; +CM143129.1 StringTie transcript 1147952 1151287 1000 . . gene_id "SS.2127"; transcript_id "SS.2127.1"; cov "457.807254"; FPKM "22.388835"; TPM "47.875091"; +CM143129.1 StringTie exon 1147952 1151287 1000 . . gene_id "SS.2127"; transcript_id "SS.2127.1"; exon_number "1"; cov "457.807251"; +CM143129.1 StringTie transcript 1151669 1165006 1000 . . gene_id "SS.2128"; transcript_id "SS.2128.1"; cov "873.399310"; FPKM "42.713156"; TPM "91.335538"; +CM143129.1 StringTie exon 1151669 1165006 1000 . . gene_id "SS.2128"; transcript_id "SS.2128.1"; exon_number "1"; cov "873.399292"; +CM143129.1 StringTie transcript 1165302 1167923 1000 . . gene_id "SS.2129"; transcript_id "SS.2129.1"; cov "356.859649"; FPKM "17.452042"; TPM "37.318518"; +CM143129.1 StringTie exon 1165302 1167923 1000 . . gene_id "SS.2129"; transcript_id "SS.2129.1"; exon_number "1"; cov "356.859650"; +CM143129.1 StringTie transcript 1168406 1174919 1000 . . gene_id "SS.2130"; transcript_id "SS.2130.1"; cov "523.062327"; FPKM "25.580101"; TPM "54.699126"; +CM143129.1 StringTie exon 1168406 1174919 1000 . . gene_id "SS.2130"; transcript_id "SS.2130.1"; exon_number "1"; cov "523.062317"; +CM143129.1 StringTie transcript 1175172 1175691 1000 . . gene_id "SS.2131"; transcript_id "SS.2131.1"; cov "9.186538"; FPKM "0.449263"; TPM "0.960680"; +CM143129.1 StringTie exon 1175172 1175691 1000 . . gene_id "SS.2131"; transcript_id "SS.2131.1"; exon_number "1"; cov "9.186539"; +CM143129.1 StringTie transcript 1178086 1178482 1000 . . gene_id "SS.2132"; transcript_id "SS.2132.1"; cov "872.269521"; FPKM "42.657904"; TPM "91.217391"; +CM143129.1 StringTie exon 1178086 1178482 1000 . . gene_id "SS.2132"; transcript_id "SS.2132.1"; exon_number "1"; cov "872.269531"; +CM143129.1 StringTie transcript 1179064 1181372 1000 . . gene_id "SS.2133"; transcript_id "SS.2133.1"; cov "1403.965786"; FPKM "68.660244"; TPM "146.819409"; +CM143129.1 StringTie exon 1179064 1181372 1000 . . gene_id "SS.2133"; transcript_id "SS.2133.1"; exon_number "1"; cov "1403.965820"; +CM143129.1 StringTie transcript 1182319 1183451 1000 . . gene_id "SS.2134"; transcript_id "SS.2134.1"; cov "17767.429832"; FPKM "868.907262"; TPM "1858.025010"; +CM143129.1 StringTie exon 1182319 1183451 1000 . . gene_id "SS.2134"; transcript_id "SS.2134.1"; exon_number "1"; cov "17767.429688"; +CM143129.1 StringTie transcript 1183668 1187660 1000 . . gene_id "SS.2135"; transcript_id "SS.2135.1"; cov "6105.400451"; FPKM "298.581553"; TPM "638.470890"; +CM143129.1 StringTie exon 1183668 1187660 1000 . . gene_id "SS.2135"; transcript_id "SS.2135.1"; exon_number "1"; cov "6105.400391"; +CM143129.1 StringTie transcript 1187953 1189043 1000 . . gene_id "SS.2136"; transcript_id "SS.2136.1"; cov "346.448213"; FPKM "16.942876"; TPM "36.229745"; +CM143129.1 StringTie exon 1187953 1189043 1000 . . gene_id "SS.2136"; transcript_id "SS.2136.1"; exon_number "1"; cov "346.448212"; +CM143129.1 StringTie transcript 1189358 1191572 1000 . . gene_id "SS.2137"; transcript_id "SS.2137.1"; cov "7290.417156"; FPKM "356.534201"; TPM "762.393747"; +CM143129.1 StringTie exon 1189358 1191572 1000 . . gene_id "SS.2137"; transcript_id "SS.2137.1"; exon_number "1"; cov "7290.416992"; +CM143129.1 StringTie transcript 1192128 1197728 1000 . . gene_id "SS.2138"; transcript_id "SS.2138.1"; cov "327.776111"; FPKM "16.029727"; TPM "34.277114"; +CM143129.1 StringTie exon 1192128 1197728 1000 . . gene_id "SS.2138"; transcript_id "SS.2138.1"; exon_number "1"; cov "327.776123"; +CM143129.1 StringTie transcript 1197974 1202090 1000 + . gene_id "SS.2139"; transcript_id "SS.2139.1"; cov "439.352809"; FPKM "21.486329"; TPM "45.945222"; +CM143129.1 StringTie exon 1197974 1198104 1000 + . gene_id "SS.2139"; transcript_id "SS.2139.1"; exon_number "1"; cov "197.580154"; +CM143129.1 StringTie exon 1198217 1202090 1000 + . gene_id "SS.2139"; transcript_id "SS.2139.1"; exon_number "2"; cov "447.528381"; +CM143129.1 StringTie transcript 1202376 1208802 1000 . . gene_id "SS.2140"; transcript_id "SS.2140.1"; cov "392.374047"; FPKM "19.188856"; TPM "41.032428"; +CM143129.1 StringTie exon 1202376 1208802 1000 . . gene_id "SS.2140"; transcript_id "SS.2140.1"; exon_number "1"; cov "392.374054"; +CM143129.1 StringTie transcript 1211273 1212089 1000 . . gene_id "SS.2141"; transcript_id "SS.2141.1"; cov "25770.447980"; FPKM "1260.290858"; TPM "2694.938847"; +CM143129.1 StringTie exon 1211273 1212089 1000 . . gene_id "SS.2141"; transcript_id "SS.2141.1"; exon_number "1"; cov "25770.447266"; +CM143129.1 StringTie transcript 1212662 1215113 1000 . . gene_id "SS.2142"; transcript_id "SS.2142.1"; cov "406.966966"; FPKM "19.902516"; TPM "42.558480"; +CM143129.1 StringTie exon 1212662 1215113 1000 . . gene_id "SS.2142"; transcript_id "SS.2142.1"; exon_number "1"; cov "406.966980"; +CM143129.1 StringTie transcript 1215445 1216298 1000 . . gene_id "SS.2143"; transcript_id "SS.2143.1"; cov "158.935597"; FPKM "7.772666"; TPM "16.620655"; +CM143129.1 StringTie exon 1215445 1216298 1000 . . gene_id "SS.2143"; transcript_id "SS.2143.1"; exon_number "1"; cov "158.935593"; +CM143129.1 StringTie transcript 1216979 1219592 1000 + . gene_id "SS.2144"; transcript_id "SS.2144.1"; cov "249.450099"; FPKM "12.199232"; TPM "26.086188"; +CM143129.1 StringTie exon 1216979 1217268 1000 + . gene_id "SS.2144"; transcript_id "SS.2144.1"; exon_number "1"; cov "137.513794"; +CM143129.1 StringTie exon 1217368 1219592 1000 + . gene_id "SS.2144"; transcript_id "SS.2144.1"; exon_number "2"; cov "264.039551"; +CM143129.1 StringTie transcript 1219978 1228114 1000 . . gene_id "SS.2145"; transcript_id "SS.2145.1"; cov "863.347917"; FPKM "42.221598"; TPM "90.284416"; +CM143129.1 StringTie exon 1219978 1228114 1000 . . gene_id "SS.2145"; transcript_id "SS.2145.1"; exon_number "1"; cov "863.347900"; +CM143129.1 StringTie transcript 1225984 1230357 1000 + . gene_id "SS.2146"; transcript_id "SS.2146.1"; cov "344.398957"; FPKM "16.842659"; TPM "36.015444"; +CM143129.1 StringTie exon 1225984 1229300 1000 + . gene_id "SS.2146"; transcript_id "SS.2146.1"; exon_number "1"; cov "273.556274"; +CM143129.1 StringTie exon 1229386 1230357 1000 + . gene_id "SS.2146"; transcript_id "SS.2146.1"; exon_number "2"; cov "586.153320"; +CM143129.1 StringTie transcript 1230676 1235992 1000 . . gene_id "SS.2147"; transcript_id "SS.2147.1"; cov "185.641903"; FPKM "9.078724"; TPM "19.413461"; +CM143129.1 StringTie exon 1230676 1235992 1000 . . gene_id "SS.2147"; transcript_id "SS.2147.1"; exon_number "1"; cov "185.641907"; +CM143129.1 StringTie transcript 1236361 1238147 1000 . . gene_id "SS.2148"; transcript_id "SS.2148.1"; cov "378.113039"; FPKM "18.491429"; TPM "39.541087"; +CM143129.1 StringTie exon 1236361 1238147 1000 . . gene_id "SS.2148"; transcript_id "SS.2148.1"; exon_number "1"; cov "378.113037"; +CM143129.1 StringTie transcript 1238376 1240512 1000 . . gene_id "SS.2149"; transcript_id "SS.2149.1"; cov "308.498362"; FPKM "15.086958"; TPM "32.261147"; +CM143129.1 StringTie exon 1238376 1240512 1000 . . gene_id "SS.2149"; transcript_id "SS.2149.1"; exon_number "1"; cov "308.498352"; +CM143129.1 StringTie transcript 1240857 1245886 1000 - . gene_id "SS.2150"; transcript_id "SS.2150.1"; cov "172.303910"; FPKM "8.426436"; TPM "18.018643"; +CM143129.1 StringTie exon 1240857 1244835 1000 - . gene_id "SS.2150"; transcript_id "SS.2150.1"; exon_number "1"; cov "193.928619"; +CM143129.1 StringTie exon 1244904 1245886 1000 - . gene_id "SS.2150"; transcript_id "SS.2150.1"; exon_number "2"; cov "84.771111"; +CM143129.1 StringTie transcript 1277311 1277942 1000 . . gene_id "SS.2151"; transcript_id "SS.2151.1"; cov "1907.650316"; FPKM "93.292684"; TPM "199.492106"; +CM143129.1 StringTie exon 1277311 1277942 1000 . . gene_id "SS.2151"; transcript_id "SS.2151.1"; exon_number "1"; cov "1907.650269"; +CM143129.1 StringTie transcript 1246188 1253778 1000 . . gene_id "SS.2152"; transcript_id "SS.2152.1"; cov "428.045712"; FPKM "20.933361"; TPM "44.762785"; +CM143129.1 StringTie exon 1246188 1253778 1000 . . gene_id "SS.2152"; transcript_id "SS.2152.1"; exon_number "1"; cov "428.045715"; +CM143129.1 StringTie transcript 1254176 1255116 1000 . . gene_id "SS.2153"; transcript_id "SS.2153.1"; cov "13780.768332"; FPKM "673.941577"; TPM "1441.120773"; +CM143129.1 StringTie exon 1254176 1255116 1000 . . gene_id "SS.2153"; transcript_id "SS.2153.1"; exon_number "1"; cov "13780.768555"; +CM143129.1 StringTie transcript 1257732 1258909 1000 . . gene_id "SS.2154"; transcript_id "SS.2154.1"; cov "1430.516978"; FPKM "69.958717"; TPM "149.595994"; +CM143129.1 StringTie exon 1257732 1258909 1000 . . gene_id "SS.2154"; transcript_id "SS.2154.1"; exon_number "1"; cov "1430.516968"; +CM143129.1 StringTie transcript 1259209 1272668 1000 . . gene_id "SS.2155"; transcript_id "SS.2155.1"; cov "897.446805"; FPKM "43.889187"; TPM "93.850299"; +CM143129.1 StringTie exon 1259209 1272668 1000 . . gene_id "SS.2155"; transcript_id "SS.2155.1"; exon_number "1"; cov "897.446777"; +CM143129.1 StringTie transcript 1273216 1275310 1000 . . gene_id "SS.2156"; transcript_id "SS.2156.1"; cov "736.146062"; FPKM "36.000855"; TPM "76.982310"; +CM143129.1 StringTie exon 1273216 1275310 1000 . . gene_id "SS.2156"; transcript_id "SS.2156.1"; exon_number "1"; cov "736.146057"; +CM143129.1 StringTie transcript 1275608 1276987 1000 . . gene_id "SS.2157"; transcript_id "SS.2157.1"; cov "876.828986"; FPKM "42.880883"; TPM "91.694196"; +CM143129.1 StringTie exon 1275608 1276987 1000 . . gene_id "SS.2157"; transcript_id "SS.2157.1"; exon_number "1"; cov "876.828979"; +CM143129.1 StringTie transcript 1278327 1285551 1000 . . gene_id "SS.2158"; transcript_id "SS.2158.1"; cov "87.868512"; FPKM "4.297166"; TPM "9.188830"; +CM143129.1 StringTie exon 1278327 1285551 1000 . . gene_id "SS.2158"; transcript_id "SS.2158.1"; exon_number "1"; cov "87.868515"; +CM143129.1 StringTie transcript 1289916 1292951 1000 + . gene_id "SS.2159"; transcript_id "SS.2159.1"; cov "1042.140423"; FPKM "50.965356"; TPM "108.981602"; +CM143129.1 StringTie exon 1289916 1289998 1000 + . gene_id "SS.2159"; transcript_id "SS.2159.1"; exon_number "1"; cov "189.469879"; +CM143129.1 StringTie exon 1290101 1292951 1000 + . gene_id "SS.2159"; transcript_id "SS.2159.1"; exon_number "2"; cov "1066.963867"; +CM143129.1 StringTie transcript 1298612 1299537 1000 . . gene_id "SS.2160"; transcript_id "SS.2160.1"; cov "5920.146868"; FPKM "289.521819"; TPM "619.098038"; +CM143129.1 StringTie exon 1298612 1299537 1000 . . gene_id "SS.2160"; transcript_id "SS.2160.1"; exon_number "1"; cov "5920.146973"; +CM143129.1 StringTie transcript 1301967 1303392 1000 . . gene_id "SS.2161"; transcript_id "SS.2161.1"; cov "509.232118"; FPKM "24.903742"; TPM "53.252835"; +CM143129.1 StringTie exon 1301967 1303392 1000 . . gene_id "SS.2161"; transcript_id "SS.2161.1"; exon_number "1"; cov "509.232117"; +CM143129.1 StringTie transcript 1303731 1305344 1000 . . gene_id "SS.2162"; transcript_id "SS.2162.1"; cov "501.775093"; FPKM "24.539060"; TPM "52.473018"; +CM143129.1 StringTie exon 1303731 1305344 1000 . . gene_id "SS.2162"; transcript_id "SS.2162.1"; exon_number "1"; cov "501.775085"; +CM143129.1 StringTie transcript 1306813 1311351 1000 - . gene_id "SS.2163"; transcript_id "SS.2163.1"; cov "475.606774"; FPKM "23.259311"; TPM "49.736472"; +CM143129.1 StringTie exon 1306813 1311199 1000 - . gene_id "SS.2163"; transcript_id "SS.2163.1"; exon_number "1"; cov "477.870056"; +CM143129.1 StringTie exon 1311281 1311351 1000 - . gene_id "SS.2163"; transcript_id "SS.2163.1"; exon_number "2"; cov "335.760559"; +CM143129.1 StringTie transcript 1316827 1317541 1000 . . gene_id "SS.2164"; transcript_id "SS.2164.1"; cov "2417.076923"; FPKM "118.205937"; TPM "252.765280"; +CM143129.1 StringTie exon 1316827 1317541 1000 . . gene_id "SS.2164"; transcript_id "SS.2164.1"; exon_number "1"; cov "2417.076904"; +CM143129.1 StringTie transcript 1318640 1320062 1000 . . gene_id "SS.2165"; transcript_id "SS.2165.1"; cov "7181.568517"; FPKM "351.211013"; TPM "751.010925"; +CM143129.1 StringTie exon 1318640 1320062 1000 . . gene_id "SS.2165"; transcript_id "SS.2165.1"; exon_number "1"; cov "7181.568359"; +CM143129.1 StringTie transcript 1323466 1324895 1000 . . gene_id "SS.2166"; transcript_id "SS.2166.1"; cov "6318.469930"; FPKM "309.001609"; TPM "660.752583"; +CM143129.1 StringTie exon 1323466 1324895 1000 . . gene_id "SS.2166"; transcript_id "SS.2166.1"; exon_number "1"; cov "6318.469727"; +CM143129.1 StringTie transcript 1327161 1329203 1000 . . gene_id "SS.2167"; transcript_id "SS.2167.1"; cov "1677.685267"; FPKM "82.046358"; TPM "175.443562"; +CM143129.1 StringTie exon 1327161 1329203 1000 . . gene_id "SS.2167"; transcript_id "SS.2167.1"; exon_number "1"; cov "1677.685303"; +CM143129.1 StringTie transcript 1336570 1337559 1000 + . gene_id "SS.2168"; transcript_id "SS.2168.1"; cov "13.840217"; FPKM "0.676849"; TPM "1.447338"; +CM143129.1 StringTie exon 1336570 1336733 1000 + . gene_id "SS.2168"; transcript_id "SS.2168.1"; exon_number "1"; cov "23.079268"; +CM143129.1 StringTie exon 1336804 1337559 1000 + . gene_id "SS.2168"; transcript_id "SS.2168.1"; exon_number "2"; cov "11.835979"; +CM143129.1 StringTie transcript 1338390 1345214 1000 . . gene_id "SS.2169"; transcript_id "SS.2169.1"; cov "908.343150"; FPKM "44.422067"; TPM "94.989782"; +CM143129.1 StringTie exon 1338390 1345214 1000 . . gene_id "SS.2169"; transcript_id "SS.2169.1"; exon_number "1"; cov "908.343140"; +CM143129.1 StringTie transcript 1345566 1347825 1000 + . gene_id "SS.2170"; transcript_id "SS.2170.1"; cov "628.103226"; FPKM "30.717074"; TPM "65.683755"; +CM143129.1 StringTie exon 1345566 1345655 1000 + . gene_id "SS.2170"; transcript_id "SS.2170.1"; exon_number "1"; cov "38.933334"; +CM143129.1 StringTie exon 1345746 1347825 1000 + . gene_id "SS.2170"; transcript_id "SS.2170.1"; exon_number "2"; cov "653.596130"; +CM143129.1 StringTie transcript 1348478 1351345 1000 . . gene_id "SS.2171"; transcript_id "SS.2171.1"; cov "777.512901"; FPKM "38.023879"; TPM "81.308238"; +CM143129.1 StringTie exon 1348478 1351345 1000 . . gene_id "SS.2171"; transcript_id "SS.2171.1"; exon_number "1"; cov "777.512878"; +CM143129.1 StringTie transcript 1358323 1363406 1000 . . gene_id "SS.2172"; transcript_id "SS.2172.1"; cov "318.674076"; FPKM "15.584596"; TPM "33.325270"; +CM143129.1 StringTie exon 1358323 1363406 1000 . . gene_id "SS.2172"; transcript_id "SS.2172.1"; exon_number "1"; cov "318.674072"; +CM143129.1 StringTie transcript 1363695 1365939 1000 . . gene_id "SS.2173"; transcript_id "SS.2173.1"; cov "731.819154"; FPKM "35.789249"; TPM "76.529825"; +CM143129.1 StringTie exon 1363695 1365939 1000 . . gene_id "SS.2173"; transcript_id "SS.2173.1"; exon_number "1"; cov "731.819153"; +CM143129.1 StringTie transcript 1366146 1370036 1000 . . gene_id "SS.2174"; transcript_id "SS.2174.1"; cov "992.342071"; FPKM "48.529992"; TPM "103.773951"; +CM143129.1 StringTie exon 1366146 1370036 1000 . . gene_id "SS.2174"; transcript_id "SS.2174.1"; exon_number "1"; cov "992.342041"; +CM143129.1 StringTie transcript 1431324 1431762 1000 . . gene_id "SS.2175"; transcript_id "SS.2175.1"; cov "17.312073"; FPKM "0.846638"; TPM "1.810406"; +CM143129.1 StringTie exon 1431324 1431762 1000 . . gene_id "SS.2175"; transcript_id "SS.2175.1"; exon_number "1"; cov "17.312073"; +CM143129.1 StringTie transcript 1370750 1376571 1000 . . gene_id "SS.2176"; transcript_id "SS.2176.1"; cov "532.404157"; FPKM "26.036959"; TPM "55.676046"; +CM143129.1 StringTie exon 1370750 1376571 1000 . . gene_id "SS.2176"; transcript_id "SS.2176.1"; exon_number "1"; cov "532.404175"; +CM143129.1 StringTie transcript 1376899 1379598 1000 + . gene_id "SS.2177"; transcript_id "SS.2177.1"; cov "7071.642286"; FPKM "345.835126"; TPM "739.515414"; +CM143129.1 StringTie exon 1376899 1377098 1000 + . gene_id "SS.2177"; transcript_id "SS.2177.1"; exon_number "1"; cov "2823.225098"; +CM143129.1 StringTie exon 1377174 1379598 1000 + . gene_id "SS.2177"; transcript_id "SS.2177.1"; exon_number "2"; cov "7422.027344"; +CM143129.1 StringTie transcript 1379824 1382057 1000 . . gene_id "SS.2178"; transcript_id "SS.2178.1"; cov "1535.185318"; FPKM "75.077469"; TPM "160.541662"; +CM143129.1 StringTie exon 1379824 1382057 1000 . . gene_id "SS.2178"; transcript_id "SS.2178.1"; exon_number "1"; cov "1535.185303"; +CM143129.1 StringTie transcript 1382466 1383529 1000 . . gene_id "SS.2179"; transcript_id "SS.2179.1"; cov "6871.981203"; FPKM "336.070801"; TPM "718.635901"; +CM143129.1 StringTie exon 1382466 1383529 1000 . . gene_id "SS.2179"; transcript_id "SS.2179.1"; exon_number "1"; cov "6871.981445"; +CM143129.1 StringTie transcript 1383690 1384436 1000 . . gene_id "SS.2180"; transcript_id "SS.2180.1"; cov "62.230254"; FPKM "3.043339"; TPM "6.507715"; +CM143129.1 StringTie exon 1383690 1384436 1000 . . gene_id "SS.2180"; transcript_id "SS.2180.1"; exon_number "1"; cov "62.230255"; +CM143129.1 StringTie transcript 1384706 1386633 1000 . . gene_id "SS.2181"; transcript_id "SS.2181.1"; cov "676.273340"; FPKM "33.072809"; TPM "70.721134"; +CM143129.1 StringTie exon 1384706 1386633 1000 . . gene_id "SS.2181"; transcript_id "SS.2181.1"; exon_number "1"; cov "676.273315"; +CM143129.1 StringTie transcript 1387784 1389434 1000 . . gene_id "SS.2182"; transcript_id "SS.2182.1"; cov "308.506965"; FPKM "15.087379"; TPM "32.262047"; +CM143129.1 StringTie exon 1387784 1389434 1000 . . gene_id "SS.2182"; transcript_id "SS.2182.1"; exon_number "1"; cov "308.506958"; +CM143129.1 StringTie transcript 1389670 1410649 1000 . . gene_id "SS.2183"; transcript_id "SS.2183.1"; cov "626.576168"; FPKM "30.642394"; TPM "65.524063"; +CM143129.1 StringTie exon 1389670 1410649 1000 . . gene_id "SS.2183"; transcript_id "SS.2183.1"; exon_number "1"; cov "626.576172"; +CM143129.1 StringTie transcript 1389670 1405945 1000 - . gene_id "SS.2184"; transcript_id "SS.2184.1"; cov "106.576136"; FPKM "5.212053"; TPM "11.145176"; +CM143129.1 StringTie exon 1389670 1394055 1000 - . gene_id "SS.2184"; transcript_id "SS.2184.1"; exon_number "1"; cov "104.578232"; +CM143129.1 StringTie exon 1394139 1405945 1000 - . gene_id "SS.2184"; transcript_id "SS.2184.1"; exon_number "2"; cov "107.318306"; +CM143129.1 StringTie transcript 1411087 1414577 1000 - . gene_id "SS.2185"; transcript_id "SS.2185.1"; cov "1114.332157"; FPKM "54.495856"; TPM "116.531037"; +CM143129.1 StringTie exon 1411087 1414348 1000 - . gene_id "SS.2185"; transcript_id "SS.2185.1"; exon_number "1"; cov "1132.122681"; +CM143129.1 StringTie exon 1414441 1414577 1000 - . gene_id "SS.2185"; transcript_id "SS.2185.1"; exon_number "2"; cov "690.737244"; +CM143129.1 StringTie transcript 1415034 1416435 1000 . . gene_id "SS.2186"; transcript_id "SS.2186.1"; cov "763.468616"; FPKM "37.337050"; TPM "79.839560"; +CM143129.1 StringTie exon 1415034 1416435 1000 . . gene_id "SS.2186"; transcript_id "SS.2186.1"; exon_number "1"; cov "763.468628"; +CM143129.1 StringTie transcript 1416765 1421036 1000 . . gene_id "SS.2187"; transcript_id "SS.2187.1"; cov "234.884129"; FPKM "11.486891"; TPM "24.562955"; +CM143129.1 StringTie exon 1416765 1421036 1000 . . gene_id "SS.2187"; transcript_id "SS.2187.1"; exon_number "1"; cov "234.884125"; +CM143129.1 StringTie transcript 1421250 1428221 1000 . . gene_id "SS.2188"; transcript_id "SS.2188.1"; cov "265.725330"; FPKM "12.995164"; TPM "27.788167"; +CM143129.1 StringTie exon 1421250 1428221 1000 . . gene_id "SS.2188"; transcript_id "SS.2188.1"; exon_number "1"; cov "265.725342"; +CM143129.1 StringTie transcript 1428606 1429526 1000 . . gene_id "SS.2189"; transcript_id "SS.2189.1"; cov "619.603692"; FPKM "30.301408"; TPM "64.794918"; +CM143129.1 StringTie exon 1428606 1429526 1000 . . gene_id "SS.2189"; transcript_id "SS.2189.1"; exon_number "1"; cov "619.603699"; +CM143129.1 StringTie transcript 1451413 1452019 1000 . . gene_id "SS.2190"; transcript_id "SS.2190.1"; cov "504.942339"; FPKM "24.693952"; TPM "52.804232"; +CM143129.1 StringTie exon 1451413 1452019 1000 . . gene_id "SS.2190"; transcript_id "SS.2190.1"; exon_number "1"; cov "504.942352"; +CM143129.1 StringTie transcript 1453426 1454678 1000 . . gene_id "SS.2191"; transcript_id "SS.2191.1"; cov "816.425379"; FPKM "39.926874"; TPM "85.377502"; +CM143129.1 StringTie exon 1453426 1454678 1000 . . gene_id "SS.2191"; transcript_id "SS.2191.1"; exon_number "1"; cov "816.425354"; +CM143129.1 StringTie transcript 1454922 1457489 1000 . . gene_id "SS.2192"; transcript_id "SS.2192.1"; cov "492.792835"; FPKM "24.099787"; TPM "51.533701"; +CM143129.1 StringTie exon 1454922 1457489 1000 . . gene_id "SS.2192"; transcript_id "SS.2192.1"; exon_number "1"; cov "492.792847"; +CM143129.1 StringTie transcript 1432421 1434653 1000 . . gene_id "SS.2193"; transcript_id "SS.2193.1"; cov "5639.774742"; FPKM "275.810360"; TPM "589.778185"; +CM143129.1 StringTie exon 1432421 1434653 1000 . . gene_id "SS.2193"; transcript_id "SS.2193.1"; exon_number "1"; cov "5639.774902"; +CM143129.1 StringTie transcript 1438025 1439374 1000 . . gene_id "SS.2194"; transcript_id "SS.2194.1"; cov "2370.077778"; FPKM "115.907467"; TPM "247.850355"; +CM143129.1 StringTie exon 1438025 1439374 1000 . . gene_id "SS.2194"; transcript_id "SS.2194.1"; exon_number "1"; cov "2370.077881"; +CM143129.1 StringTie transcript 1439916 1441315 1000 . . gene_id "SS.2195"; transcript_id "SS.2195.1"; cov "584.866429"; FPKM "28.602600"; TPM "61.162276"; +CM143129.1 StringTie exon 1439916 1441315 1000 . . gene_id "SS.2195"; transcript_id "SS.2195.1"; exon_number "1"; cov "584.866455"; +CM143129.1 StringTie transcript 1441649 1442358 1000 . . gene_id "SS.2196"; transcript_id "SS.2196.1"; cov "3349.881690"; FPKM "163.824287"; TPM "350.313130"; +CM143129.1 StringTie exon 1441649 1442358 1000 . . gene_id "SS.2196"; transcript_id "SS.2196.1"; exon_number "1"; cov "3349.881592"; +CM143129.1 StringTie transcript 1442517 1443398 1000 . . gene_id "SS.2197"; transcript_id "SS.2197.1"; cov "31176.197279"; FPKM "1524.656321"; TPM "3260.243874"; +CM143129.1 StringTie exon 1442517 1443398 1000 . . gene_id "SS.2197"; transcript_id "SS.2197.1"; exon_number "1"; cov "31176.197266"; +CM143129.1 StringTie transcript 1444865 1445477 1000 . . gene_id "SS.2198"; transcript_id "SS.2198.1"; cov "67315.021207"; FPKM "3292.007414"; TPM "7039.453322"; +CM143129.1 StringTie exon 1444865 1445477 1000 . . gene_id "SS.2198"; transcript_id "SS.2198.1"; exon_number "1"; cov "67315.023438"; +CM143129.1 StringTie transcript 1447266 1450941 1000 . . gene_id "SS.2199"; transcript_id "SS.2199.1"; cov "1911.519042"; FPKM "93.481882"; TPM "199.896677"; +CM143129.1 StringTie exon 1447266 1450941 1000 . . gene_id "SS.2199"; transcript_id "SS.2199.1"; exon_number "1"; cov "1911.519043"; +CM143129.1 StringTie transcript 1458852 1464447 1000 . . gene_id "SS.2200"; transcript_id "SS.2200.1"; cov "1116.211758"; FPKM "54.587777"; TPM "116.727596"; +CM143129.1 StringTie exon 1458852 1464447 1000 . . gene_id "SS.2200"; transcript_id "SS.2200.1"; exon_number "1"; cov "1116.211792"; +CM143129.1 StringTie transcript 1464786 1466894 1000 . . gene_id "SS.2201"; transcript_id "SS.2201.1"; cov "2073.897582"; FPKM "101.422923"; TPM "216.877377"; +CM143129.1 StringTie exon 1464786 1466894 1000 . . gene_id "SS.2201"; transcript_id "SS.2201.1"; exon_number "1"; cov "2073.897461"; +CM143129.1 StringTie transcript 1467451 1469432 1000 . . gene_id "SS.2202"; transcript_id "SS.2202.1"; cov "2079.678607"; FPKM "101.705641"; TPM "217.481926"; +CM143129.1 StringTie exon 1467451 1469432 1000 . . gene_id "SS.2202"; transcript_id "SS.2202.1"; exon_number "1"; cov "2079.678711"; +CM143129.1 StringTie transcript 1469851 1472085 1000 . . gene_id "SS.2203"; transcript_id "SS.2203.1"; cov "525.425951"; FPKM "25.695693"; TPM "54.946302"; +CM143129.1 StringTie exon 1469851 1472085 1000 . . gene_id "SS.2203"; transcript_id "SS.2203.1"; exon_number "1"; cov "525.425964"; +CM143129.1 StringTie transcript 1472386 1474244 1000 . . gene_id "SS.2204"; transcript_id "SS.2204.1"; cov "5765.562668"; FPKM "281.961956"; TPM "602.932429"; +CM143129.1 StringTie exon 1472386 1474244 1000 . . gene_id "SS.2204"; transcript_id "SS.2204.1"; exon_number "1"; cov "5765.562500"; +CM143129.1 StringTie transcript 1472386 1474222 1000 + . gene_id "SS.2205"; transcript_id "SS.2205.1"; cov "687.507830"; FPKM "33.622226"; TPM "71.895978"; +CM143129.1 StringTie exon 1472386 1473102 1000 + . gene_id "SS.2205"; transcript_id "SS.2205.1"; exon_number "1"; cov "626.266968"; +CM143129.1 StringTie exon 1473148 1474222 1000 + . gene_id "SS.2205"; transcript_id "SS.2205.1"; exon_number "2"; cov "728.354065"; +CM143129.1 StringTie transcript 1474592 1476676 1000 - . gene_id "SS.2206"; transcript_id "SS.2206.1"; cov "675.841393"; FPKM "33.051685"; TPM "70.675963"; +CM143129.1 StringTie exon 1474592 1475931 1000 - . gene_id "SS.2206"; transcript_id "SS.2206.1"; exon_number "1"; cov "728.618286"; +CM143129.1 StringTie exon 1476528 1476676 1000 - . gene_id "SS.2206"; transcript_id "SS.2206.1"; exon_number "2"; cov "201.203583"; +CM143129.1 StringTie transcript 1474592 1476676 1000 - . gene_id "SS.2206"; transcript_id "SS.2206.2"; cov "315.988490"; FPKM "15.453259"; TPM "33.044426"; +CM143129.1 StringTie exon 1474592 1476252 1000 - . gene_id "SS.2206"; transcript_id "SS.2206.2"; exon_number "1"; cov "336.196564"; +CM143129.1 StringTie exon 1476528 1476676 1000 - . gene_id "SS.2206"; transcript_id "SS.2206.2"; exon_number "2"; cov "90.715881"; +CM143129.1 StringTie transcript 1477229 1478346 1000 . . gene_id "SS.2207"; transcript_id "SS.2207.1"; cov "845.642218"; FPKM "41.355709"; TPM "88.432846"; +CM143129.1 StringTie exon 1477229 1478346 1000 . . gene_id "SS.2207"; transcript_id "SS.2207.1"; exon_number "1"; cov "845.642212"; +CM143129.1 StringTie transcript 1481454 1487074 1000 . . gene_id "SS.2208"; transcript_id "SS.2208.1"; cov "1022.081302"; FPKM "49.984374"; TPM "106.883924"; +CM143129.1 StringTie exon 1481454 1487074 1000 . . gene_id "SS.2208"; transcript_id "SS.2208.1"; exon_number "1"; cov "1022.081299"; +CM143129.1 StringTie transcript 1487288 1489073 1000 . . gene_id "SS.2209"; transcript_id "SS.2209.1"; cov "787.390258"; FPKM "38.506926"; TPM "82.341161"; +CM143129.1 StringTie exon 1487288 1489073 1000 . . gene_id "SS.2209"; transcript_id "SS.2209.1"; exon_number "1"; cov "787.390259"; +CM143129.1 StringTie transcript 1489373 1492044 1000 . . gene_id "SS.2210"; transcript_id "SS.2210.1"; cov "563.705979"; FPKM "27.567759"; TPM "58.949427"; +CM143129.1 StringTie exon 1489373 1492044 1000 . . gene_id "SS.2210"; transcript_id "SS.2210.1"; exon_number "1"; cov "563.705994"; +CM143129.1 StringTie transcript 1489373 1492331 1000 - . gene_id "SS.2211"; transcript_id "SS.2211.1"; cov "375.326259"; FPKM "18.355143"; TPM "39.249660"; +CM143129.1 StringTie exon 1489373 1492074 1000 - . gene_id "SS.2211"; transcript_id "SS.2211.1"; exon_number "1"; cov "381.089783"; +CM143129.1 StringTie exon 1492154 1492331 1000 - . gene_id "SS.2211"; transcript_id "SS.2211.1"; exon_number "2"; cov "287.837067"; +CM143129.1 StringTie transcript 1493391 1498412 1000 + . gene_id "SS.2212"; transcript_id "SS.2212.1"; cov "262.846809"; FPKM "12.854392"; TPM "27.487146"; +CM143129.1 StringTie exon 1493391 1493681 1000 + . gene_id "SS.2212"; transcript_id "SS.2212.1"; exon_number "1"; cov "455.804138"; +CM143129.1 StringTie exon 1493769 1498412 1000 + . gene_id "SS.2212"; transcript_id "SS.2212.1"; exon_number "2"; cov "250.755814"; +CM143129.1 StringTie transcript 1499768 1501506 1000 . . gene_id "SS.2213"; transcript_id "SS.2213.1"; cov "5334.903968"; FPKM "260.900808"; TPM "557.896392"; +CM143129.1 StringTie exon 1499768 1501506 1000 . . gene_id "SS.2213"; transcript_id "SS.2213.1"; exon_number "1"; cov "5334.903809"; +CM143129.1 StringTie transcript 1502407 1505112 1000 . . gene_id "SS.2214"; transcript_id "SS.2214.1"; cov "4099.584996"; FPKM "200.488152"; TPM "428.713186"; +CM143129.1 StringTie exon 1502407 1505112 1000 . . gene_id "SS.2214"; transcript_id "SS.2214.1"; exon_number "1"; cov "4099.584961"; +CM143129.1 StringTie transcript 1509933 1512656 1000 + . gene_id "SS.2215"; transcript_id "SS.2215.1"; cov "2723.025371"; FPKM "133.168193"; TPM "284.759771"; +CM143129.1 StringTie exon 1509933 1510074 1000 + . gene_id "SS.2215"; transcript_id "SS.2215.1"; exon_number "1"; cov "1051.535156"; +CM143129.1 StringTie exon 1510237 1512656 1000 + . gene_id "SS.2215"; transcript_id "SS.2215.1"; exon_number "2"; cov "2821.104492"; +CM143129.1 StringTie transcript 1512980 1515311 1000 . . gene_id "SS.2216"; transcript_id "SS.2216.1"; cov "952.219983"; FPKM "46.567842"; TPM "99.578192"; +CM143129.1 StringTie exon 1512980 1515311 1000 . . gene_id "SS.2216"; transcript_id "SS.2216.1"; exon_number "1"; cov "952.219971"; +CM143129.1 StringTie transcript 1518145 1519905 1000 . . gene_id "SS.2217"; transcript_id "SS.2217.1"; cov "3549.548552"; FPKM "173.588895"; TPM "371.193248"; +CM143129.1 StringTie exon 1518145 1519905 1000 . . gene_id "SS.2217"; transcript_id "SS.2217.1"; exon_number "1"; cov "3549.548584"; +CM143129.1 StringTie transcript 1520151 1524480 1000 . . gene_id "SS.2218"; transcript_id "SS.2218.1"; cov "105.608545"; FPKM "5.164733"; TPM "11.043990"; +CM143129.1 StringTie exon 1520151 1524480 1000 . . gene_id "SS.2218"; transcript_id "SS.2218.1"; exon_number "1"; cov "105.608543"; +CM143129.1 StringTie transcript 1524715 1526271 1000 . . gene_id "SS.2219"; transcript_id "SS.2219.1"; cov "625.547206"; FPKM "30.592073"; TPM "65.416459"; +CM143129.1 StringTie exon 1524715 1526271 1000 . . gene_id "SS.2219"; transcript_id "SS.2219.1"; exon_number "1"; cov "625.547180"; +CM143129.1 StringTie transcript 1527231 1529231 1000 . . gene_id "SS.2220"; transcript_id "SS.2220.1"; cov "307.982009"; FPKM "15.061706"; TPM "32.207150"; +CM143129.1 StringTie exon 1527231 1529231 1000 . . gene_id "SS.2220"; transcript_id "SS.2220.1"; exon_number "1"; cov "307.981995"; +CM143129.1 StringTie transcript 1529821 1532147 1000 . . gene_id "SS.2221"; transcript_id "SS.2221.1"; cov "6293.656210"; FPKM "307.788106"; TPM "658.157694"; +CM143129.1 StringTie exon 1529821 1532147 1000 . . gene_id "SS.2221"; transcript_id "SS.2221.1"; exon_number "1"; cov "6293.656250"; +CM143129.1 StringTie transcript 1535061 1537390 1000 . . gene_id "SS.2222"; transcript_id "SS.2222.1"; cov "537.225322"; FPKM "26.272735"; TPM "56.180218"; +CM143129.1 StringTie exon 1535061 1537390 1000 . . gene_id "SS.2222"; transcript_id "SS.2222.1"; exon_number "1"; cov "537.225342"; +CM143129.1 StringTie transcript 1549665 1550169 1000 . . gene_id "SS.2223"; transcript_id "SS.2223.1"; cov "7491.819802"; FPKM "366.383697"; TPM "783.455384"; +CM143129.1 StringTie exon 1549665 1550169 1000 . . gene_id "SS.2223"; transcript_id "SS.2223.1"; exon_number "1"; cov "7491.819824"; +CM143129.1 StringTie transcript 1551094 1551671 1000 . . gene_id "SS.2224"; transcript_id "SS.2224.1"; cov "18442.098616"; FPKM "901.901601"; TPM "1928.578348"; +CM143129.1 StringTie exon 1551094 1551671 1000 . . gene_id "SS.2224"; transcript_id "SS.2224.1"; exon_number "1"; cov "18442.097656"; +CM143129.1 StringTie transcript 1552888 1559397 1000 . . gene_id "SS.2225"; transcript_id "SS.2225.1"; cov "304.197081"; FPKM "14.876606"; TPM "31.811342"; +CM143129.1 StringTie exon 1552888 1559397 1000 . . gene_id "SS.2225"; transcript_id "SS.2225.1"; exon_number "1"; cov "304.197083"; +CM143129.1 StringTie transcript 1559666 1565588 1000 . . gene_id "SS.2226"; transcript_id "SS.2226.1"; cov "226.253250"; FPKM "11.064802"; TPM "23.660383"; +CM143129.1 StringTie exon 1559666 1565588 1000 . . gene_id "SS.2226"; transcript_id "SS.2226.1"; exon_number "1"; cov "226.253250"; +CM143129.1 StringTie transcript 1595261 1595752 1000 . . gene_id "SS.2227"; transcript_id "SS.2227.1"; cov "18.286585"; FPKM "0.894296"; TPM "1.912316"; +CM143129.1 StringTie exon 1595261 1595752 1000 . . gene_id "SS.2227"; transcript_id "SS.2227.1"; exon_number "1"; cov "18.286585"; +CM143129.1 StringTie transcript 1566217 1579029 1000 - . gene_id "SS.2228"; transcript_id "SS.2228.1"; cov "324.281350"; FPKM "15.858817"; TPM "33.911650"; +CM143129.1 StringTie exon 1566217 1576728 1000 - . gene_id "SS.2228"; transcript_id "SS.2228.1"; exon_number "1"; cov "248.686066"; +CM143129.1 StringTie exon 1576903 1577033 1000 - . gene_id "SS.2228"; transcript_id "SS.2228.1"; exon_number "2"; cov "448.305328"; +CM143129.1 StringTie exon 1577103 1577811 1000 - . gene_id "SS.2228"; transcript_id "SS.2228.1"; exon_number "3"; cov "442.445709"; +CM143129.1 StringTie exon 1577878 1579029 1000 - . gene_id "SS.2228"; transcript_id "SS.2228.1"; exon_number "4"; cov "927.260437"; +CM143129.1 StringTie transcript 1578211 1579029 1000 . . gene_id "SS.2229"; transcript_id "SS.2229.1"; cov "2177.085470"; FPKM "106.469275"; TPM "227.668227"; +CM143129.1 StringTie exon 1578211 1579029 1000 . . gene_id "SS.2229"; transcript_id "SS.2229.1"; exon_number "1"; cov "2177.085449"; +CM143129.1 StringTie transcript 1579329 1580666 1000 . . gene_id "SS.2230"; transcript_id "SS.2230.1"; cov "2179.299701"; FPKM "106.577561"; TPM "227.899780"; +CM143129.1 StringTie exon 1579329 1580666 1000 . . gene_id "SS.2230"; transcript_id "SS.2230.1"; exon_number "1"; cov "2179.299805"; +CM143129.1 StringTie transcript 1580986 1589210 1000 . . gene_id "SS.2231"; transcript_id "SS.2231.1"; cov "244.227356"; FPKM "11.943817"; TPM "25.540021"; +CM143129.1 StringTie exon 1580986 1589210 1000 . . gene_id "SS.2231"; transcript_id "SS.2231.1"; exon_number "1"; cov "244.227356"; +CM143129.1 StringTie transcript 1589528 1595015 1000 . . gene_id "SS.2232"; transcript_id "SS.2232.1"; cov "426.242894"; FPKM "20.845195"; TPM "44.574256"; +CM143129.1 StringTie exon 1589528 1595015 1000 . . gene_id "SS.2232"; transcript_id "SS.2232.1"; exon_number "1"; cov "426.242889"; +CM143129.1 StringTie transcript 1596021 1596280 1000 . . gene_id "SS.2233"; transcript_id "SS.2233.1"; cov "11.788462"; FPKM "0.576509"; TPM "1.232776"; +CM143129.1 StringTie exon 1596021 1596280 1000 . . gene_id "SS.2233"; transcript_id "SS.2233.1"; exon_number "1"; cov "11.788462"; +CM143129.1 StringTie transcript 1596613 1598221 1000 . . gene_id "SS.2234"; transcript_id "SS.2234.1"; cov "88.231860"; FPKM "4.314935"; TPM "9.226827"; +CM143129.1 StringTie exon 1596613 1598221 1000 . . gene_id "SS.2234"; transcript_id "SS.2234.1"; exon_number "1"; cov "88.231857"; +CM143129.1 StringTie transcript 1598762 1599627 1000 . . gene_id "SS.2235"; transcript_id "SS.2235.1"; cov "1015.148961"; FPKM "49.645352"; TPM "106.158976"; +CM143129.1 StringTie exon 1598762 1599627 1000 . . gene_id "SS.2235"; transcript_id "SS.2235.1"; exon_number "1"; cov "1015.148987"; +CM143129.1 StringTie transcript 1599991 1605606 1000 . . gene_id "SS.2236"; transcript_id "SS.2236.1"; cov "1006.550392"; FPKM "49.224843"; TPM "105.259783"; +CM143129.1 StringTie exon 1599991 1605606 1000 . . gene_id "SS.2236"; transcript_id "SS.2236.1"; exon_number "1"; cov "1006.550415"; +CM143129.1 StringTie transcript 1605844 1607678 1000 . . gene_id "SS.2237"; transcript_id "SS.2237.1"; cov "197.525886"; FPKM "9.659905"; TPM "20.656225"; +CM143129.1 StringTie exon 1605844 1607678 1000 . . gene_id "SS.2237"; transcript_id "SS.2237.1"; exon_number "1"; cov "197.525879"; +CM143129.1 StringTie transcript 1607924 1612166 1000 . . gene_id "SS.2238"; transcript_id "SS.2238.1"; cov "164.721659"; FPKM "8.055630"; TPM "17.225731"; +CM143129.1 StringTie exon 1607924 1612166 1000 . . gene_id "SS.2238"; transcript_id "SS.2238.1"; exon_number "1"; cov "164.721664"; +CM143129.1 StringTie transcript 1612440 1614349 1000 . . gene_id "SS.2239"; transcript_id "SS.2239.1"; cov "266.253927"; FPKM "13.021015"; TPM "27.843445"; +CM143129.1 StringTie exon 1612440 1614349 1000 . . gene_id "SS.2239"; transcript_id "SS.2239.1"; exon_number "1"; cov "266.253937"; +CM143129.1 StringTie transcript 1614689 1618379 1000 . . gene_id "SS.2240"; transcript_id "SS.2240.1"; cov "346.303441"; FPKM "16.935796"; TPM "36.214605"; +CM143129.1 StringTie exon 1614689 1618379 1000 . . gene_id "SS.2240"; transcript_id "SS.2240.1"; exon_number "1"; cov "346.303436"; +CM143129.1 StringTie transcript 1622368 1624184 1000 + . gene_id "SS.2241"; transcript_id "SS.2241.1"; cov "714.336066"; FPKM "34.934248"; TPM "74.701535"; +CM143129.1 StringTie exon 1622368 1622473 1000 + . gene_id "SS.2241"; transcript_id "SS.2241.1"; exon_number "1"; cov "533.811340"; +CM143129.1 StringTie exon 1622583 1624184 1000 + . gene_id "SS.2241"; transcript_id "SS.2241.1"; exon_number "2"; cov "726.280884"; +CM143129.1 StringTie transcript 1624486 1626506 1000 . . gene_id "SS.2242"; transcript_id "SS.2242.1"; cov "915.801583"; FPKM "44.786818"; TPM "95.769746"; +CM143129.1 StringTie exon 1624486 1626506 1000 . . gene_id "SS.2242"; transcript_id "SS.2242.1"; exon_number "1"; cov "915.801575"; +CM143129.1 StringTie transcript 1626742 1627365 1000 + . gene_id "SS.2243"; transcript_id "SS.2243.1"; cov "2381.473469"; FPKM "116.464768"; TPM "249.042057"; +CM143129.1 StringTie exon 1626742 1626813 1000 + . gene_id "SS.2243"; transcript_id "SS.2243.1"; exon_number "1"; cov "840.111084"; +CM143129.1 StringTie exon 1626948 1627365 1000 + . gene_id "SS.2243"; transcript_id "SS.2243.1"; exon_number "2"; cov "2646.971191"; +CM143129.1 StringTie transcript 1645409 1647621 1000 . . gene_id "SS.2244"; transcript_id "SS.2244.1"; cov "17.280615"; FPKM "0.845100"; TPM "1.807116"; +CM143129.1 StringTie exon 1645409 1647621 1000 . . gene_id "SS.2244"; transcript_id "SS.2244.1"; exon_number "1"; cov "17.280615"; +CM143129.1 StringTie transcript 1628413 1628824 1000 . . gene_id "SS.2245"; transcript_id "SS.2245.1"; cov "37633.759709"; FPKM "1840.460179"; TPM "3935.542024"; +CM143129.1 StringTie exon 1628413 1628824 1000 . . gene_id "SS.2245"; transcript_id "SS.2245.1"; exon_number "1"; cov "37633.757812"; +CM143129.1 StringTie transcript 1629035 1630742 1000 . . gene_id "SS.2246"; transcript_id "SS.2246.1"; cov "1160.323185"; FPKM "56.745025"; TPM "121.340538"; +CM143129.1 StringTie exon 1629035 1630742 1000 . . gene_id "SS.2246"; transcript_id "SS.2246.1"; exon_number "1"; cov "1160.323242"; +CM143129.1 StringTie transcript 1632597 1633445 1000 . . gene_id "SS.2247"; transcript_id "SS.2247.1"; cov "3870.840989"; FPKM "189.301541"; TPM "404.792333"; +CM143129.1 StringTie exon 1632597 1633445 1000 . . gene_id "SS.2247"; transcript_id "SS.2247.1"; exon_number "1"; cov "3870.841064"; +CM143129.1 StringTie transcript 1637670 1639036 1000 - . gene_id "SS.2248"; transcript_id "SS.2248.1"; cov "1075.578700"; FPKM "52.600638"; TPM "112.478403"; +CM143129.1 StringTie exon 1637670 1638871 1000 - . gene_id "SS.2248"; transcript_id "SS.2248.1"; exon_number "1"; cov "1116.826172"; +CM143129.1 StringTie exon 1638962 1639036 1000 - . gene_id "SS.2248"; transcript_id "SS.2248.1"; exon_number "2"; cov "414.519989"; +CM143129.1 StringTie transcript 1639347 1645057 1000 . . gene_id "SS.2249"; transcript_id "SS.2249.1"; cov "255.344664"; FPKM "12.487503"; TPM "26.702611"; +CM143129.1 StringTie exon 1639347 1645057 1000 . . gene_id "SS.2249"; transcript_id "SS.2249.1"; exon_number "1"; cov "255.344666"; +CM143129.1 StringTie transcript 1639347 1645142 1000 - . gene_id "SS.2250"; transcript_id "SS.2250.1"; cov "25.970214"; FPKM "1.270060"; TPM "2.715829"; +CM143129.1 StringTie exon 1639347 1645041 1000 - . gene_id "SS.2250"; transcript_id "SS.2250.1"; exon_number "1"; cov "25.990627"; +CM143129.1 StringTie exon 1645118 1645142 1000 - . gene_id "SS.2250"; transcript_id "SS.2250.1"; exon_number "2"; cov "21.320000"; +CM143129.1 StringTie transcript 1647907 1649710 1000 . . gene_id "SS.2251"; transcript_id "SS.2251.1"; cov "1235.792683"; FPKM "60.435823"; TPM "129.232744"; +CM143129.1 StringTie exon 1647907 1649710 1000 . . gene_id "SS.2251"; transcript_id "SS.2251.1"; exon_number "1"; cov "1235.792725"; +CM143129.1 StringTie transcript 1651025 1657529 1000 . . gene_id "SS.2252"; transcript_id "SS.2252.1"; cov "526.507610"; FPKM "25.748591"; TPM "55.059416"; +CM143129.1 StringTie exon 1651025 1657529 1000 . . gene_id "SS.2252"; transcript_id "SS.2252.1"; exon_number "1"; cov "526.507629"; +CM143129.1 StringTie transcript 1657867 1660531 1000 + . gene_id "SS.2253"; transcript_id "SS.2253.1"; cov "6780.396166"; FPKM "331.591880"; TPM "709.058416"; +CM143129.1 StringTie exon 1657867 1657994 1000 + . gene_id "SS.2253"; transcript_id "SS.2253.1"; exon_number "1"; cov "2224.460938"; +CM143129.1 StringTie exon 1658156 1660531 1000 + . gene_id "SS.2253"; transcript_id "SS.2253.1"; exon_number "2"; cov "7025.833984"; +CM143129.1 StringTie transcript 1658880 1660531 1000 . . gene_id "SS.2254"; transcript_id "SS.2254.1"; cov "31342.864407"; FPKM "1532.807094"; TPM "3277.673051"; +CM143129.1 StringTie exon 1658880 1660531 1000 . . gene_id "SS.2254"; transcript_id "SS.2254.1"; exon_number "1"; cov "31342.865234"; +CM143129.1 StringTie transcript 1823029 1823978 1000 . . gene_id "SS.2255"; transcript_id "SS.2255.1"; cov "68.127368"; FPKM "3.331735"; TPM "7.124404"; +CM143129.1 StringTie exon 1823029 1823978 1000 . . gene_id "SS.2255"; transcript_id "SS.2255.1"; exon_number "1"; cov "68.127365"; +CM143129.1 StringTie transcript 1827040 1828348 1000 - . gene_id "SS.2256"; transcript_id "SS.2256.1"; cov "5736.572361"; FPKM "280.544200"; TPM "599.900775"; +CM143129.1 StringTie exon 1827040 1827813 1000 - . gene_id "SS.2256"; transcript_id "SS.2256.1"; exon_number "1"; cov "6358.392578"; +CM143129.1 StringTie exon 1828204 1828348 1000 - . gene_id "SS.2256"; transcript_id "SS.2256.1"; exon_number "2"; cov "2417.337891"; +CM143129.1 StringTie transcript 1829094 1830665 1000 . . gene_id "SS.2257"; transcript_id "SS.2257.1"; cov "392.016539"; FPKM "19.171373"; TPM "40.995042"; +CM143129.1 StringTie exon 1829094 1830665 1000 . . gene_id "SS.2257"; transcript_id "SS.2257.1"; exon_number "1"; cov "392.016541"; +CM143129.1 StringTie transcript 1831221 1836004 1000 . . gene_id "SS.2258"; transcript_id "SS.2258.1"; cov "1607.456104"; FPKM "78.611836"; TPM "168.099363"; +CM143129.1 StringTie exon 1831221 1836004 1000 . . gene_id "SS.2258"; transcript_id "SS.2258.1"; exon_number "1"; cov "1607.456055"; +CM143129.1 StringTie transcript 1837811 1839281 1000 . . gene_id "SS.2259"; transcript_id "SS.2259.1"; cov "2215.365058"; FPKM "108.341319"; TPM "231.671307"; +CM143129.1 StringTie exon 1837811 1839281 1000 . . gene_id "SS.2259"; transcript_id "SS.2259.1"; exon_number "1"; cov "2215.364990"; +CM143129.1 StringTie transcript 1843869 1847623 1000 . . gene_id "SS.2260"; transcript_id "SS.2260.1"; cov "464.196804"; FPKM "22.701312"; TPM "48.543277"; +CM143129.1 StringTie exon 1843869 1847623 1000 . . gene_id "SS.2260"; transcript_id "SS.2260.1"; exon_number "1"; cov "464.196808"; +CM143129.1 StringTie transcript 1847945 1850736 1000 . . gene_id "SS.2261"; transcript_id "SS.2261.1"; cov "13.709464"; FPKM "0.670454"; TPM "1.433664"; +CM143129.1 StringTie exon 1847945 1850736 1000 . . gene_id "SS.2261"; transcript_id "SS.2261.1"; exon_number "1"; cov "13.709464"; +CM143129.1 StringTie transcript 1847945 1853345 1000 - . gene_id "SS.2262"; transcript_id "SS.2262.1"; cov "6.341911"; FPKM "0.310148"; TPM "0.663204"; +CM143129.1 StringTie exon 1847945 1849899 1000 - . gene_id "SS.2262"; transcript_id "SS.2262.1"; exon_number "1"; cov "6.802136"; +CM143129.1 StringTie exon 1852489 1853345 1000 - . gene_id "SS.2262"; transcript_id "SS.2262.1"; exon_number "2"; cov "5.292037"; +CM143129.1 StringTie transcript 1850956 1853345 1000 . . gene_id "SS.2263"; transcript_id "SS.2263.1"; cov "41.283986"; FPKM "2.018973"; TPM "4.317264"; +CM143129.1 StringTie exon 1850956 1853345 1000 . . gene_id "SS.2263"; transcript_id "SS.2263.1"; exon_number "1"; cov "41.283985"; +CM143129.1 StringTie transcript 1853583 1858228 1000 . . gene_id "SS.2264"; transcript_id "SS.2264.1"; cov "325.104821"; FPKM "15.899089"; TPM "33.997764"; +CM143129.1 StringTie exon 1853583 1858228 1000 . . gene_id "SS.2264"; transcript_id "SS.2264.1"; exon_number "1"; cov "325.104828"; +CM143129.1 StringTie transcript 1666408 1674822 1000 . . gene_id "SS.2265"; transcript_id "SS.2265.1"; cov "184.530437"; FPKM "9.024369"; TPM "19.297229"; +CM143129.1 StringTie exon 1666408 1674822 1000 . . gene_id "SS.2265"; transcript_id "SS.2265.1"; exon_number "1"; cov "184.530441"; +CM143129.1 StringTie transcript 1687078 1688000 1000 - . gene_id "SS.2266"; transcript_id "SS.2266.1"; cov "20826.501171"; FPKM "1018.509614"; TPM "2177.926713"; +CM143129.1 StringTie exon 1687078 1687397 1000 - . gene_id "SS.2266"; transcript_id "SS.2266.1"; exon_number "1"; cov "26628.332031"; +CM143129.1 StringTie exon 1687894 1688000 1000 - . gene_id "SS.2266"; transcript_id "SS.2266.1"; exon_number "2"; cov "3475.233643"; +CM143129.1 StringTie transcript 1688520 1699839 1000 . . gene_id "SS.2267"; transcript_id "SS.2267.1"; cov "353.295230"; FPKM "17.277726"; TPM "36.945770"; +CM143129.1 StringTie exon 1688520 1699839 1000 . . gene_id "SS.2267"; transcript_id "SS.2267.1"; exon_number "1"; cov "353.295227"; +CM143129.1 StringTie transcript 1704730 1705579 1000 . . gene_id "SS.2268"; transcript_id "SS.2268.1"; cov "1869.849412"; FPKM "91.444049"; TPM "195.539085"; +CM143129.1 StringTie exon 1704730 1705579 1000 . . gene_id "SS.2268"; transcript_id "SS.2268.1"; exon_number "1"; cov "1869.849365"; +CM143129.1 StringTie transcript 1706024 1707488 1000 + . gene_id "SS.2269"; transcript_id "SS.2269.1"; cov "1280.750854"; FPKM "62.634479"; TPM "133.934235"; +CM143129.1 StringTie exon 1706024 1706173 1000 + . gene_id "SS.2269"; transcript_id "SS.2269.1"; exon_number "1"; cov "561.113342"; +CM143129.1 StringTie exon 1706321 1707488 1000 + . gene_id "SS.2269"; transcript_id "SS.2269.1"; exon_number "2"; cov "1373.170044"; +CM143129.1 StringTie transcript 1706324 1707488 1000 . . gene_id "SS.2270"; transcript_id "SS.2270.1"; cov "1533.594313"; FPKM "74.999662"; TPM "160.375283"; +CM143129.1 StringTie exon 1706324 1707488 1000 . . gene_id "SS.2270"; transcript_id "SS.2270.1"; exon_number "1"; cov "1533.594360"; +CM143129.1 StringTie transcript 1707682 1710017 1000 - . gene_id "SS.2271"; transcript_id "SS.2271.1"; cov "1977.394376"; FPKM "96.703482"; TPM "206.785576"; +CM143129.1 StringTie exon 1707682 1708816 1000 - . gene_id "SS.2271"; transcript_id "SS.2271.1"; exon_number "1"; cov "2089.555908"; +CM143129.1 StringTie exon 1709695 1710017 1000 - . gene_id "SS.2271"; transcript_id "SS.2271.1"; exon_number "2"; cov "1583.266235"; +CM143129.1 StringTie transcript 1725143 1725615 1000 . . gene_id "SS.2272"; transcript_id "SS.2272.1"; cov "262.504757"; FPKM "12.837664"; TPM "27.451376"; +CM143129.1 StringTie exon 1725143 1725615 1000 . . gene_id "SS.2272"; transcript_id "SS.2272.1"; exon_number "1"; cov "262.504761"; +CM143129.1 StringTie transcript 1726180 1731598 1000 . . gene_id "SS.2273"; transcript_id "SS.2273.1"; cov "291.696438"; FPKM "14.265268"; TPM "30.504090"; +CM143129.1 StringTie exon 1726180 1731598 1000 . . gene_id "SS.2273"; transcript_id "SS.2273.1"; exon_number "1"; cov "291.696442"; +CM143129.1 StringTie transcript 1733141 1734447 1000 - . gene_id "SS.2274"; transcript_id "SS.2274.1"; cov "42.057018"; FPKM "2.056777"; TPM "4.398103"; +CM143129.1 StringTie exon 1733141 1734003 1000 - . gene_id "SS.2274"; transcript_id "SS.2274.1"; exon_number "1"; cov "48.421783"; +CM143129.1 StringTie exon 1734171 1734447 1000 - . gene_id "SS.2274"; transcript_id "SS.2274.1"; exon_number "2"; cov "22.227436"; +CM143129.1 StringTie transcript 1734694 1735706 1000 - . gene_id "SS.2275"; transcript_id "SS.2275.1"; cov "5253.375988"; FPKM "256.913723"; TPM "549.370622"; +CM143129.1 StringTie exon 1734694 1735009 1000 - . gene_id "SS.2275"; transcript_id "SS.2275.1"; exon_number "1"; cov "7105.759277"; +CM143129.1 StringTie exon 1735517 1735706 1000 - . gene_id "SS.2275"; transcript_id "SS.2275.1"; exon_number "2"; cov "2172.569824"; +CM143129.1 StringTie transcript 1735972 1738058 1000 . . gene_id "SS.2276"; transcript_id "SS.2276.1"; cov "2804.708673"; FPKM "137.162874"; TPM "293.301784"; +CM143129.1 StringTie exon 1735972 1738058 1000 . . gene_id "SS.2276"; transcript_id "SS.2276.1"; exon_number "1"; cov "2804.708740"; +CM143129.1 StringTie transcript 1738323 1740542 1000 . . gene_id "SS.2277"; transcript_id "SS.2277.1"; cov "1127.904054"; FPKM "55.159583"; TPM "117.950315"; +CM143129.1 StringTie exon 1738323 1740542 1000 . . gene_id "SS.2277"; transcript_id "SS.2277.1"; exon_number "1"; cov "1127.904053"; +CM143129.1 StringTie transcript 1740829 1752735 1000 . . gene_id "SS.2278"; transcript_id "SS.2278.1"; cov "521.605274"; FPKM "25.508845"; TPM "54.546755"; +CM143129.1 StringTie exon 1740829 1752735 1000 . . gene_id "SS.2278"; transcript_id "SS.2278.1"; exon_number "1"; cov "521.605286"; +CM143129.1 StringTie transcript 1753059 1754648 1000 + . gene_id "SS.2279"; transcript_id "SS.2279.1"; cov "7627.778907"; FPKM "373.032709"; TPM "797.673277"; +CM143129.1 StringTie exon 1753059 1753203 1000 + . gene_id "SS.2279"; transcript_id "SS.2279.1"; exon_number "1"; cov "1274.300415"; +CM143129.1 StringTie exon 1753733 1753745 1000 + . gene_id "SS.2279"; transcript_id "SS.2279.1"; exon_number "2"; cov "4011.738281"; +CM143129.1 StringTie exon 1754075 1754648 1000 + . gene_id "SS.2279"; transcript_id "SS.2279.1"; exon_number "3"; cov "9314.648438"; +CM143129.1 StringTie transcript 1753059 1754648 1000 + . gene_id "SS.2279"; transcript_id "SS.2279.2"; cov "1109.319687"; FPKM "54.250724"; TPM "116.006859"; +CM143129.1 StringTie exon 1753059 1753203 1000 + . gene_id "SS.2279"; transcript_id "SS.2279.2"; exon_number "1"; cov "224.351288"; +CM143129.1 StringTie exon 1753733 1754648 1000 + . gene_id "SS.2279"; transcript_id "SS.2279.2"; exon_number "2"; cov "1249.407471"; +CM143129.1 StringTie transcript 1756951 1760081 1000 . . gene_id "SS.2280"; transcript_id "SS.2280.1"; cov "245.142127"; FPKM "11.988553"; TPM "25.635683"; +CM143129.1 StringTie exon 1756951 1760081 1000 . . gene_id "SS.2280"; transcript_id "SS.2280.1"; exon_number "1"; cov "245.142120"; +CM143129.1 StringTie transcript 1771320 1772205 1000 . . gene_id "SS.2281"; transcript_id "SS.2281.1"; cov "33828.501129"; FPKM "1654.365913"; TPM "3537.607957"; +CM143129.1 StringTie exon 1771320 1772205 1000 . . gene_id "SS.2281"; transcript_id "SS.2281.1"; exon_number "1"; cov "33828.500000"; +CM143129.1 StringTie transcript 1772753 1774174 1000 . . gene_id "SS.2282"; transcript_id "SS.2282.1"; cov "2320.573840"; FPKM "113.486502"; TPM "242.673491"; +CM143129.1 StringTie exon 1772753 1774174 1000 . . gene_id "SS.2282"; transcript_id "SS.2282.1"; exon_number "1"; cov "2320.573730"; +CM143129.1 StringTie transcript 1774390 1775441 1000 + . gene_id "SS.2283"; transcript_id "SS.2283.1"; cov "1935.277949"; FPKM "94.643799"; TPM "202.381260"; +CM143129.1 StringTie exon 1774390 1774619 1000 + . gene_id "SS.2283"; transcript_id "SS.2283.1"; exon_number "1"; cov "813.913025"; +CM143129.1 StringTie exon 1774697 1775441 1000 + . gene_id "SS.2283"; transcript_id "SS.2283.1"; exon_number "2"; cov "2281.471191"; +CM143129.1 StringTie transcript 1776836 1779664 1000 . . gene_id "SS.2284"; transcript_id "SS.2284.1"; cov "5710.992223"; FPKM "279.293216"; TPM "597.225737"; +CM143129.1 StringTie exon 1776836 1779664 1000 . . gene_id "SS.2284"; transcript_id "SS.2284.1"; exon_number "1"; cov "5710.992188"; +CM143129.1 StringTie transcript 1782589 1784085 1000 . . gene_id "SS.2285"; transcript_id "SS.2285.1"; cov "42247.615230"; FPKM "2066.098474"; TPM "4418.034935"; +CM143129.1 StringTie exon 1782589 1784085 1000 . . gene_id "SS.2285"; transcript_id "SS.2285.1"; exon_number "1"; cov "42247.613281"; +CM143129.1 StringTie transcript 1789327 1790395 1000 . . gene_id "SS.2286"; transcript_id "SS.2286.1"; cov "11240.273152"; FPKM "549.699932"; TPM "1175.449057"; +CM143129.1 StringTie exon 1789327 1790395 1000 . . gene_id "SS.2286"; transcript_id "SS.2286.1"; exon_number "1"; cov "11240.273438"; +CM143129.1 StringTie transcript 1791138 1795358 1000 . . gene_id "SS.2287"; transcript_id "SS.2287.1"; cov "817.605070"; FPKM "39.984567"; TPM "85.500868"; +CM143129.1 StringTie exon 1791138 1795358 1000 . . gene_id "SS.2287"; transcript_id "SS.2287.1"; exon_number "1"; cov "817.605042"; +CM143129.1 StringTie transcript 1800320 1803044 1000 - . gene_id "SS.2288"; transcript_id "SS.2288.1"; cov "8592.266377"; FPKM "420.200486"; TPM "898.534339"; +CM143129.1 StringTie exon 1800320 1802516 1000 - . gene_id "SS.2288"; transcript_id "SS.2288.1"; exon_number "1"; cov "8874.289062"; +CM143129.1 StringTie exon 1802937 1803044 1000 - . gene_id "SS.2288"; transcript_id "SS.2288.1"; exon_number "2"; cov "2855.185303"; +CM143129.1 StringTie transcript 1803848 1805228 1000 + . gene_id "SS.2289"; transcript_id "SS.2289.1"; cov "995.177196"; FPKM "48.668643"; TPM "104.070433"; +CM143129.1 StringTie exon 1803848 1803907 1000 + . gene_id "SS.2289"; transcript_id "SS.2289.1"; exon_number "1"; cov "80.333336"; +CM143129.1 StringTie exon 1803991 1805228 1000 + . gene_id "SS.2289"; transcript_id "SS.2289.1"; exon_number "2"; cov "1039.515381"; +CM143129.1 StringTie transcript 1807732 1811089 1000 . . gene_id "SS.2290"; transcript_id "SS.2290.1"; cov "167.379709"; FPKM "8.185621"; TPM "17.503696"; +CM143129.1 StringTie exon 1807732 1811089 1000 . . gene_id "SS.2290"; transcript_id "SS.2290.1"; exon_number "1"; cov "167.379715"; +CM143129.1 StringTie transcript 1811704 1813477 1000 . . gene_id "SS.2291"; transcript_id "SS.2291.1"; cov "8622.357384"; FPKM "421.672072"; TPM "901.681099"; +CM143129.1 StringTie exon 1811704 1813477 1000 . . gene_id "SS.2291"; transcript_id "SS.2291.1"; exon_number "1"; cov "8622.357422"; +CM143129.1 StringTie transcript 1819208 1819949 1000 . . gene_id "SS.2292"; transcript_id "SS.2292.1"; cov "8618.676550"; FPKM "421.492062"; TPM "901.296177"; +CM143129.1 StringTie exon 1819208 1819949 1000 . . gene_id "SS.2292"; transcript_id "SS.2292.1"; exon_number "1"; cov "8618.676758"; +CM143129.1 StringTie transcript 1821154 1822540 1000 . . gene_id "SS.2293"; transcript_id "SS.2293.1"; cov "134.905552"; FPKM "6.597488"; TPM "14.107718"; +CM143129.1 StringTie exon 1821154 1822540 1000 . . gene_id "SS.2293"; transcript_id "SS.2293.1"; exon_number "1"; cov "134.905548"; +CM143129.1 StringTie transcript 1858609 1859255 1000 . . gene_id "SS.2294"; transcript_id "SS.2294.1"; cov "63.588872"; FPKM "3.109782"; TPM "6.649792"; +CM143129.1 StringTie exon 1858609 1859255 1000 . . gene_id "SS.2294"; transcript_id "SS.2294.1"; exon_number "1"; cov "63.588871"; +CM143129.1 StringTie transcript 1859485 1861278 1000 . . gene_id "SS.2295"; transcript_id "SS.2295.1"; cov "4487.608138"; FPKM "219.464229"; TPM "469.290620"; +CM143129.1 StringTie exon 1859485 1861278 1000 . . gene_id "SS.2295"; transcript_id "SS.2295.1"; exon_number "1"; cov "4487.607910"; +CM143129.1 StringTie transcript 1864955 1867242 1000 . . gene_id "SS.2296"; transcript_id "SS.2296.1"; cov "1023.467657"; FPKM "50.052173"; TPM "107.028902"; +CM143129.1 StringTie exon 1864955 1867242 1000 . . gene_id "SS.2296"; transcript_id "SS.2296.1"; exon_number "1"; cov "1023.467651"; +CM143129.1 StringTie transcript 1867468 1871218 1000 . . gene_id "SS.2297"; transcript_id "SS.2297.1"; cov "203.464943"; FPKM "9.950351"; TPM "21.277301"; +CM143129.1 StringTie exon 1867468 1871218 1000 . . gene_id "SS.2297"; transcript_id "SS.2297.1"; exon_number "1"; cov "203.464935"; +CM143129.1 StringTie transcript 1871693 1874146 1000 . . gene_id "SS.2298"; transcript_id "SS.2298.1"; cov "751.768949"; FPKM "36.764884"; TPM "78.616070"; +CM143129.1 StringTie exon 1871693 1874146 1000 . . gene_id "SS.2298"; transcript_id "SS.2298.1"; exon_number "1"; cov "751.768921"; +CM143129.1 StringTie transcript 1877084 1879154 1000 . . gene_id "SS.2299"; transcript_id "SS.2299.1"; cov "7183.028006"; FPKM "351.282389"; TPM "751.163551"; +CM143129.1 StringTie exon 1877084 1879154 1000 . . gene_id "SS.2299"; transcript_id "SS.2299.1"; exon_number "1"; cov "7183.027832"; +CM143129.1 StringTie transcript 1882266 1884153 1000 . . gene_id "SS.2300"; transcript_id "SS.2300.1"; cov "20882.983051"; FPKM "1021.271832"; TPM "2183.833293"; +CM143129.1 StringTie exon 1882266 1884153 1000 . . gene_id "SS.2300"; transcript_id "SS.2300.1"; exon_number "1"; cov "20882.982422"; +CM143129.1 StringTie transcript 1884463 1885759 1000 . . gene_id "SS.2301"; transcript_id "SS.2301.1"; cov "358.343870"; FPKM "17.524628"; TPM "37.473730"; +CM143129.1 StringTie exon 1884463 1885759 1000 . . gene_id "SS.2301"; transcript_id "SS.2301.1"; exon_number "1"; cov "358.343872"; +CM143129.1 StringTie transcript 1886407 1888644 1000 . . gene_id "SS.2302"; transcript_id "SS.2302.1"; cov "459.186774"; FPKM "22.456299"; TPM "48.019354"; +CM143129.1 StringTie exon 1886407 1888644 1000 . . gene_id "SS.2302"; transcript_id "SS.2302.1"; exon_number "1"; cov "459.186768"; +CM143129.1 StringTie transcript 1889031 1891512 1000 . . gene_id "SS.2303"; transcript_id "SS.2303.1"; cov "528.047139"; FPKM "25.823881"; TPM "55.220412"; +CM143129.1 StringTie exon 1889031 1891512 1000 . . gene_id "SS.2303"; transcript_id "SS.2303.1"; exon_number "1"; cov "528.047119"; +CM143129.1 StringTie transcript 1891856 1892925 1000 . . gene_id "SS.2304"; transcript_id "SS.2304.1"; cov "2271.778505"; FPKM "111.100191"; TPM "237.570730"; +CM143129.1 StringTie exon 1891856 1892925 1000 . . gene_id "SS.2304"; transcript_id "SS.2304.1"; exon_number "1"; cov "2271.778564"; +CM143129.1 StringTie transcript 1893380 1900170 1000 . . gene_id "SS.2305"; transcript_id "SS.2305.1"; cov "757.243116"; FPKM "37.032596"; TPM "79.188530"; +CM143129.1 StringTie exon 1893380 1900170 1000 . . gene_id "SS.2305"; transcript_id "SS.2305.1"; exon_number "1"; cov "757.243103"; +CM143129.1 StringTie transcript 1904255 1907867 1000 - . gene_id "SS.2306"; transcript_id "SS.2306.1"; cov "635.454777"; FPKM "31.076598"; TPM "66.452542"; +CM143129.1 StringTie exon 1904255 1907700 1000 - . gene_id "SS.2306"; transcript_id "SS.2306.1"; exon_number "1"; cov "648.980286"; +CM143129.1 StringTie exon 1907776 1907867 1000 - . gene_id "SS.2306"; transcript_id "SS.2306.1"; exon_number "2"; cov "128.836960"; +CM143129.1 StringTie transcript 1908196 1912673 1000 . . gene_id "SS.2307"; transcript_id "SS.2307.1"; cov "580.733810"; FPKM "28.400496"; TPM "60.730109"; +CM143129.1 StringTie exon 1908196 1912673 1000 . . gene_id "SS.2307"; transcript_id "SS.2307.1"; exon_number "1"; cov "580.733826"; +CM143129.1 StringTie transcript 1917400 1918415 1000 . . gene_id "SS.2308"; transcript_id "SS.2308.1"; cov "1642.891732"; FPKM "80.344798"; TPM "171.805036"; +CM143129.1 StringTie exon 1917400 1918415 1000 . . gene_id "SS.2308"; transcript_id "SS.2308.1"; exon_number "1"; cov "1642.891724"; +CM143129.1 StringTie transcript 1918618 1919862 1000 . . gene_id "SS.2309"; transcript_id "SS.2309.1"; cov "1179.162249"; FPKM "57.666339"; TPM "123.310629"; +CM143129.1 StringTie exon 1918618 1919862 1000 . . gene_id "SS.2309"; transcript_id "SS.2309.1"; exon_number "1"; cov "1179.162231"; +CM143129.1 StringTie transcript 1920193 1922319 1000 . . gene_id "SS.2310"; transcript_id "SS.2310.1"; cov "404.259050"; FPKM "19.770086"; TPM "42.275300"; +CM143129.1 StringTie exon 1920193 1922319 1000 . . gene_id "SS.2310"; transcript_id "SS.2310.1"; exon_number "1"; cov "404.259064"; +CM143129.1 StringTie transcript 1922637 1923524 1000 + . gene_id "SS.2311"; transcript_id "SS.2311.1"; cov "30.946704"; FPKM "1.513433"; TPM "3.236245"; +CM143129.1 StringTie exon 1922637 1922799 1000 + . gene_id "SS.2311"; transcript_id "SS.2311.1"; exon_number "1"; cov "20.975460"; +CM143129.1 StringTie exon 1922975 1923524 1000 + . gene_id "SS.2311"; transcript_id "SS.2311.1"; exon_number "2"; cov "33.901817"; +CM143129.1 StringTie transcript 1925164 1926696 1000 . . gene_id "SS.2312"; transcript_id "SS.2312.1"; cov "37.811045"; FPKM "1.849130"; TPM "3.954082"; +CM143129.1 StringTie exon 1925164 1926696 1000 . . gene_id "SS.2312"; transcript_id "SS.2312.1"; exon_number "1"; cov "37.811047"; +CM143129.1 StringTie transcript 1925164 1929866 1000 + . gene_id "SS.2313"; transcript_id "SS.2313.1"; cov "9.558627"; FPKM "0.467460"; TPM "0.999591"; +CM143129.1 StringTie exon 1925164 1925823 1000 + . gene_id "SS.2313"; transcript_id "SS.2313.1"; exon_number "1"; cov "10.714647"; +CM143129.1 StringTie exon 1929018 1929866 1000 + . gene_id "SS.2313"; transcript_id "SS.2313.1"; exon_number "2"; cov "8.659955"; +CM143129.1 StringTie transcript 1926935 1927272 1000 . . gene_id "SS.2314"; transcript_id "SS.2314.1"; cov "16.186391"; FPKM "0.791587"; TPM "1.692688"; +CM143129.1 StringTie exon 1926935 1927272 1000 . . gene_id "SS.2314"; transcript_id "SS.2314.1"; exon_number "1"; cov "16.186390"; +CM143129.1 StringTie transcript 1928503 1929866 1000 . . gene_id "SS.2315"; transcript_id "SS.2315.1"; cov "37.661895"; FPKM "1.841836"; TPM "3.938484"; +CM143129.1 StringTie exon 1928503 1929866 1000 . . gene_id "SS.2315"; transcript_id "SS.2315.1"; exon_number "1"; cov "37.661896"; +CM143129.1 StringTie transcript 1930202 1931074 1000 . . gene_id "SS.2316"; transcript_id "SS.2316.1"; cov "164.247423"; FPKM "8.032438"; TPM "17.176138"; +CM143129.1 StringTie exon 1930202 1931074 1000 . . gene_id "SS.2316"; transcript_id "SS.2316.1"; exon_number "1"; cov "164.247421"; +CM143129.1 StringTie transcript 1934703 1935562 1000 . . gene_id "SS.2317"; transcript_id "SS.2317.1"; cov "6774.002326"; FPKM "331.279193"; TPM "708.389782"; +CM143129.1 StringTie exon 1934703 1935562 1000 . . gene_id "SS.2317"; transcript_id "SS.2317.1"; exon_number "1"; cov "6774.002441"; +CM143129.1 StringTie transcript 1939618 1942294 1000 + . gene_id "SS.2318"; transcript_id "SS.2318.1"; cov "702.584956"; FPKM "34.359566"; TPM "73.472665"; +CM143129.1 StringTie exon 1939618 1939768 1000 + . gene_id "SS.2318"; transcript_id "SS.2318.1"; exon_number "1"; cov "258.258270"; +CM143129.1 StringTie exon 1939827 1942294 1000 + . gene_id "SS.2318"; transcript_id "SS.2318.1"; exon_number "2"; cov "729.770264"; +CM143129.1 StringTie transcript 1944874 1945207 1000 . . gene_id "SS.2319"; transcript_id "SS.2319.1"; cov "22.215569"; FPKM "1.086441"; TPM "2.323188"; +CM143129.1 StringTie exon 1944874 1945207 1000 . . gene_id "SS.2319"; transcript_id "SS.2319.1"; exon_number "1"; cov "22.215569"; +CM143129.1 StringTie transcript 1945524 1950070 1000 . . gene_id "SS.2320"; transcript_id "SS.2320.1"; cov "202.732791"; FPKM "9.914546"; TPM "21.200736"; +CM143129.1 StringTie exon 1945524 1950070 1000 . . gene_id "SS.2320"; transcript_id "SS.2320.1"; exon_number "1"; cov "202.732788"; +CM143129.1 StringTie transcript 1950341 1951106 1000 . . gene_id "SS.2321"; transcript_id "SS.2321.1"; cov "509.800261"; FPKM "24.931527"; TPM "53.312249"; +CM143129.1 StringTie exon 1950341 1951106 1000 . . gene_id "SS.2321"; transcript_id "SS.2321.1"; exon_number "1"; cov "509.800262"; +CM143129.1 StringTie transcript 1951352 1953175 1000 . . gene_id "SS.2322"; transcript_id "SS.2322.1"; cov "616.725877"; FPKM "30.160670"; TPM "64.493971"; +CM143129.1 StringTie exon 1951352 1953175 1000 . . gene_id "SS.2322"; transcript_id "SS.2322.1"; exon_number "1"; cov "616.725891"; +CM143129.1 StringTie transcript 1954397 1956044 1000 . . gene_id "SS.2323"; transcript_id "SS.2323.1"; cov "633.569782"; FPKM "30.984413"; TPM "66.255419"; +CM143129.1 StringTie exon 1954397 1956044 1000 . . gene_id "SS.2323"; transcript_id "SS.2323.1"; exon_number "1"; cov "633.569763"; +CM143129.1 StringTie transcript 1956284 1959616 1000 . . gene_id "SS.2324"; transcript_id "SS.2324.1"; cov "246.329433"; FPKM "12.046618"; TPM "25.759845"; +CM143129.1 StringTie exon 1956284 1959616 1000 . . gene_id "SS.2324"; transcript_id "SS.2324.1"; exon_number "1"; cov "246.329437"; +CM143129.1 StringTie transcript 1960419 1961229 1000 . . gene_id "SS.2325"; transcript_id "SS.2325.1"; cov "22165.400740"; FPKM "1083.987827"; TPM "2317.941836"; +CM143129.1 StringTie exon 1960419 1961229 1000 . . gene_id "SS.2325"; transcript_id "SS.2325.1"; exon_number "1"; cov "22165.400391"; +CM143129.1 StringTie transcript 1967261 1968406 1000 + . gene_id "SS.2326"; transcript_id "SS.2326.1"; cov "30660.190337"; FPKM "1499.421260"; TPM "3206.282563"; +CM143129.1 StringTie exon 1967261 1967410 1000 + . gene_id "SS.2326"; transcript_id "SS.2326.1"; exon_number "1"; cov "4936.333496"; +CM143129.1 StringTie exon 1967874 1968406 1000 + . gene_id "SS.2326"; transcript_id "SS.2326.1"; exon_number "2"; cov "37899.550781"; +CM143129.1 StringTie transcript 1968718 1971352 1000 . . gene_id "SS.2327"; transcript_id "SS.2327.1"; cov "678.989753"; FPKM "33.205654"; TPM "71.005202"; +CM143129.1 StringTie exon 1968718 1971352 1000 . . gene_id "SS.2327"; transcript_id "SS.2327.1"; exon_number "1"; cov "678.989746"; +CM143129.1 StringTie transcript 1972457 1973339 1000 . . gene_id "SS.2328"; transcript_id "SS.2328.1"; cov "14789.060023"; FPKM "723.251577"; TPM "1546.562652"; +CM143129.1 StringTie exon 1972457 1973339 1000 . . gene_id "SS.2328"; transcript_id "SS.2328.1"; exon_number "1"; cov "14789.059570"; +CM143129.1 StringTie transcript 1976287 1981727 1000 . . gene_id "SS.2329"; transcript_id "SS.2329.1"; cov "164.770998"; FPKM "8.058043"; TPM "17.230890"; +CM143129.1 StringTie exon 1976287 1981727 1000 . . gene_id "SS.2329"; transcript_id "SS.2329.1"; exon_number "1"; cov "164.770996"; +CM143129.1 StringTie transcript 1981973 1984223 1000 . . gene_id "SS.2330"; transcript_id "SS.2330.1"; cov "260.770769"; FPKM "12.752864"; TPM "27.270045"; +CM143129.1 StringTie exon 1981973 1984223 1000 . . gene_id "SS.2330"; transcript_id "SS.2330.1"; exon_number "1"; cov "260.770782"; +CM143129.1 StringTie transcript 1985638 1987566 1000 . . gene_id "SS.2331"; transcript_id "SS.2331.1"; cov "557.888025"; FPKM "27.283235"; TPM "58.341016"; +CM143129.1 StringTie exon 1985638 1987566 1000 . . gene_id "SS.2331"; transcript_id "SS.2331.1"; exon_number "1"; cov "557.888000"; +CM143129.1 StringTie transcript 1990175 1991438 1000 . . gene_id "SS.2332"; transcript_id "SS.2332.1"; cov "4308.162975"; FPKM "210.688554"; TPM "450.525182"; +CM143129.1 StringTie exon 1990175 1991438 1000 . . gene_id "SS.2332"; transcript_id "SS.2332.1"; exon_number "1"; cov "4308.163086"; +CM143129.1 StringTie transcript 1993436 1994666 1000 . . gene_id "SS.2333"; transcript_id "SS.2333.1"; cov "5132.950447"; FPKM "251.024372"; TPM "536.777148"; +CM143129.1 StringTie exon 1993436 1994666 1000 . . gene_id "SS.2333"; transcript_id "SS.2333.1"; exon_number "1"; cov "5132.950684"; +CM143129.1 StringTie transcript 1994806 1997765 1000 . . gene_id "SS.2334"; transcript_id "SS.2334.1"; cov "651.817905"; FPKM "31.876828"; TPM "68.163712"; +CM143129.1 StringTie exon 1994806 1997765 1000 . . gene_id "SS.2334"; transcript_id "SS.2334.1"; exon_number "1"; cov "651.817932"; +CM143129.1 StringTie transcript 1998181 1999392 1000 . . gene_id "SS.2335"; transcript_id "SS.2335.1"; cov "12281.094884"; FPKM "600.600797"; TPM "1284.292757"; +CM143129.1 StringTie exon 1998181 1999392 1000 . . gene_id "SS.2335"; transcript_id "SS.2335.1"; exon_number "1"; cov "12281.094727"; +CM143129.1 StringTie transcript 2000895 2001464 1000 . . gene_id "SS.2336"; transcript_id "SS.2336.1"; cov "1496.228070"; FPKM "73.172285"; TPM "156.467717"; +CM143129.1 StringTie exon 2000895 2001464 1000 . . gene_id "SS.2336"; transcript_id "SS.2336.1"; exon_number "1"; cov "1496.228027"; +CM143129.1 StringTie transcript 2002945 2005258 1000 . . gene_id "SS.2337"; transcript_id "SS.2337.1"; cov "22073.808124"; FPKM "1079.508536"; TPM "2308.363559"; +CM143129.1 StringTie exon 2002945 2005258 1000 . . gene_id "SS.2337"; transcript_id "SS.2337.1"; exon_number "1"; cov "22073.808594"; +CM143129.1 StringTie transcript 2007353 2009742 1000 + . gene_id "SS.2338"; transcript_id "SS.2338.1"; cov "1163.035917"; FPKM "56.877689"; TPM "121.624221"; +CM143129.1 StringTie exon 2007353 2007502 1000 + . gene_id "SS.2338"; transcript_id "SS.2338.1"; exon_number "1"; cov "159.839996"; +CM143129.1 StringTie exon 2007636 2007691 1000 + . gene_id "SS.2338"; transcript_id "SS.2338.1"; exon_number "2"; cov "505.428558"; +CM143129.1 StringTie exon 2007833 2009742 1000 + . gene_id "SS.2338"; transcript_id "SS.2338.1"; exon_number "3"; cov "1261.101562"; +CM143129.1 StringTie transcript 2060456 2064537 1000 . . gene_id "SS.2339"; transcript_id "SS.2339.1"; cov "294.405683"; FPKM "14.397763"; TPM "30.787409"; +CM143129.1 StringTie exon 2060456 2064537 1000 . . gene_id "SS.2339"; transcript_id "SS.2339.1"; exon_number "1"; cov "294.405670"; +CM143129.1 StringTie transcript 2013968 2015014 1000 . . gene_id "SS.2340"; transcript_id "SS.2340.1"; cov "371.131805"; FPKM "18.150015"; TPM "38.811026"; +CM143129.1 StringTie exon 2013968 2015014 1000 . . gene_id "SS.2340"; transcript_id "SS.2340.1"; exon_number "1"; cov "371.131805"; +CM143129.1 StringTie transcript 2015280 2016721 1000 - . gene_id "SS.2341"; transcript_id "SS.2341.1"; cov "226.185937"; FPKM "11.061510"; TPM "23.653344"; +CM143129.1 StringTie exon 2015280 2016448 1000 - . gene_id "SS.2341"; transcript_id "SS.2341.1"; exon_number "1"; cov "240.360138"; +CM143129.1 StringTie exon 2016611 2016721 1000 - . gene_id "SS.2341"; transcript_id "SS.2341.1"; exon_number "2"; cov "76.909912"; +CM143129.1 StringTie transcript 2017123 2018795 1000 . . gene_id "SS.2342"; transcript_id "SS.2342.1"; cov "782.240885"; FPKM "38.255099"; TPM "81.802666"; +CM143129.1 StringTie exon 2017123 2018795 1000 . . gene_id "SS.2342"; transcript_id "SS.2342.1"; exon_number "1"; cov "782.240906"; +CM143129.1 StringTie transcript 2021253 2022549 1000 . . gene_id "SS.2343"; transcript_id "SS.2343.1"; cov "779.455667"; FPKM "38.118889"; TPM "81.511402"; +CM143129.1 StringTie exon 2021253 2022549 1000 . . gene_id "SS.2343"; transcript_id "SS.2343.1"; exon_number "1"; cov "779.455688"; +CM143129.1 StringTie transcript 2023392 2026569 1000 . . gene_id "SS.2344"; transcript_id "SS.2344.1"; cov "1458.341724"; FPKM "71.319472"; TPM "152.505760"; +CM143129.1 StringTie exon 2023392 2026569 1000 . . gene_id "SS.2344"; transcript_id "SS.2344.1"; exon_number "1"; cov "1458.341675"; +CM143129.1 StringTie transcript 2028510 2031302 1000 . . gene_id "SS.2345"; transcript_id "SS.2345.1"; cov "110.601146"; FPKM "5.408894"; TPM "11.566090"; +CM143129.1 StringTie exon 2028510 2031302 1000 . . gene_id "SS.2345"; transcript_id "SS.2345.1"; exon_number "1"; cov "110.601143"; +CM143129.1 StringTie transcript 2058457 2059810 1000 - . gene_id "SS.2346"; transcript_id "SS.2346.1"; cov "17365.680087"; FPKM "849.259891"; TPM "1816.012120"; +CM143129.1 StringTie exon 2058457 2059279 1000 - . gene_id "SS.2346"; transcript_id "SS.2346.1"; exon_number "1"; cov "19261.423828"; +CM143129.1 StringTie exon 2059715 2059810 1000 - . gene_id "SS.2346"; transcript_id "SS.2346.1"; exon_number "2"; cov "1113.625000"; +CM143129.1 StringTie transcript 2070613 2072000 1000 . . gene_id "SS.2347"; transcript_id "SS.2347.1"; cov "11757.572767"; FPKM "574.998210"; TPM "1229.545548"; +CM143129.1 StringTie exon 2070613 2072000 1000 . . gene_id "SS.2347"; transcript_id "SS.2347.1"; exon_number "1"; cov "11757.573242"; +CM143129.1 StringTie transcript 2074732 2076248 1000 - . gene_id "SS.2348"; transcript_id "SS.2348.1"; cov "451.824353"; FPKM "22.096244"; TPM "47.249431"; +CM143129.1 StringTie exon 2074732 2075776 1000 - . gene_id "SS.2348"; transcript_id "SS.2348.1"; exon_number "1"; cov "417.634460"; +CM143129.1 StringTie exon 2075865 2076248 1000 - . gene_id "SS.2348"; transcript_id "SS.2348.1"; exon_number "2"; cov "544.867188"; +CM143129.1 StringTie transcript 2076558 2078861 1000 . . gene_id "SS.2349"; transcript_id "SS.2349.1"; cov "1873.877170"; FPKM "91.641025"; TPM "195.960287"; +CM143129.1 StringTie exon 2076558 2078861 1000 . . gene_id "SS.2349"; transcript_id "SS.2349.1"; exon_number "1"; cov "1873.877197"; +CM143129.1 StringTie transcript 2081042 2082869 1000 . . gene_id "SS.2350"; transcript_id "SS.2350.1"; cov "604.576039"; FPKM "29.566489"; TPM "63.223404"; +CM143129.1 StringTie exon 2081042 2082869 1000 . . gene_id "SS.2350"; transcript_id "SS.2350.1"; exon_number "1"; cov "604.576050"; +CM143129.1 StringTie transcript 2083421 2085281 1000 . . gene_id "SS.2351"; transcript_id "SS.2351.1"; cov "18615.993552"; FPKM "910.405845"; TPM "1946.763372"; +CM143129.1 StringTie exon 2083421 2085281 1000 . . gene_id "SS.2351"; transcript_id "SS.2351.1"; exon_number "1"; cov "18615.994141"; +CM143129.1 StringTie transcript 2087479 2089169 1000 . . gene_id "SS.2352"; transcript_id "SS.2352.1"; cov "655.426966"; FPKM "32.053328"; TPM "68.541129"; +CM143129.1 StringTie exon 2087479 2089169 1000 . . gene_id "SS.2352"; transcript_id "SS.2352.1"; exon_number "1"; cov "655.426941"; +CM143129.1 StringTie transcript 2089474 2091356 1000 . . gene_id "SS.2353"; transcript_id "SS.2353.1"; cov "3067.411046"; FPKM "150.010202"; TPM "320.773826"; +CM143129.1 StringTie exon 2089474 2091356 1000 . . gene_id "SS.2353"; transcript_id "SS.2353.1"; exon_number "1"; cov "3067.411133"; +CM143129.1 StringTie transcript 2091732 2095867 1000 . . gene_id "SS.2354"; transcript_id "SS.2354.1"; cov "518.678433"; FPKM "25.365709"; TPM "54.240681"; +CM143129.1 StringTie exon 2091732 2095867 1000 . . gene_id "SS.2354"; transcript_id "SS.2354.1"; exon_number "1"; cov "518.678406"; +CM143129.1 StringTie transcript 2096312 2101222 1000 . . gene_id "SS.2355"; transcript_id "SS.2355.1"; cov "990.748524"; FPKM "48.452061"; TPM "103.607306"; +CM143129.1 StringTie exon 2096312 2101222 1000 . . gene_id "SS.2355"; transcript_id "SS.2355.1"; exon_number "1"; cov "990.748535"; +CM143129.1 StringTie transcript 2102173 2107115 1000 . . gene_id "SS.2356"; transcript_id "SS.2356.1"; cov "1792.919077"; FPKM "87.681810"; TPM "187.494112"; +CM143129.1 StringTie exon 2102173 2107115 1000 . . gene_id "SS.2356"; transcript_id "SS.2356.1"; exon_number "1"; cov "1792.919067"; +CM143129.1 StringTie transcript 2108123 2109113 1000 . . gene_id "SS.2357"; transcript_id "SS.2357.1"; cov "1994.943491"; FPKM "97.561713"; TPM "208.620770"; +CM143129.1 StringTie exon 2108123 2109113 1000 . . gene_id "SS.2357"; transcript_id "SS.2357.1"; exon_number "1"; cov "1994.943481"; +CM143129.1 StringTie transcript 2109204 2114112 1000 . . gene_id "SS.2358"; transcript_id "SS.2358.1"; cov "1032.043797"; FPKM "50.471585"; TPM "107.925750"; +CM143129.1 StringTie exon 2109204 2114112 1000 . . gene_id "SS.2358"; transcript_id "SS.2358.1"; exon_number "1"; cov "1032.043823"; +CM143129.1 StringTie transcript 2114424 2115973 1000 . . gene_id "SS.2359"; transcript_id "SS.2359.1"; cov "2112.325806"; FPKM "103.302236"; TPM "220.896000"; +CM143129.1 StringTie exon 2114424 2115973 1000 . . gene_id "SS.2359"; transcript_id "SS.2359.1"; exon_number "1"; cov "2112.325928"; +CM143129.1 StringTie transcript 2116428 2119204 1000 . . gene_id "SS.2360"; transcript_id "SS.2360.1"; cov "242.052935"; FPKM "11.837478"; TPM "25.312632"; +CM143129.1 StringTie exon 2116428 2119204 1000 . . gene_id "SS.2360"; transcript_id "SS.2360.1"; exon_number "1"; cov "242.052933"; +CM143129.1 StringTie transcript 2119479 2130950 1000 . . gene_id "SS.2361"; transcript_id "SS.2361.1"; cov "99.455370"; FPKM "4.863815"; TPM "10.400523"; +CM143129.1 StringTie exon 2119479 2130950 1000 . . gene_id "SS.2361"; transcript_id "SS.2361.1"; exon_number "1"; cov "99.455368"; +CM143129.1 StringTie transcript 2131351 2135765 1000 . . gene_id "SS.2362"; transcript_id "SS.2362.1"; cov "374.372140"; FPKM "18.308482"; TPM "39.149883"; +CM143129.1 StringTie exon 2131351 2135765 1000 . . gene_id "SS.2362"; transcript_id "SS.2362.1"; exon_number "1"; cov "374.372131"; +CM143129.1 StringTie transcript 2136726 2138326 1000 . . gene_id "SS.2363"; transcript_id "SS.2363.1"; cov "887.668332"; FPKM "43.410975"; TPM "92.827718"; +CM143129.1 StringTie exon 2136726 2138326 1000 . . gene_id "SS.2363"; transcript_id "SS.2363.1"; exon_number "1"; cov "887.668335"; +CM143129.1 StringTie transcript 2141422 2145593 1000 - . gene_id "SS.2364"; transcript_id "SS.2364.1"; cov "386.177030"; FPKM "18.885794"; TPM "40.384377"; +CM143129.1 StringTie exon 2141422 2145198 1000 - . gene_id "SS.2364"; transcript_id "SS.2364.1"; exon_number "1"; cov "410.797729"; +CM143129.1 StringTie exon 2145270 2145593 1000 - . gene_id "SS.2364"; transcript_id "SS.2364.1"; exon_number "2"; cov "99.163582"; +CM143129.1 StringTie transcript 2152751 2161139 1000 . . gene_id "SS.2365"; transcript_id "SS.2365.1"; cov "1149.551198"; FPKM "56.218226"; TPM "120.214060"; +CM143129.1 StringTie exon 2152751 2161139 1000 . . gene_id "SS.2365"; transcript_id "SS.2365.1"; exon_number "1"; cov "1149.551147"; +CM143129.1 StringTie transcript 2161401 2165164 1000 . . gene_id "SS.2366"; transcript_id "SS.2366.1"; cov "248.267269"; FPKM "12.141387"; TPM "25.962494"; +CM143129.1 StringTie exon 2161401 2165164 1000 . . gene_id "SS.2366"; transcript_id "SS.2366.1"; exon_number "1"; cov "248.267273"; +CM143129.1 StringTie transcript 2165463 2166943 1000 . . gene_id "SS.2367"; transcript_id "SS.2367.1"; cov "772.111411"; FPKM "37.759722"; TPM "80.743379"; +CM143129.1 StringTie exon 2165463 2166943 1000 . . gene_id "SS.2367"; transcript_id "SS.2367.1"; exon_number "1"; cov "772.111389"; +CM143129.1 StringTie transcript 2167788 2170549 1000 . . gene_id "SS.2368"; transcript_id "SS.2368.1"; cov "22.636495"; FPKM "1.107026"; TPM "2.367206"; +CM143129.1 StringTie exon 2167788 2170549 1000 . . gene_id "SS.2368"; transcript_id "SS.2368.1"; exon_number "1"; cov "22.636496"; +CM143129.1 StringTie transcript 2173743 2174477 1000 . . gene_id "SS.2369"; transcript_id "SS.2369.1"; cov "6089.080272"; FPKM "297.783423"; TPM "636.764211"; +CM143129.1 StringTie exon 2173743 2174477 1000 . . gene_id "SS.2369"; transcript_id "SS.2369.1"; exon_number "1"; cov "6089.080078"; +CM143129.1 StringTie transcript 2180120 2181355 1000 . . gene_id "SS.2370"; transcript_id "SS.2370.1"; cov "2649.791262"; FPKM "129.586715"; TPM "277.101330"; +CM143129.1 StringTie exon 2180120 2181355 1000 . . gene_id "SS.2370"; transcript_id "SS.2370.1"; exon_number "1"; cov "2649.791260"; +CM143129.1 StringTie transcript 2181556 2182230 1000 . . gene_id "SS.2371"; transcript_id "SS.2371.1"; cov "210.275556"; FPKM "10.283421"; TPM "21.989519"; +CM143129.1 StringTie exon 2181556 2182230 1000 . . gene_id "SS.2371"; transcript_id "SS.2371.1"; exon_number "1"; cov "210.275558"; +CM143129.1 StringTie transcript 2182448 2185004 1000 + . gene_id "SS.2372"; transcript_id "SS.2372.1"; cov "2842.890631"; FPKM "139.030143"; TPM "297.294653"; +CM143129.1 StringTie exon 2182448 2182509 1000 + . gene_id "SS.2372"; transcript_id "SS.2372.1"; exon_number "1"; cov "380.516144"; +CM143129.1 StringTie exon 2182580 2185004 1000 + . gene_id "SS.2372"; transcript_id "SS.2372.1"; exon_number "2"; cov "2905.846191"; +CM143129.1 StringTie transcript 2185265 2187954 1000 . . gene_id "SS.2373"; transcript_id "SS.2373.1"; cov "91.611152"; FPKM "4.480198"; TPM "9.580216"; +CM143129.1 StringTie exon 2185265 2187954 1000 . . gene_id "SS.2373"; transcript_id "SS.2373.1"; exon_number "1"; cov "91.611153"; +CM143129.1 StringTie transcript 2188358 2191013 1000 . . gene_id "SS.2374"; transcript_id "SS.2374.1"; cov "1065.489834"; FPKM "52.107247"; TPM "111.423362"; +CM143129.1 StringTie exon 2188358 2191013 1000 . . gene_id "SS.2374"; transcript_id "SS.2374.1"; exon_number "1"; cov "1065.489868"; +CM143129.1 StringTie transcript 2191951 2195103 1000 + . gene_id "SS.2375"; transcript_id "SS.2375.1"; cov "1296.026135"; FPKM "63.381509"; TPM "135.531644"; +CM143129.1 StringTie exon 2191951 2193333 1000 + . gene_id "SS.2375"; transcript_id "SS.2375.1"; exon_number "1"; cov "925.932739"; +CM143129.1 StringTie exon 2193426 2195103 1000 + . gene_id "SS.2375"; transcript_id "SS.2375.1"; exon_number "2"; cov "1601.055420"; +CM143129.1 StringTie transcript 2197392 2201518 1000 . . gene_id "SS.2376"; transcript_id "SS.2376.1"; cov "348.058154"; FPKM "17.021610"; TPM "36.398104"; +CM143129.1 StringTie exon 2197392 2201518 1000 . . gene_id "SS.2376"; transcript_id "SS.2376.1"; exon_number "1"; cov "348.058167"; +CM143129.1 StringTie transcript 2201837 2205121 1000 . . gene_id "SS.2377"; transcript_id "SS.2377.1"; cov "1332.312938"; FPKM "65.156097"; TPM "139.326328"; +CM143129.1 StringTie exon 2201837 2205121 1000 . . gene_id "SS.2377"; transcript_id "SS.2377.1"; exon_number "1"; cov "1332.312988"; +CM143129.1 StringTie transcript 2206714 2210852 1000 - . gene_id "SS.2378"; transcript_id "SS.2378.1"; cov "598.919088"; FPKM "29.289838"; TPM "62.631830"; +CM143129.1 StringTie exon 2206714 2210505 1000 - . gene_id "SS.2378"; transcript_id "SS.2378.1"; exon_number "1"; cov "602.062256"; +CM143129.1 StringTie exon 2210653 2210852 1000 - . gene_id "SS.2378"; transcript_id "SS.2378.1"; exon_number "2"; cov "539.325012"; +CM143129.1 StringTie transcript 2211324 2212227 1000 + . gene_id "SS.2379"; transcript_id "SS.2379.1"; cov "120.342105"; FPKM "5.885270"; TPM "12.584749"; +CM143129.1 StringTie exon 2211324 2211589 1000 + . gene_id "SS.2379"; transcript_id "SS.2379.1"; exon_number "1"; cov "61.266918"; +CM143129.1 StringTie exon 2211696 2212227 1000 + . gene_id "SS.2379"; transcript_id "SS.2379.1"; exon_number "2"; cov "149.879700"; +CM143129.1 StringTie transcript 2217790 2218993 1000 + . gene_id "SS.2380"; transcript_id "SS.2380.1"; cov "2596.836134"; FPKM "126.996971"; TPM "271.563559"; +CM143129.1 StringTie exon 2217790 2217863 1000 + . gene_id "SS.2380"; transcript_id "SS.2380.1"; exon_number "1"; cov "452.405396"; +CM143129.1 StringTie exon 2218116 2218993 1000 + . gene_id "SS.2380"; transcript_id "SS.2380.1"; exon_number "2"; cov "2777.573975"; +CM143129.1 StringTie transcript 2243310 2244441 1000 . . gene_id "SS.2381"; transcript_id "SS.2381.1"; cov "950.432862"; FPKM "46.480443"; TPM "99.391304"; +CM143129.1 StringTie exon 2243310 2244441 1000 . . gene_id "SS.2381"; transcript_id "SS.2381.1"; exon_number "1"; cov "950.432861"; +CM143129.1 StringTie transcript 2246839 2248832 1000 . . gene_id "SS.2382"; transcript_id "SS.2382.1"; cov "4418.217151"; FPKM "216.070698"; TPM "462.034073"; +CM143129.1 StringTie exon 2246839 2248832 1000 . . gene_id "SS.2382"; transcript_id "SS.2382.1"; exon_number "1"; cov "4418.217285"; +CM143129.1 StringTie transcript 2249470 2250297 1000 . . gene_id "SS.2383"; transcript_id "SS.2383.1"; cov "17897.218599"; FPKM "875.254516"; TPM "1871.597641"; +CM143129.1 StringTie exon 2249470 2250297 1000 . . gene_id "SS.2383"; transcript_id "SS.2383.1"; exon_number "1"; cov "17897.218750"; +CM143129.1 StringTie transcript 2251135 2252250 1000 . . gene_id "SS.2384"; transcript_id "SS.2384.1"; cov "840.430108"; FPKM "41.100814"; TPM "87.887791"; +CM143129.1 StringTie exon 2251135 2252250 1000 . . gene_id "SS.2384"; transcript_id "SS.2384.1"; exon_number "1"; cov "840.430115"; +CM143129.1 StringTie transcript 2254029 2255999 1000 . . gene_id "SS.2385"; transcript_id "SS.2385.1"; cov "459.941147"; FPKM "22.493192"; TPM "48.098243"; +CM143129.1 StringTie exon 2254029 2255999 1000 . . gene_id "SS.2385"; transcript_id "SS.2385.1"; exon_number "1"; cov "459.941132"; +CM143129.1 StringTie transcript 2256333 2258446 1000 - . gene_id "SS.2386"; transcript_id "SS.2386.1"; cov "11423.135009"; FPKM "558.642699"; TPM "1194.571795"; +CM143129.1 StringTie exon 2256333 2257993 1000 - . gene_id "SS.2386"; transcript_id "SS.2386.1"; exon_number "1"; cov "11690.733398"; +CM143129.1 StringTie exon 2258397 2258446 1000 - . gene_id "SS.2386"; transcript_id "SS.2386.1"; exon_number "2"; cov "2533.520020"; +CM143129.1 StringTie transcript 2265028 2267051 1000 . . gene_id "SS.2387"; transcript_id "SS.2387.1"; cov "824.043478"; FPKM "40.299434"; TPM "86.174163"; +CM143129.1 StringTie exon 2265028 2267051 1000 . . gene_id "SS.2387"; transcript_id "SS.2387.1"; exon_number "1"; cov "824.043457"; +CM143129.1 StringTie transcript 2267678 2269659 1000 . . gene_id "SS.2388"; transcript_id "SS.2388.1"; cov "5275.620081"; FPKM "258.001559"; TPM "551.696793"; +CM143129.1 StringTie exon 2267678 2269659 1000 . . gene_id "SS.2388"; transcript_id "SS.2388.1"; exon_number "1"; cov "5275.620117"; +CM143129.1 StringTie transcript 2270380 2271247 1000 . . gene_id "SS.2389"; transcript_id "SS.2389.1"; cov "3572.365207"; FPKM "174.704732"; TPM "373.579294"; +CM143129.1 StringTie exon 2270380 2271247 1000 . . gene_id "SS.2389"; transcript_id "SS.2389.1"; exon_number "1"; cov "3572.365234"; +CM143129.1 StringTie transcript 2276662 2277622 1000 . . gene_id "SS.2390"; transcript_id "SS.2390.1"; cov "1656.386056"; FPKM "81.004731"; TPM "173.216202"; +CM143129.1 StringTie exon 2276662 2277622 1000 . . gene_id "SS.2390"; transcript_id "SS.2390.1"; exon_number "1"; cov "1656.386108"; +CM143129.1 StringTie transcript 2278239 2281062 1000 . . gene_id "SS.2391"; transcript_id "SS.2391.1"; cov "1288.139164"; FPKM "62.995801"; TPM "134.706866"; +CM143129.1 StringTie exon 2278239 2281062 1000 . . gene_id "SS.2391"; transcript_id "SS.2391.1"; exon_number "1"; cov "1288.139160"; +CM143129.1 StringTie transcript 2326150 2326426 1000 . . gene_id "SS.2392"; transcript_id "SS.2392.1"; cov "25.693141"; FPKM "1.256510"; TPM "2.686854"; +CM143129.1 StringTie exon 2326150 2326426 1000 . . gene_id "SS.2392"; transcript_id "SS.2392.1"; exon_number "1"; cov "25.693140"; +CM143129.1 StringTie transcript 2327775 2328274 1000 . . gene_id "SS.2393"; transcript_id "SS.2393.1"; cov "10.920000"; FPKM "0.534037"; TPM "1.141957"; +CM143129.1 StringTie exon 2327775 2328274 1000 . . gene_id "SS.2393"; transcript_id "SS.2393.1"; exon_number "1"; cov "10.920000"; +CM143129.1 StringTie transcript 2328604 2329748 1000 . . gene_id "SS.2394"; transcript_id "SS.2394.1"; cov "7.878585"; FPKM "0.385298"; TPM "0.823901"; +CM143129.1 StringTie exon 2328604 2329748 1000 . . gene_id "SS.2394"; transcript_id "SS.2394.1"; exon_number "1"; cov "7.878585"; +CM143129.1 StringTie transcript 2330165 2331730 1000 . . gene_id "SS.2395"; transcript_id "SS.2395.1"; cov "10.735929"; FPKM "0.525035"; TPM "1.122707"; +CM143129.1 StringTie exon 2330165 2331730 1000 . . gene_id "SS.2395"; transcript_id "SS.2395.1"; exon_number "1"; cov "10.735929"; +CM143129.1 StringTie transcript 2332082 2333903 1000 . . gene_id "SS.2396"; transcript_id "SS.2396.1"; cov "7.985031"; FPKM "0.390504"; TPM "0.835033"; +CM143129.1 StringTie exon 2332082 2333903 1000 . . gene_id "SS.2396"; transcript_id "SS.2396.1"; exon_number "1"; cov "7.985031"; +CM143130.1 StringTie transcript 293 556 1000 . . gene_id "SS.2397"; transcript_id "SS.2397.1"; cov "12.526515"; FPKM "0.612603"; TPM "1.309958"; +CM143130.1 StringTie exon 293 556 1000 . . gene_id "SS.2397"; transcript_id "SS.2397.1"; exon_number "1"; cov "12.526515"; +CM143130.1 StringTie transcript 6607 6975 1000 . . gene_id "SS.2398"; transcript_id "SS.2398.1"; cov "10.464770"; FPKM "0.511774"; TPM "1.094351"; +CM143130.1 StringTie exon 6607 6975 1000 . . gene_id "SS.2398"; transcript_id "SS.2398.1"; exon_number "1"; cov "10.464769"; +CM143130.1 StringTie transcript 9635 11502 1000 . . gene_id "SS.2399"; transcript_id "SS.2399.1"; cov "17.563086"; FPKM "0.858914"; TPM "1.836656"; +CM143130.1 StringTie exon 9635 11502 1000 . . gene_id "SS.2399"; transcript_id "SS.2399.1"; exon_number "1"; cov "17.563086"; +CM143129.1 StringTie transcript 2284596 2285575 1000 + . gene_id "SS.2400"; transcript_id "SS.2400.1"; cov "20058.247655"; FPKM "980.938560"; TPM "2097.586773"; +CM143129.1 StringTie exon 2284596 2284647 1000 + . gene_id "SS.2400"; transcript_id "SS.2400.1"; exon_number "1"; cov "3002.576904"; +CM143129.1 StringTie exon 2285095 2285575 1000 + . gene_id "SS.2400"; transcript_id "SS.2400.1"; exon_number "2"; cov "21902.103516"; +CM143129.1 StringTie transcript 2288563 2290528 1000 + . gene_id "SS.2401"; transcript_id "SS.2401.1"; cov "2015.478307"; FPKM "98.565958"; TPM "210.768194"; +CM143129.1 StringTie exon 2288563 2288672 1000 + . gene_id "SS.2401"; transcript_id "SS.2401.1"; exon_number "1"; cov "400.809082"; +CM143129.1 StringTie exon 2288749 2290528 1000 + . gene_id "SS.2401"; transcript_id "SS.2401.1"; exon_number "2"; cov "2115.261230"; +CM143129.1 StringTie transcript 2293900 2301197 1000 . . gene_id "SS.2402"; transcript_id "SS.2402.1"; cov "340.486572"; FPKM "16.651325"; TPM "35.606307"; +CM143129.1 StringTie exon 2293900 2301197 1000 . . gene_id "SS.2402"; transcript_id "SS.2402.1"; exon_number "1"; cov "340.486572"; +CM143129.1 StringTie transcript 2310251 2310743 1000 . . gene_id "SS.2403"; transcript_id "SS.2403.1"; cov "25882.115619"; FPKM "1265.751908"; TPM "2706.616465"; +CM143129.1 StringTie exon 2310251 2310743 1000 . . gene_id "SS.2403"; transcript_id "SS.2403.1"; exon_number "1"; cov "25882.115234"; +CM143129.1 StringTie transcript 2311128 2312304 1000 . . gene_id "SS.2404"; transcript_id "SS.2404.1"; cov "4220.335599"; FPKM "206.393400"; TPM "441.340654"; +CM143129.1 StringTie exon 2311128 2312304 1000 . . gene_id "SS.2404"; transcript_id "SS.2404.1"; exon_number "1"; cov "4220.335449"; +CM143129.1 StringTie transcript 2312697 2316682 1000 . . gene_id "SS.2405"; transcript_id "SS.2405.1"; cov "299.138986"; FPKM "14.629242"; TPM "31.282393"; +CM143129.1 StringTie exon 2312697 2316682 1000 . . gene_id "SS.2405"; transcript_id "SS.2405.1"; exon_number "1"; cov "299.138977"; +CM143129.1 StringTie transcript 2317238 2325104 1000 . . gene_id "SS.2406"; transcript_id "SS.2406.1"; cov "295.202205"; FPKM "14.436716"; TPM "30.870705"; +CM143129.1 StringTie exon 2317238 2325104 1000 . . gene_id "SS.2406"; transcript_id "SS.2406.1"; exon_number "1"; cov "295.202209"; +CM143130.1 StringTie transcript 12732 31847 1000 . . gene_id "SS.2407"; transcript_id "SS.2407.1"; cov "93.995841"; FPKM "4.596820"; TPM "9.829594"; +CM143130.1 StringTie exon 12732 31847 1000 . . gene_id "SS.2407"; transcript_id "SS.2407.1"; exon_number "1"; cov "93.995842"; +CM143130.1 StringTie transcript 13976 31847 1000 + . gene_id "SS.2408"; transcript_id "SS.2408.1"; cov "60.672958"; FPKM "2.967181"; TPM "6.344861"; +CM143130.1 StringTie exon 13976 24458 1000 + . gene_id "SS.2408"; transcript_id "SS.2408.1"; exon_number "1"; cov "56.941898"; +CM143130.1 StringTie exon 29444 31847 1000 + . gene_id "SS.2408"; transcript_id "SS.2408.1"; exon_number "2"; cov "76.942787"; +CM143130.1 StringTie transcript 32516 44113 1000 . . gene_id "SS.2409"; transcript_id "SS.2409.1"; cov "258.523086"; FPKM "12.642942"; TPM "27.034994"; +CM143130.1 StringTie exon 32516 44113 1000 . . gene_id "SS.2409"; transcript_id "SS.2409.1"; exon_number "1"; cov "258.523071"; +CM143130.1 StringTie transcript 51334 53747 1000 . . gene_id "SS.2410"; transcript_id "SS.2410.1"; cov "8.030712"; FPKM "0.392738"; TPM "0.839810"; +CM143130.1 StringTie exon 51334 53747 1000 . . gene_id "SS.2410"; transcript_id "SS.2410.1"; exon_number "1"; cov "8.030712"; +CM143130.1 StringTie transcript 58862 63667 1000 . . gene_id "SS.2411"; transcript_id "SS.2411.1"; cov "28.336103"; FPKM "1.385763"; TPM "2.963242"; +CM143130.1 StringTie exon 58862 63667 1000 . . gene_id "SS.2411"; transcript_id "SS.2411.1"; exon_number "1"; cov "28.336103"; +CM143130.1 StringTie transcript 63848 64098 1000 . . gene_id "SS.2412"; transcript_id "SS.2412.1"; cov "20.260240"; FPKM "0.990817"; TPM "2.118710"; +CM143130.1 StringTie exon 63848 64098 1000 . . gene_id "SS.2412"; transcript_id "SS.2412.1"; exon_number "1"; cov "20.260241"; +CM143130.1 StringTie transcript 64526 65875 1000 . . gene_id "SS.2413"; transcript_id "SS.2413.1"; cov "42.783704"; FPKM "2.092316"; TPM "4.474096"; +CM143130.1 StringTie exon 64526 65875 1000 . . gene_id "SS.2413"; transcript_id "SS.2413.1"; exon_number "1"; cov "42.783703"; +CM143130.1 StringTie transcript 66468 73440 1000 . . gene_id "SS.2414"; transcript_id "SS.2414.1"; cov "145.948785"; FPKM "7.137552"; TPM "15.262562"; +CM143130.1 StringTie exon 66468 73440 1000 . . gene_id "SS.2414"; transcript_id "SS.2414.1"; exon_number "1"; cov "145.948792"; +CM143130.1 StringTie transcript 67684 73440 1000 + . gene_id "SS.2415"; transcript_id "SS.2415.1"; cov "23.145644"; FPKM "1.131926"; TPM "2.420451"; +CM143130.1 StringTie exon 67684 71508 1000 + . gene_id "SS.2415"; transcript_id "SS.2415.1"; exon_number "1"; cov "5.329944"; +CM143130.1 StringTie exon 71566 73440 1000 + . gene_id "SS.2415"; transcript_id "SS.2415.1"; exon_number "2"; cov "59.489670"; +CM143130.1 StringTie transcript 74015 74888 1000 . . gene_id "SS.2416"; transcript_id "SS.2416.1"; cov "1621.762014"; FPKM "79.311459"; TPM "169.595401"; +CM143130.1 StringTie exon 74015 74888 1000 . . gene_id "SS.2416"; transcript_id "SS.2416.1"; exon_number "1"; cov "1621.761963"; +CM143130.1 StringTie transcript 75222 79894 1000 . . gene_id "SS.2417"; transcript_id "SS.2417.1"; cov "211.703189"; FPKM "10.353238"; TPM "22.138814"; +CM143130.1 StringTie exon 75222 79894 1000 . . gene_id "SS.2417"; transcript_id "SS.2417.1"; exon_number "1"; cov "211.703186"; +CM143130.1 StringTie transcript 80486 81993 1000 . . gene_id "SS.2418"; transcript_id "SS.2418.1"; cov "203.673740"; FPKM "9.960562"; TPM "21.299136"; +CM143130.1 StringTie exon 80486 81993 1000 . . gene_id "SS.2418"; transcript_id "SS.2418.1"; exon_number "1"; cov "203.673737"; +CM143130.1 StringTie transcript 85856 87224 1000 + . gene_id "SS.2419"; transcript_id "SS.2419.1"; cov "1035.700892"; FPKM "50.650434"; TPM "108.308190"; +CM143130.1 StringTie exon 85856 86120 1000 + . gene_id "SS.2419"; transcript_id "SS.2419.1"; exon_number "1"; cov "534.834229"; +CM143130.1 StringTie exon 86183 86258 1000 + . gene_id "SS.2419"; transcript_id "SS.2419.1"; exon_number "2"; cov "1110.831543"; +CM143130.1 StringTie exon 86324 87224 1000 + . gene_id "SS.2419"; transcript_id "SS.2419.1"; exon_number "3"; cov "1176.677246"; +CM143130.1 StringTie transcript 85856 87224 1000 + . gene_id "SS.2419"; transcript_id "SS.2419.2"; cov "322.452136"; FPKM "15.769360"; TPM "33.720360"; +CM143130.1 StringTie exon 85856 86120 1000 + . gene_id "SS.2419"; transcript_id "SS.2419.2"; exon_number "1"; cov "164.731857"; +CM143130.1 StringTie exon 86183 87224 1000 + . gene_id "SS.2419"; transcript_id "SS.2419.2"; exon_number "2"; cov "362.563354"; +CM143130.1 StringTie transcript 87541 88882 1000 . . gene_id "SS.2420"; transcript_id "SS.2420.1"; cov "15709.645306"; FPKM "768.272339"; TPM "1642.832652"; +CM143130.1 StringTie exon 87541 88882 1000 . . gene_id "SS.2420"; transcript_id "SS.2420.1"; exon_number "1"; cov "15709.645508"; +CM143130.1 StringTie transcript 92201 92616 1000 . . gene_id "SS.2421"; transcript_id "SS.2421.1"; cov "1133.177885"; FPKM "55.417497"; TPM "118.501824"; +CM143130.1 StringTie exon 92201 92616 1000 . . gene_id "SS.2421"; transcript_id "SS.2421.1"; exon_number "1"; cov "1133.177856"; +CM143130.1 StringTie transcript 96387 97054 1000 . . gene_id "SS.2422"; transcript_id "SS.2422.1"; cov "2658.887725"; FPKM "130.031573"; TPM "278.052591"; +CM143130.1 StringTie exon 96387 97054 1000 . . gene_id "SS.2422"; transcript_id "SS.2422.1"; exon_number "1"; cov "2658.887695"; +CM143130.1 StringTie transcript 97390 101267 1000 . . gene_id "SS.2423"; transcript_id "SS.2423.1"; cov "511.691851"; FPKM "25.024034"; TPM "53.510061"; +CM143130.1 StringTie exon 97390 101267 1000 . . gene_id "SS.2423"; transcript_id "SS.2423.1"; exon_number "1"; cov "511.691864"; +CM143130.1 StringTie transcript 106273 109331 1000 . . gene_id "SS.2424"; transcript_id "SS.2424.1"; cov "920.356653"; FPKM "45.009581"; TPM "96.246092"; +CM143130.1 StringTie exon 106273 109331 1000 . . gene_id "SS.2424"; transcript_id "SS.2424.1"; exon_number "1"; cov "920.356628"; +CM143130.1 StringTie transcript 109622 117844 1000 . . gene_id "SS.2425"; transcript_id "SS.2425.1"; cov "253.681990"; FPKM "12.406191"; TPM "26.528737"; +CM143130.1 StringTie exon 109622 117844 1000 . . gene_id "SS.2425"; transcript_id "SS.2425.1"; exon_number "1"; cov "253.681992"; +CM143130.1 StringTie transcript 118417 120982 1000 + . gene_id "SS.2426"; transcript_id "SS.2426.1"; cov "3856.383638"; FPKM "188.594511"; TPM "403.280458"; +CM143130.1 StringTie exon 118417 118811 1000 + . gene_id "SS.2426"; transcript_id "SS.2426.1"; exon_number "1"; cov "3221.108887"; +CM143130.1 StringTie exon 119410 120982 1000 + . gene_id "SS.2426"; transcript_id "SS.2426.1"; exon_number "2"; cov "4015.909180"; +CM143130.1 StringTie transcript 121793 126222 1000 + . gene_id "SS.2427"; transcript_id "SS.2427.1"; cov "3372.041187"; FPKM "164.907986"; TPM "352.630455"; +CM143130.1 StringTie exon 121793 121844 1000 + . gene_id "SS.2427"; transcript_id "SS.2427.1"; exon_number "1"; cov "3162.903809"; +CM143130.1 StringTie exon 122366 126222 1000 + . gene_id "SS.2427"; transcript_id "SS.2427.1"; exon_number "2"; cov "3374.860840"; +CM143130.1 StringTie transcript 126587 127430 1000 . . gene_id "SS.2428"; transcript_id "SS.2428.1"; cov "1554.182464"; FPKM "76.006515"; TPM "162.528284"; +CM143130.1 StringTie exon 126587 127430 1000 . . gene_id "SS.2428"; transcript_id "SS.2428.1"; exon_number "1"; cov "1554.182495"; +CM143130.1 StringTie transcript 127888 134698 1000 . . gene_id "SS.2429"; transcript_id "SS.2429.1"; cov "504.150198"; FPKM "24.655213"; TPM "52.721394"; +CM143130.1 StringTie exon 127888 134698 1000 . . gene_id "SS.2429"; transcript_id "SS.2429.1"; exon_number "1"; cov "504.150208"; +CM143130.1 StringTie transcript 135030 137518 1000 . . gene_id "SS.2430"; transcript_id "SS.2430.1"; cov "34.601045"; FPKM "1.692147"; TPM "3.618397"; +CM143130.1 StringTie exon 135030 137518 1000 . . gene_id "SS.2430"; transcript_id "SS.2430.1"; exon_number "1"; cov "34.601044"; +CM143130.1 StringTie transcript 150074 151109 1000 . . gene_id "SS.2431"; transcript_id "SS.2431.1"; cov "5.758687"; FPKM "0.281626"; TPM "0.602213"; +CM143130.1 StringTie exon 150074 151109 1000 . . gene_id "SS.2431"; transcript_id "SS.2431.1"; exon_number "1"; cov "5.758687"; +CM143130.1 StringTie transcript 137897 148902 1000 . . gene_id "SS.2432"; transcript_id "SS.2432.1"; cov "629.411321"; FPKM "30.781046"; TPM "65.820548"; +CM143130.1 StringTie exon 137897 148902 1000 . . gene_id "SS.2432"; transcript_id "SS.2432.1"; exon_number "1"; cov "629.411316"; +CM143130.1 StringTie transcript 151648 153551 1000 . . gene_id "SS.2433"; transcript_id "SS.2433.1"; cov "806.542017"; FPKM "39.443534"; TPM "84.343951"; +CM143130.1 StringTie exon 151648 153551 1000 . . gene_id "SS.2433"; transcript_id "SS.2433.1"; exon_number "1"; cov "806.541992"; +CM143130.1 StringTie transcript 153772 154201 1000 + . gene_id "SS.2434"; transcript_id "SS.2434.1"; cov "856.532967"; FPKM "41.888316"; TPM "89.571744"; +CM143130.1 StringTie exon 153772 153826 1000 + . gene_id "SS.2434"; transcript_id "SS.2434.1"; exon_number "1"; cov "225.854538"; +CM143130.1 StringTie exon 153893 154201 1000 + . gene_id "SS.2434"; transcript_id "SS.2434.1"; exon_number "2"; cov "968.789673"; +CM143130.1 StringTie transcript 154414 156012 1000 . . gene_id "SS.2435"; transcript_id "SS.2435.1"; cov "138.742339"; FPKM "6.785125"; TPM "14.508949"; +CM143130.1 StringTie exon 154414 156012 1000 . . gene_id "SS.2435"; transcript_id "SS.2435.1"; exon_number "1"; cov "138.742340"; +CM143130.1 StringTie transcript 156514 158012 1000 . . gene_id "SS.2436"; transcript_id "SS.2436.1"; cov "569.557705"; FPKM "27.853934"; TPM "59.561370"; +CM143130.1 StringTie exon 156514 158012 1000 . . gene_id "SS.2436"; transcript_id "SS.2436.1"; exon_number "1"; cov "569.557678"; +CM143130.1 StringTie transcript 158290 159929 1000 . . gene_id "SS.2437"; transcript_id "SS.2437.1"; cov "1498.145732"; FPKM "73.266067"; TPM "156.668256"; +CM143130.1 StringTie exon 158290 159929 1000 . . gene_id "SS.2437"; transcript_id "SS.2437.1"; exon_number "1"; cov "1498.145752"; +CM143130.1 StringTie transcript 160204 165673 1000 . . gene_id "SS.2438"; transcript_id "SS.2438.1"; cov "2346.281536"; FPKM "114.743724"; TPM "245.361868"; +CM143130.1 StringTie exon 160204 165673 1000 . . gene_id "SS.2438"; transcript_id "SS.2438.1"; exon_number "1"; cov "2346.281494"; +CM143130.1 StringTie transcript 165978 175252 1000 . . gene_id "SS.2439"; transcript_id "SS.2439.1"; cov "138.285714"; FPKM "6.762794"; TPM "14.461198"; +CM143130.1 StringTie exon 165978 175252 1000 . . gene_id "SS.2439"; transcript_id "SS.2439.1"; exon_number "1"; cov "138.285721"; +CM143130.1 StringTie transcript 175459 179316 1000 . . gene_id "SS.2440"; transcript_id "SS.2440.1"; cov "1002.363142"; FPKM "49.020068"; TPM "104.821902"; +CM143130.1 StringTie exon 175459 179316 1000 . . gene_id "SS.2440"; transcript_id "SS.2440.1"; exon_number "1"; cov "1002.363159"; +CM143130.1 StringTie transcript 184902 185655 1000 . . gene_id "SS.2441"; transcript_id "SS.2441.1"; cov "6272.599469"; FPKM "306.758337"; TPM "655.955690"; +CM143130.1 StringTie exon 184902 185655 1000 . . gene_id "SS.2441"; transcript_id "SS.2441.1"; exon_number "1"; cov "6272.599609"; +CM143130.1 StringTie transcript 192431 194755 1000 . . gene_id "SS.2442"; transcript_id "SS.2442.1"; cov "577.668817"; FPKM "28.250604"; TPM "60.409588"; +CM143130.1 StringTie exon 192431 194755 1000 . . gene_id "SS.2442"; transcript_id "SS.2442.1"; exon_number "1"; cov "577.668823"; +CM143130.1 StringTie transcript 195182 195656 1000 . . gene_id "SS.2443"; transcript_id "SS.2443.1"; cov "80.278947"; FPKM "3.926002"; TPM "8.395153"; +CM143130.1 StringTie exon 195182 195656 1000 . . gene_id "SS.2443"; transcript_id "SS.2443.1"; exon_number "1"; cov "80.278946"; +CM143130.1 StringTie transcript 196931 202663 1000 . . gene_id "SS.2444"; transcript_id "SS.2444.1"; cov "790.643991"; FPKM "38.666049"; TPM "82.681419"; +CM143130.1 StringTie exon 196931 202663 1000 . . gene_id "SS.2444"; transcript_id "SS.2444.1"; exon_number "1"; cov "790.643982"; +CM143130.1 StringTie transcript 203177 204202 1000 . . gene_id "SS.2445"; transcript_id "SS.2445.1"; cov "2821.137427"; FPKM "137.966314"; TPM "295.019817"; +CM143130.1 StringTie exon 203177 204202 1000 . . gene_id "SS.2445"; transcript_id "SS.2445.1"; exon_number "1"; cov "2821.137451"; +CM143130.1 StringTie transcript 204562 208144 1000 . . gene_id "SS.2446"; transcript_id "SS.2446.1"; cov "290.629640"; FPKM "14.213097"; TPM "30.392530"; +CM143130.1 StringTie exon 204562 208144 1000 . . gene_id "SS.2446"; transcript_id "SS.2446.1"; exon_number "1"; cov "290.629639"; +CM143130.1 StringTie transcript 208542 212825 1000 . . gene_id "SS.2447"; transcript_id "SS.2447.1"; cov "1097.424136"; FPKM "53.668978"; TPM "114.762884"; +CM143130.1 StringTie exon 208542 212825 1000 . . gene_id "SS.2447"; transcript_id "SS.2447.1"; exon_number "1"; cov "1097.424194"; +CM143130.1 StringTie transcript 213170 217261 1000 . . gene_id "SS.2448"; transcript_id "SS.2448.1"; cov "325.507820"; FPKM "15.918797"; TPM "34.039908"; +CM143130.1 StringTie exon 213170 217261 1000 . . gene_id "SS.2448"; transcript_id "SS.2448.1"; exon_number "1"; cov "325.507812"; +CM143130.1 StringTie transcript 217609 220243 1000 . . gene_id "SS.2449"; transcript_id "SS.2449.1"; cov "400.564326"; FPKM "19.589398"; TPM "41.888925"; +CM143130.1 StringTie exon 217609 220243 1000 . . gene_id "SS.2449"; transcript_id "SS.2449.1"; exon_number "1"; cov "400.564331"; +CM143130.1 StringTie transcript 220492 221299 1000 + . gene_id "SS.2450"; transcript_id "SS.2450.1"; cov "1200.464865"; FPKM "58.708133"; TPM "125.538345"; +CM143130.1 StringTie exon 220492 220641 1000 + . gene_id "SS.2450"; transcript_id "SS.2450.1"; exon_number "1"; cov "321.966675"; +CM143130.1 StringTie exon 220710 221299 1000 + . gene_id "SS.2450"; transcript_id "SS.2450.1"; exon_number "2"; cov "1423.811890"; +CM143130.1 StringTie transcript 221778 223751 1000 + . gene_id "SS.2451"; transcript_id "SS.2451.1"; cov "1908.385237"; FPKM "93.328625"; TPM "199.568960"; +CM143130.1 StringTie exon 221778 222002 1000 + . gene_id "SS.2451"; transcript_id "SS.2451.1"; exon_number "1"; cov "1262.737793"; +CM143130.1 StringTie exon 222121 223751 1000 + . gene_id "SS.2451"; transcript_id "SS.2451.1"; exon_number "2"; cov "1997.453735"; +CM143130.1 StringTie transcript 224146 226967 1000 . . gene_id "SS.2452"; transcript_id "SS.2452.1"; cov "1841.799079"; FPKM "90.072262"; TPM "192.605728"; +CM143130.1 StringTie exon 224146 226967 1000 . . gene_id "SS.2452"; transcript_id "SS.2452.1"; exon_number "1"; cov "1841.799072"; +CM143130.1 StringTie transcript 227716 231608 1000 . . gene_id "SS.2453"; transcript_id "SS.2453.1"; cov "1028.022348"; FPKM "50.274918"; TPM "107.505208"; +CM143130.1 StringTie exon 227716 231608 1000 . . gene_id "SS.2453"; transcript_id "SS.2453.1"; exon_number "1"; cov "1028.022339"; +CM143130.1 StringTie transcript 232322 241735 1000 . . gene_id "SS.2454"; transcript_id "SS.2454.1"; cov "593.830571"; FPKM "29.040987"; TPM "62.099699"; +CM143130.1 StringTie exon 232322 241735 1000 . . gene_id "SS.2454"; transcript_id "SS.2454.1"; exon_number "1"; cov "593.830566"; +CM143130.1 StringTie transcript 244263 248222 1000 . . gene_id "SS.2455"; transcript_id "SS.2455.1"; cov "90.954545"; FPKM "4.448086"; TPM "9.511551"; +CM143130.1 StringTie exon 244263 248222 1000 . . gene_id "SS.2455"; transcript_id "SS.2455.1"; exon_number "1"; cov "90.954544"; +CM143130.1 StringTie transcript 252132 258240 1000 . . gene_id "SS.2456"; transcript_id "SS.2456.1"; cov "2791.644459"; FPKM "136.523975"; TPM "291.935596"; +CM143130.1 StringTie exon 252132 258240 1000 . . gene_id "SS.2456"; transcript_id "SS.2456.1"; exon_number "1"; cov "2791.644531"; +CM143130.1 StringTie transcript 259001 261205 1000 . . gene_id "SS.2457"; transcript_id "SS.2457.1"; cov "1499.215420"; FPKM "73.318380"; TPM "156.780118"; +CM143130.1 StringTie exon 259001 261205 1000 . . gene_id "SS.2457"; transcript_id "SS.2457.1"; exon_number "1"; cov "1499.215454"; +CM143130.1 StringTie transcript 261696 263602 1000 . . gene_id "SS.2458"; transcript_id "SS.2458.1"; cov "1582.690614"; FPKM "77.400692"; TPM "165.509518"; +CM143130.1 StringTie exon 261696 263602 1000 . . gene_id "SS.2458"; transcript_id "SS.2458.1"; exon_number "1"; cov "1582.690674"; +CM143130.1 StringTie transcript 267962 272010 1000 . . gene_id "SS.2459"; transcript_id "SS.2459.1"; cov "684.320079"; FPKM "33.466331"; TPM "71.562620"; +CM143130.1 StringTie exon 267962 272010 1000 . . gene_id "SS.2459"; transcript_id "SS.2459.1"; exon_number "1"; cov "684.320068"; +CM143130.1 StringTie transcript 273102 273619 1000 . . gene_id "SS.2460"; transcript_id "SS.2460.1"; cov "7424.701255"; FPKM "363.101298"; TPM "776.436477"; +CM143130.1 StringTie exon 273102 273619 1000 . . gene_id "SS.2460"; transcript_id "SS.2460.1"; exon_number "1"; cov "7424.701172"; +CM143130.1 StringTie transcript 273102 275713 1000 - . gene_id "SS.2461"; transcript_id "SS.2461.1"; cov "2336.532092"; FPKM "114.266932"; TPM "244.342322"; +CM143130.1 StringTie exon 273102 275174 1000 - . gene_id "SS.2461"; transcript_id "SS.2461.1"; exon_number "1"; cov "2710.480469"; +CM143130.1 StringTie exon 275263 275713 1000 - . gene_id "SS.2461"; transcript_id "SS.2461.1"; exon_number "2"; cov "617.696228"; +CM143130.1 StringTie transcript 283410 286965 1000 . . gene_id "SS.2462"; transcript_id "SS.2462.1"; cov "825.781496"; FPKM "40.384431"; TPM "86.355916"; +CM143130.1 StringTie exon 283410 286965 1000 . . gene_id "SS.2462"; transcript_id "SS.2462.1"; exon_number "1"; cov "825.781494"; +CM143130.1 StringTie transcript 331152 332240 1000 . . gene_id "SS.2463"; transcript_id "SS.2463.1"; cov "26.376492"; FPKM "1.289929"; TPM "2.758316"; +CM143130.1 StringTie exon 331152 332240 1000 . . gene_id "SS.2463"; transcript_id "SS.2463.1"; exon_number "1"; cov "26.376492"; +CM143130.1 StringTie transcript 290830 292508 1000 . . gene_id "SS.2464"; transcript_id "SS.2464.1"; cov "4854.299583"; FPKM "237.397091"; TPM "507.637296"; +CM143130.1 StringTie exon 290830 292508 1000 . . gene_id "SS.2464"; transcript_id "SS.2464.1"; exon_number "1"; cov "4854.299805"; +CM143130.1 StringTie transcript 299099 300394 1000 . . gene_id "SS.2465"; transcript_id "SS.2465.1"; cov "9858.536265"; FPKM "482.126781"; TPM "1030.954230"; +CM143130.1 StringTie exon 299099 300394 1000 . . gene_id "SS.2465"; transcript_id "SS.2465.1"; exon_number "1"; cov "9858.536133"; +CM143130.1 StringTie transcript 301425 302574 1000 . . gene_id "SS.2466"; transcript_id "SS.2466.1"; cov "853.026957"; FPKM "41.716856"; TPM "89.205104"; +CM143130.1 StringTie exon 301425 302574 1000 . . gene_id "SS.2466"; transcript_id "SS.2466.1"; exon_number "1"; cov "853.026978"; +CM143130.1 StringTie transcript 303834 304390 1000 . . gene_id "SS.2467"; transcript_id "SS.2467.1"; cov "21192.775583"; FPKM "1036.422081"; TPM "2216.229778"; +CM143130.1 StringTie exon 303834 304390 1000 . . gene_id "SS.2467"; transcript_id "SS.2467.1"; exon_number "1"; cov "21192.775391"; +CM143130.1 StringTie transcript 317233 320047 1000 + . gene_id "SS.2468"; transcript_id "SS.2468.1"; cov "1518.152850"; FPKM "74.244505"; TPM "158.760496"; +CM143130.1 StringTie exon 317233 318953 1000 + . gene_id "SS.2468"; transcript_id "SS.2468.1"; exon_number "1"; cov "1753.137085"; +CM143130.1 StringTie exon 319067 320047 1000 + . gene_id "SS.2468"; transcript_id "SS.2468.1"; exon_number "2"; cov "1105.912354"; +CM143130.1 StringTie transcript 323350 323973 1000 . . gene_id "SS.2469"; transcript_id "SS.2469.1"; cov "13814.546474"; FPKM "675.593480"; TPM "1444.653115"; +CM143130.1 StringTie exon 323350 323973 1000 . . gene_id "SS.2469"; transcript_id "SS.2469.1"; exon_number "1"; cov "13814.546875"; +CM143130.1 StringTie transcript 323350 323973 1000 + . gene_id "SS.2470"; transcript_id "SS.2470.1"; cov "6866.892292"; FPKM "335.821930"; TPM "718.103729"; +CM143130.1 StringTie exon 323350 323733 1000 + . gene_id "SS.2470"; transcript_id "SS.2470.1"; exon_number "1"; cov "7931.285645"; +CM143130.1 StringTie exon 323758 323973 1000 + . gene_id "SS.2470"; transcript_id "SS.2470.1"; exon_number "2"; cov "4974.637207"; +CM143130.1 StringTie transcript 326729 327870 1000 . . gene_id "SS.2471"; transcript_id "SS.2471.1"; cov "194.264380"; FPKM "9.500402"; TPM "20.315154"; +CM143130.1 StringTie exon 326729 327870 1000 . . gene_id "SS.2471"; transcript_id "SS.2471.1"; exon_number "1"; cov "194.264374"; +CM143130.1 StringTie transcript 326729 327758 1000 - . gene_id "SS.2472"; transcript_id "SS.2472.1"; cov "179.482020"; FPKM "8.777478"; TPM "18.769292"; +CM143130.1 StringTie exon 326729 327476 1000 - . gene_id "SS.2472"; transcript_id "SS.2472.1"; exon_number "1"; cov "196.396515"; +CM143130.1 StringTie exon 327594 327758 1000 - . gene_id "SS.2472"; transcript_id "SS.2472.1"; exon_number "2"; cov "102.802971"; +CM143130.1 StringTie transcript 329171 330538 1000 . . gene_id "SS.2473"; transcript_id "SS.2473.1"; cov "23566.146199"; FPKM "1152.490583"; TPM "2464.424480"; +CM143130.1 StringTie exon 329171 330538 1000 . . gene_id "SS.2473"; transcript_id "SS.2473.1"; exon_number "1"; cov "23566.146484"; +CM143130.1 StringTie transcript 343032 344721 1000 . . gene_id "SS.2474"; transcript_id "SS.2474.1"; cov "3906.385799"; FPKM "191.039842"; TPM "408.509423"; +CM143130.1 StringTie exon 343032 344721 1000 . . gene_id "SS.2474"; transcript_id "SS.2474.1"; exon_number "1"; cov "3906.385742"; +CM143130.1 StringTie transcript 344996 349483 1000 . . gene_id "SS.2475"; transcript_id "SS.2475.1"; cov "421.295677"; FPKM "20.603254"; TPM "44.056901"; +CM143130.1 StringTie exon 344996 349483 1000 . . gene_id "SS.2475"; transcript_id "SS.2475.1"; exon_number "1"; cov "421.295685"; +CM143130.1 StringTie transcript 372468 373490 1000 . . gene_id "SS.2476"; transcript_id "SS.2476.1"; cov "11.119059"; FPKM "0.543772"; TPM "1.162773"; +CM143130.1 StringTie exon 372468 373490 1000 . . gene_id "SS.2476"; transcript_id "SS.2476.1"; exon_number "1"; cov "11.119060"; +CM143130.1 StringTie transcript 351902 353567 1000 + . gene_id "SS.2477"; transcript_id "SS.2477.1"; cov "2182.972170"; FPKM "106.757161"; TPM "228.283828"; +CM143130.1 StringTie exon 351902 351992 1000 + . gene_id "SS.2477"; transcript_id "SS.2477.1"; exon_number "1"; cov "176.527466"; +CM143130.1 StringTie exon 352078 353567 1000 + . gene_id "SS.2477"; transcript_id "SS.2477.1"; exon_number "2"; cov "2305.513428"; +CM143130.1 StringTie transcript 360804 367307 1000 . . gene_id "SS.2478"; transcript_id "SS.2478.1"; cov "994.073186"; FPKM "48.614652"; TPM "103.954982"; +CM143130.1 StringTie exon 360804 367307 1000 . . gene_id "SS.2478"; transcript_id "SS.2478.1"; exon_number "1"; cov "994.073181"; +CM143130.1 StringTie transcript 367557 370541 1000 . . gene_id "SS.2479"; transcript_id "SS.2479.1"; cov "287.087102"; FPKM "14.039851"; TPM "30.022070"; +CM143130.1 StringTie exon 367557 370541 1000 . . gene_id "SS.2479"; transcript_id "SS.2479.1"; exon_number "1"; cov "287.087097"; +CM143130.1 StringTie transcript 370797 371925 1000 . . gene_id "SS.2480"; transcript_id "SS.2480.1"; cov "2000.463242"; FPKM "97.831653"; TPM "209.197997"; +CM143130.1 StringTie exon 370797 371925 1000 . . gene_id "SS.2480"; transcript_id "SS.2480.1"; exon_number "1"; cov "2000.463257"; +CM143130.1 StringTie transcript 373775 378616 1000 . . gene_id "SS.2481"; transcript_id "SS.2481.1"; cov "161.889302"; FPKM "7.917115"; TPM "16.929538"; +CM143130.1 StringTie exon 373775 378616 1000 . . gene_id "SS.2481"; transcript_id "SS.2481.1"; exon_number "1"; cov "161.889297"; +CM143130.1 StringTie transcript 379907 381617 1000 . . gene_id "SS.2482"; transcript_id "SS.2482.1"; cov "633.843366"; FPKM "30.997793"; TPM "66.284029"; +CM143130.1 StringTie exon 379907 381617 1000 . . gene_id "SS.2482"; transcript_id "SS.2482.1"; exon_number "1"; cov "633.843384"; +CM143130.1 StringTie transcript 381844 382912 1000 . . gene_id "SS.2483"; transcript_id "SS.2483.1"; cov "5690.382601"; FPKM "278.285312"; TPM "595.070491"; +CM143130.1 StringTie exon 381844 382912 1000 . . gene_id "SS.2483"; transcript_id "SS.2483.1"; exon_number "1"; cov "5690.382812"; +CM143130.1 StringTie transcript 384653 387849 1000 . . gene_id "SS.2484"; transcript_id "SS.2484.1"; cov "710.100876"; FPKM "34.727128"; TPM "74.258641"; +CM143130.1 StringTie exon 384653 387849 1000 . . gene_id "SS.2484"; transcript_id "SS.2484.1"; exon_number "1"; cov "710.100891"; +CM143130.1 StringTie transcript 387075 389028 1000 - . gene_id "SS.2485"; transcript_id "SS.2485.1"; cov "246.549371"; FPKM "12.057374"; TPM "25.782845"; +CM143130.1 StringTie exon 387075 388273 1000 - . gene_id "SS.2485"; transcript_id "SS.2485.1"; exon_number "1"; cov "209.437378"; +CM143130.1 StringTie exon 388356 389028 1000 - . gene_id "SS.2485"; transcript_id "SS.2485.1"; exon_number "2"; cov "312.667175"; +CM143130.1 StringTie transcript 389283 391874 1000 . . gene_id "SS.2486"; transcript_id "SS.2486.1"; cov "103.510380"; FPKM "5.062123"; TPM "10.824575"; +CM143130.1 StringTie exon 389283 391874 1000 . . gene_id "SS.2486"; transcript_id "SS.2486.1"; exon_number "1"; cov "103.510384"; +CM143130.1 StringTie transcript 389283 391091 1000 - . gene_id "SS.2487"; transcript_id "SS.2487.1"; cov "11.821038"; FPKM "0.578102"; TPM "1.236182"; +CM143130.1 StringTie exon 389283 390998 1000 - . gene_id "SS.2487"; transcript_id "SS.2487.1"; exon_number "1"; cov "11.708168"; +CM143130.1 StringTie exon 391035 391091 1000 - . gene_id "SS.2487"; transcript_id "SS.2487.1"; exon_number "2"; cov "15.219008"; +CM143130.1 StringTie transcript 391093 391874 1000 + . gene_id "SS.2488"; transcript_id "SS.2488.1"; cov "18.038246"; FPKM "0.882151"; TPM "1.886346"; +CM143130.1 StringTie exon 391093 391149 1000 + . gene_id "SS.2488"; transcript_id "SS.2488.1"; exon_number "1"; cov "27.658300"; +CM143130.1 StringTie exon 391186 391874 1000 + . gene_id "SS.2488"; transcript_id "SS.2488.1"; exon_number "2"; cov "17.242393"; +CM143130.1 StringTie transcript 392719 393366 1000 - . gene_id "SS.2489"; transcript_id "SS.2489.1"; cov "52.701252"; FPKM "2.577328"; TPM "5.511222"; +CM143130.1 StringTie exon 392719 393215 1000 - . gene_id "SS.2489"; transcript_id "SS.2489.1"; exon_number "1"; cov "57.979877"; +CM143130.1 StringTie exon 393305 393366 1000 - . gene_id "SS.2489"; transcript_id "SS.2489.1"; exon_number "2"; cov "10.387096"; +CM143130.1 StringTie transcript 394223 395227 1000 . . gene_id "SS.2490"; transcript_id "SS.2490.1"; cov "298.106468"; FPKM "14.578748"; TPM "31.174417"; +CM143130.1 StringTie exon 394223 395227 1000 . . gene_id "SS.2490"; transcript_id "SS.2490.1"; exon_number "1"; cov "298.106476"; +CM143130.1 StringTie transcript 395429 396421 1000 + . gene_id "SS.2491"; transcript_id "SS.2491.1"; cov "1183.786182"; FPKM "57.892471"; TPM "123.794176"; +CM143130.1 StringTie exon 395429 395548 1000 + . gene_id "SS.2491"; transcript_id "SS.2491.1"; exon_number "1"; cov "228.552948"; +CM143130.1 StringTie exon 395628 395647 1000 + . gene_id "SS.2491"; transcript_id "SS.2491.1"; exon_number "2"; cov "572.819580"; +CM143130.1 StringTie exon 395733 396421 1000 + . gene_id "SS.2491"; transcript_id "SS.2491.1"; exon_number "3"; cov "1367.889648"; +CM143130.1 StringTie transcript 395429 396421 1000 + . gene_id "SS.2491"; transcript_id "SS.2491.2"; cov "103.595220"; FPKM "5.066272"; TPM "10.833447"; +CM143130.1 StringTie exon 395429 395548 1000 + . gene_id "SS.2491"; transcript_id "SS.2491.2"; exon_number "1"; cov "19.922056"; +CM143130.1 StringTie exon 395628 395647 1000 + . gene_id "SS.2491"; transcript_id "SS.2491.2"; exon_number "2"; cov "49.930416"; +CM143130.1 StringTie exon 395740 396421 1000 + . gene_id "SS.2491"; transcript_id "SS.2491.2"; exon_number "3"; cov "119.891518"; +CM143130.1 StringTie transcript 397181 398855 1000 . . gene_id "SS.2492"; transcript_id "SS.2492.1"; cov "2440.075821"; FPKM "119.330687"; TPM "255.170384"; +CM143130.1 StringTie exon 397181 398855 1000 . . gene_id "SS.2492"; transcript_id "SS.2492.1"; exon_number "1"; cov "2440.075928"; +CM143130.1 StringTie transcript 399181 399985 1000 . . gene_id "SS.2493"; transcript_id "SS.2493.1"; cov "484.365217"; FPKM "23.687638"; TPM "50.652384"; +CM143130.1 StringTie exon 399181 399985 1000 . . gene_id "SS.2493"; transcript_id "SS.2493.1"; exon_number "1"; cov "484.365204"; +CM143130.1 StringTie transcript 408051 409266 1000 . . gene_id "SS.2494"; transcript_id "SS.2494.1"; cov "1145.161184"; FPKM "56.003534"; TPM "119.754975"; +CM143130.1 StringTie exon 408051 409266 1000 . . gene_id "SS.2494"; transcript_id "SS.2494.1"; exon_number "1"; cov "1145.161133"; +CM143130.1 StringTie transcript 409885 411019 1000 + . gene_id "SS.2495"; transcript_id "SS.2495.1"; cov "21759.629268"; FPKM "1064.143776"; TPM "2275.508375"; +CM143130.1 StringTie exon 409885 409993 1000 + . gene_id "SS.2495"; transcript_id "SS.2495.1"; exon_number "1"; cov "4056.871582"; +CM143130.1 StringTie exon 410514 411019 1000 + . gene_id "SS.2495"; transcript_id "SS.2495.1"; exon_number "2"; cov "25573.068359"; +CM143130.1 StringTie transcript 414276 414829 1000 . . gene_id "SS.2496"; transcript_id "SS.2496.1"; cov "19.990975"; FPKM "0.977649"; TPM "2.090552"; +CM143130.1 StringTie exon 414276 414829 1000 . . gene_id "SS.2496"; transcript_id "SS.2496.1"; exon_number "1"; cov "19.990974"; +CM143130.1 StringTie transcript 415259 415815 1000 + . gene_id "SS.2497"; transcript_id "SS.2497.1"; cov "2867.778807"; FPKM "140.247287"; TPM "299.897329"; +CM143130.1 StringTie exon 415259 415409 1000 + . gene_id "SS.2497"; transcript_id "SS.2497.1"; exon_number "1"; cov "2540.188721"; +CM143130.1 StringTie exon 415481 415815 1000 + . gene_id "SS.2497"; transcript_id "SS.2497.1"; exon_number "2"; cov "3015.438721"; +CM143130.1 StringTie transcript 418583 422225 1000 . . gene_id "SS.2498"; transcript_id "SS.2498.1"; cov "1247.258304"; FPKM "60.996543"; TPM "130.431759"; +CM143130.1 StringTie exon 418583 422225 1000 . . gene_id "SS.2498"; transcript_id "SS.2498.1"; exon_number "1"; cov "1247.258301"; +CM143130.1 StringTie transcript 422512 424162 1000 . . gene_id "SS.2499"; transcript_id "SS.2499.1"; cov "615.932162"; FPKM "30.121854"; TPM "64.410968"; +CM143130.1 StringTie exon 422512 424162 1000 . . gene_id "SS.2499"; transcript_id "SS.2499.1"; exon_number "1"; cov "615.932190"; +CM143130.1 StringTie transcript 424474 426061 1000 . . gene_id "SS.2500"; transcript_id "SS.2500.1"; cov "6527.787154"; FPKM "319.238163"; TPM "682.641885"; +CM143130.1 StringTie exon 424474 426061 1000 . . gene_id "SS.2500"; transcript_id "SS.2500.1"; exon_number "1"; cov "6527.787109"; +CM143130.1 StringTie transcript 428532 432558 1000 . . gene_id "SS.2501"; transcript_id "SS.2501.1"; cov "893.378942"; FPKM "43.690250"; TPM "93.424904"; +CM143130.1 StringTie exon 428532 432558 1000 . . gene_id "SS.2501"; transcript_id "SS.2501.1"; exon_number "1"; cov "893.378967"; +CM143130.1 StringTie transcript 434050 434989 1000 . . gene_id "SS.2502"; transcript_id "SS.2502.1"; cov "17059.130851"; FPKM "834.268254"; TPM "1783.954802"; +CM143130.1 StringTie exon 434050 434989 1000 . . gene_id "SS.2502"; transcript_id "SS.2502.1"; exon_number "1"; cov "17059.130859"; +CM143130.1 StringTie transcript 435215 437894 1000 . . gene_id "SS.2503"; transcript_id "SS.2503.1"; cov "670.805224"; FPKM "32.805394"; TPM "70.149307"; +CM143130.1 StringTie exon 435215 437894 1000 . . gene_id "SS.2503"; transcript_id "SS.2503.1"; exon_number "1"; cov "670.805237"; +CM143130.1 StringTie transcript 440947 442672 1000 . . gene_id "SS.2504"; transcript_id "SS.2504.1"; cov "1676.767671"; FPKM "82.001484"; TPM "175.347605"; +CM143130.1 StringTie exon 440947 442672 1000 . . gene_id "SS.2504"; transcript_id "SS.2504.1"; exon_number "1"; cov "1676.767700"; +CM143130.1 StringTie transcript 442913 446108 1000 - . gene_id "SS.2505"; transcript_id "SS.2505.1"; cov "442.943589"; FPKM "21.661934"; TPM "46.320727"; +CM143130.1 StringTie exon 442913 444673 1000 - . gene_id "SS.2505"; transcript_id "SS.2505.1"; exon_number "1"; cov "477.216949"; +CM143130.1 StringTie exon 445743 445811 1000 - . gene_id "SS.2505"; transcript_id "SS.2505.1"; exon_number "2"; cov "277.426575"; +CM143130.1 StringTie exon 445886 446108 1000 - . gene_id "SS.2505"; transcript_id "SS.2505.1"; exon_number "3"; cov "223.505341"; +CM143130.1 StringTie transcript 442913 446108 1000 - . gene_id "SS.2505"; transcript_id "SS.2505.2"; cov "223.309589"; FPKM "10.920844"; TPM "23.352550"; +CM143130.1 StringTie exon 442913 445498 1000 - . gene_id "SS.2505"; transcript_id "SS.2505.2"; exon_number "1"; cov "233.975250"; +CM143130.1 StringTie exon 445743 445811 1000 - . gene_id "SS.2505"; transcript_id "SS.2505.2"; exon_number "2"; cov "151.312698"; +CM143130.1 StringTie exon 445886 446108 1000 - . gene_id "SS.2505"; transcript_id "SS.2505.2"; exon_number "3"; cov "121.903229"; +CM143130.1 StringTie transcript 442913 446108 1000 - . gene_id "SS.2505"; transcript_id "SS.2505.3"; cov "84.340725"; FPKM "4.124641"; TPM "8.819912"; +CM143130.1 StringTie exon 442913 445498 1000 - . gene_id "SS.2505"; transcript_id "SS.2505.3"; exon_number "1"; cov "88.452797"; +CM143130.1 StringTie exon 445743 446108 1000 - . gene_id "SS.2505"; transcript_id "SS.2505.3"; exon_number "2"; cov "55.286564"; +CM143130.1 StringTie transcript 462357 465952 1000 . . gene_id "SS.2506"; transcript_id "SS.2506.1"; cov "293.746663"; FPKM "14.365534"; TPM "30.718492"; +CM143130.1 StringTie exon 462357 465952 1000 . . gene_id "SS.2506"; transcript_id "SS.2506.1"; exon_number "1"; cov "293.746674"; +CM143130.1 StringTie transcript 466349 469135 1000 . . gene_id "SS.2507"; transcript_id "SS.2507.1"; cov "8920.734840"; FPKM "436.264072"; TPM "932.883855"; +CM143130.1 StringTie exon 466349 469135 1000 . . gene_id "SS.2507"; transcript_id "SS.2507.1"; exon_number "1"; cov "8920.734375"; +CM143130.1 StringTie transcript 469989 474633 1000 . . gene_id "SS.2508"; transcript_id "SS.2508.1"; cov "641.069537"; FPKM "31.351185"; TPM "67.039704"; +CM143130.1 StringTie exon 469989 474633 1000 . . gene_id "SS.2508"; transcript_id "SS.2508.1"; exon_number "1"; cov "641.069519"; +CM143130.1 StringTie transcript 475166 476263 1000 . . gene_id "SS.2509"; transcript_id "SS.2509.1"; cov "263.265938"; FPKM "12.874889"; TPM "27.530977"; +CM143130.1 StringTie exon 475166 476263 1000 . . gene_id "SS.2509"; transcript_id "SS.2509.1"; exon_number "1"; cov "263.265930"; +CM143130.1 StringTie transcript 476603 482141 1000 - . gene_id "SS.2510"; transcript_id "SS.2510.1"; cov "819.699285"; FPKM "40.086983"; TPM "85.719870"; +CM143130.1 StringTie exon 476603 481910 1000 - . gene_id "SS.2510"; transcript_id "SS.2510.1"; exon_number "1"; cov "836.713440"; +CM143130.1 StringTie exon 481993 482141 1000 - . gene_id "SS.2510"; transcript_id "SS.2510.1"; exon_number "2"; cov "213.583893"; +CM143130.1 StringTie transcript 482493 488236 1000 . . gene_id "SS.2511"; transcript_id "SS.2511.1"; cov "2818.354283"; FPKM "137.830205"; TPM "294.728770"; +CM143130.1 StringTie exon 482493 488236 1000 . . gene_id "SS.2511"; transcript_id "SS.2511.1"; exon_number "1"; cov "2818.354248"; +CM143130.1 StringTie transcript 488611 493970 1000 - . gene_id "SS.2512"; transcript_id "SS.2512.1"; cov "879.433086"; FPKM "43.008235"; TPM "91.966519"; +CM143130.1 StringTie exon 488611 490195 1000 - . gene_id "SS.2512"; transcript_id "SS.2512.1"; exon_number "1"; cov "1150.408203"; +CM143130.1 StringTie exon 490303 493970 1000 - . gene_id "SS.2512"; transcript_id "SS.2512.1"; exon_number "2"; cov "762.340515"; +CM143130.1 StringTie transcript 494176 501343 1000 . . gene_id "SS.2513"; transcript_id "SS.2513.1"; cov "360.388951"; FPKM "17.624641"; TPM "37.687594"; +CM143130.1 StringTie exon 494176 501343 1000 . . gene_id "SS.2513"; transcript_id "SS.2513.1"; exon_number "1"; cov "360.388947"; +CM143130.1 StringTie transcript 501759 502538 1000 . . gene_id "SS.2514"; transcript_id "SS.2514.1"; cov "119.866667"; FPKM "5.862019"; TPM "12.535030"; +CM143130.1 StringTie exon 501759 502538 1000 . . gene_id "SS.2514"; transcript_id "SS.2514.1"; exon_number "1"; cov "119.866669"; +CM143130.1 StringTie transcript 502906 508712 1000 . . gene_id "SS.2515"; transcript_id "SS.2515.1"; cov "354.168245"; FPKM "17.320421"; TPM "37.037065"; +CM143130.1 StringTie exon 502906 508712 1000 . . gene_id "SS.2515"; transcript_id "SS.2515.1"; exon_number "1"; cov "354.168243"; +CM143130.1 StringTie transcript 509051 510062 1000 . . gene_id "SS.2516"; transcript_id "SS.2516.1"; cov "174.204545"; FPKM "8.519386"; TPM "18.217401"; +CM143130.1 StringTie exon 509051 510062 1000 . . gene_id "SS.2516"; transcript_id "SS.2516.1"; exon_number "1"; cov "174.204544"; +CM143130.1 StringTie transcript 510373 511222 1000 . . gene_id "SS.2517"; transcript_id "SS.2517.1"; cov "82.551765"; FPKM "4.037153"; TPM "8.632832"; +CM143130.1 StringTie exon 510373 511222 1000 . . gene_id "SS.2517"; transcript_id "SS.2517.1"; exon_number "1"; cov "82.551765"; +CM143130.1 StringTie transcript 511508 516007 1000 . . gene_id "SS.2518"; transcript_id "SS.2518.1"; cov "532.818222"; FPKM "26.057208"; TPM "55.719347"; +CM143130.1 StringTie exon 511508 516007 1000 . . gene_id "SS.2518"; transcript_id "SS.2518.1"; exon_number "1"; cov "532.818237"; +CM143130.1 StringTie transcript 516578 519727 1000 + . gene_id "SS.2519"; transcript_id "SS.2519.1"; cov "201.822685"; FPKM "9.870037"; TPM "21.105562"; +CM143130.1 StringTie exon 516578 516728 1000 + . gene_id "SS.2519"; transcript_id "SS.2519.1"; exon_number "1"; cov "127.742546"; +CM143130.1 StringTie exon 516823 519727 1000 + . gene_id "SS.2519"; transcript_id "SS.2519.1"; exon_number "2"; cov "205.673325"; +CM143130.1 StringTie transcript 516578 518697 1000 + . gene_id "SS.2519"; transcript_id "SS.2519.2"; cov "100.169951"; FPKM "4.898761"; TPM "10.475250"; +CM143130.1 StringTie exon 516578 516684 1000 + . gene_id "SS.2519"; transcript_id "SS.2519.2"; exon_number "1"; cov "34.363312"; +CM143130.1 StringTie exon 516823 518697 1000 + . gene_id "SS.2519"; transcript_id "SS.2519.2"; exon_number "2"; cov "103.925316"; +CM143130.1 StringTie transcript 520998 521911 1000 . . gene_id "SS.2520"; transcript_id "SS.2520.1"; cov "2176.161926"; FPKM "106.424110"; TPM "227.571648"; +CM143130.1 StringTie exon 520998 521911 1000 . . gene_id "SS.2520"; transcript_id "SS.2520.1"; exon_number "1"; cov "2176.161865"; +CM143130.1 StringTie transcript 522626 524209 1000 . . gene_id "SS.2521"; transcript_id "SS.2521.1"; cov "714.837753"; FPKM "34.958782"; TPM "74.753999"; +CM143130.1 StringTie exon 522626 524209 1000 . . gene_id "SS.2521"; transcript_id "SS.2521.1"; exon_number "1"; cov "714.837769"; +CM143130.1 StringTie transcript 524544 525577 1000 - . gene_id "SS.2522"; transcript_id "SS.2522.1"; cov "604.475256"; FPKM "29.561560"; TPM "63.212865"; +CM143130.1 StringTie exon 524544 525397 1000 - . gene_id "SS.2522"; transcript_id "SS.2522.1"; exon_number "1"; cov "614.429382"; +CM143130.1 StringTie exon 525553 525577 1000 - . gene_id "SS.2522"; transcript_id "SS.2522.1"; exon_number "2"; cov "264.442505"; +CM143130.1 StringTie transcript 524544 525577 1000 - . gene_id "SS.2522"; transcript_id "SS.2522.2"; cov "74.624901"; FPKM "3.649493"; TPM "7.803882"; +CM143130.1 StringTie exon 524544 525469 1000 - . gene_id "SS.2522"; transcript_id "SS.2522.2"; exon_number "1"; cov "75.834068"; +CM143130.1 StringTie exon 525553 525577 1000 - . gene_id "SS.2522"; transcript_id "SS.2522.2"; exon_number "2"; cov "29.837492"; +CM143130.1 StringTie transcript 525954 528878 1000 + . gene_id "SS.2523"; transcript_id "SS.2523.1"; cov "515.556756"; FPKM "25.213045"; TPM "53.914233"; +CM143130.1 StringTie exon 525954 525978 1000 + . gene_id "SS.2523"; transcript_id "SS.2523.1"; exon_number "1"; cov "99.392159"; +CM143130.1 StringTie exon 526095 528878 1000 + . gene_id "SS.2523"; transcript_id "SS.2523.1"; exon_number "2"; cov "519.293884"; +CM143130.1 StringTie transcript 525954 535694 1000 + . gene_id "SS.2523"; transcript_id "SS.2523.2"; cov "500.938988"; FPKM "24.498170"; TPM "52.385583"; +CM143130.1 StringTie exon 525954 525978 1000 + . gene_id "SS.2523"; transcript_id "SS.2523.2"; exon_number "1"; cov "128.887848"; +CM143130.1 StringTie exon 526103 534600 1000 + . gene_id "SS.2523"; transcript_id "SS.2523.2"; exon_number "2"; cov "420.520020"; +CM143130.1 StringTie exon 534764 535694 1000 + . gene_id "SS.2523"; transcript_id "SS.2523.2"; exon_number "3"; cov "1244.979614"; +CM143130.1 StringTie transcript 541065 543790 1000 . . gene_id "SS.2524"; transcript_id "SS.2524.1"; cov "286.704329"; FPKM "14.021132"; TPM "29.982041"; +CM143130.1 StringTie exon 541065 543790 1000 . . gene_id "SS.2524"; transcript_id "SS.2524.1"; exon_number "1"; cov "286.704315"; +CM143130.1 StringTie transcript 544813 545421 1000 . . gene_id "SS.2525"; transcript_id "SS.2525.1"; cov "219.719212"; FPKM "10.745258"; TPM "22.977088"; +CM143130.1 StringTie exon 544813 545421 1000 . . gene_id "SS.2525"; transcript_id "SS.2525.1"; exon_number "1"; cov "219.719208"; +CM143130.1 StringTie transcript 545706 547612 1000 + . gene_id "SS.2526"; transcript_id "SS.2526.1"; cov "675.568692"; FPKM "33.038349"; TPM "70.647445"; +CM143130.1 StringTie exon 545706 545919 1000 + . gene_id "SS.2526"; transcript_id "SS.2526.1"; exon_number "1"; cov "253.542053"; +CM143130.1 StringTie exon 546000 547612 1000 + . gene_id "SS.2526"; transcript_id "SS.2526.1"; exon_number "2"; cov "731.559814"; +CM143130.1 StringTie transcript 548596 557521 1000 + . gene_id "SS.2527"; transcript_id "SS.2527.1"; cov "465.891560"; FPKM "22.784194"; TPM "48.720506"; +CM143130.1 StringTie exon 548596 552404 1000 + . gene_id "SS.2527"; transcript_id "SS.2527.1"; exon_number "1"; cov "49.113453"; +CM143130.1 StringTie exon 552480 555427 1000 + . gene_id "SS.2527"; transcript_id "SS.2527.1"; exon_number "2"; cov "222.389481"; +CM143130.1 StringTie exon 555503 557521 1000 + . gene_id "SS.2527"; transcript_id "SS.2527.1"; exon_number "3"; cov "1607.720215"; +CM143130.1 StringTie transcript 548596 555131 1000 + . gene_id "SS.2527"; transcript_id "SS.2527.2"; cov "63.996548"; FPKM "3.129719"; TPM "6.692425"; +CM143130.1 StringTie exon 548596 552404 1000 + . gene_id "SS.2527"; transcript_id "SS.2527.2"; exon_number "1"; cov "24.427374"; +CM143130.1 StringTie exon 552475 555131 1000 + . gene_id "SS.2527"; transcript_id "SS.2527.2"; exon_number "2"; cov "120.721794"; +CM143130.1 StringTie transcript 557824 564194 1000 . . gene_id "SS.2528"; transcript_id "SS.2528.1"; cov "167.655627"; FPKM "8.199115"; TPM "17.532550"; +CM143130.1 StringTie exon 557824 564194 1000 . . gene_id "SS.2528"; transcript_id "SS.2528.1"; exon_number "1"; cov "167.655624"; +CM143130.1 StringTie transcript 564838 566927 1000 . . gene_id "SS.2529"; transcript_id "SS.2529.1"; cov "1399.017225"; FPKM "68.418237"; TPM "146.301914"; +CM143130.1 StringTie exon 564838 566927 1000 . . gene_id "SS.2529"; transcript_id "SS.2529.1"; exon_number "1"; cov "1399.017212"; +CM143130.1 StringTie transcript 567379 571612 1000 . . gene_id "SS.2530"; transcript_id "SS.2530.1"; cov "277.605102"; FPKM "13.576139"; TPM "29.030492"; +CM143130.1 StringTie exon 567379 571612 1000 . . gene_id "SS.2530"; transcript_id "SS.2530.1"; exon_number "1"; cov "277.605103"; +CM143130.1 StringTie transcript 571925 577155 1000 . . gene_id "SS.2531"; transcript_id "SS.2531.1"; cov "337.709998"; FPKM "16.515538"; TPM "35.315948"; +CM143130.1 StringTie exon 571925 577155 1000 . . gene_id "SS.2531"; transcript_id "SS.2531.1"; exon_number "1"; cov "337.709991"; +CM143130.1 StringTie transcript 577498 580516 1000 . . gene_id "SS.2532"; transcript_id "SS.2532.1"; cov "218.595230"; FPKM "10.690290"; TPM "22.859547"; +CM143130.1 StringTie exon 577498 580516 1000 . . gene_id "SS.2532"; transcript_id "SS.2532.1"; exon_number "1"; cov "218.595230"; +CM143130.1 StringTie transcript 581328 582625 1000 . . gene_id "SS.2533"; transcript_id "SS.2533.1"; cov "8743.673344"; FPKM "427.604968"; TPM "914.367689"; +CM143130.1 StringTie exon 581328 582625 1000 . . gene_id "SS.2533"; transcript_id "SS.2533.1"; exon_number "1"; cov "8743.673828"; +CM143130.1 StringTie transcript 583077 586038 1000 . . gene_id "SS.2534"; transcript_id "SS.2534.1"; cov "460.324781"; FPKM "22.511953"; TPM "48.138361"; +CM143130.1 StringTie exon 583077 586038 1000 . . gene_id "SS.2534"; transcript_id "SS.2534.1"; exon_number "1"; cov "460.324768"; +CM143130.1 StringTie transcript 587560 588226 1000 + . gene_id "SS.2535"; transcript_id "SS.2535.1"; cov "1042.732441"; FPKM "50.994308"; TPM "109.043512"; +CM143130.1 StringTie exon 587560 587724 1000 + . gene_id "SS.2535"; transcript_id "SS.2535.1"; exon_number "1"; cov "553.424255"; +CM143130.1 StringTie exon 587794 588226 1000 + . gene_id "SS.2535"; transcript_id "SS.2535.1"; exon_number "2"; cov "1229.189331"; +CM143130.1 StringTie transcript 594245 594762 1000 . . gene_id "SS.2536"; transcript_id "SS.2536.1"; cov "371.650579"; FPKM "18.175386"; TPM "38.865276"; +CM143130.1 StringTie exon 594245 594762 1000 . . gene_id "SS.2536"; transcript_id "SS.2536.1"; exon_number "1"; cov "371.650574"; +CM143130.1 StringTie transcript 594862 599075 1000 . . gene_id "SS.2537"; transcript_id "SS.2537.1"; cov "71.489321"; FPKM "3.496149"; TPM "7.475980"; +CM143130.1 StringTie exon 594862 599075 1000 . . gene_id "SS.2537"; transcript_id "SS.2537.1"; exon_number "1"; cov "71.489319"; +CM143130.1 StringTie transcript 601036 602236 1000 . . gene_id "SS.2538"; transcript_id "SS.2538.1"; cov "6937.767694"; FPKM "339.288056"; TPM "725.515508"; +CM143130.1 StringTie exon 601036 602236 1000 . . gene_id "SS.2538"; transcript_id "SS.2538.1"; exon_number "1"; cov "6937.767578"; +CM143130.1 StringTie transcript 602756 603798 1000 . . gene_id "SS.2539"; transcript_id "SS.2539.1"; cov "12751.743049"; FPKM "623.617610"; TPM "1333.510684"; +CM143130.1 StringTie exon 602756 603798 1000 . . gene_id "SS.2539"; transcript_id "SS.2539.1"; exon_number "1"; cov "12751.743164"; +CM143130.1 StringTie transcript 605861 607667 1000 . . gene_id "SS.2540"; transcript_id "SS.2540.1"; cov "502.832250"; FPKM "24.590759"; TPM "52.583570"; +CM143130.1 StringTie exon 605861 607667 1000 . . gene_id "SS.2540"; transcript_id "SS.2540.1"; exon_number "1"; cov "502.832245"; +CM143130.1 StringTie transcript 605861 610102 1000 + . gene_id "SS.2541"; transcript_id "SS.2541.1"; cov "340.609243"; FPKM "16.657325"; TPM "35.619136"; +CM143130.1 StringTie exon 605861 608851 1000 + . gene_id "SS.2541"; transcript_id "SS.2541.1"; exon_number "1"; cov "216.070404"; +CM143130.1 StringTie exon 608941 610102 1000 + . gene_id "SS.2541"; transcript_id "SS.2541.1"; exon_number "2"; cov "661.173523"; +CM143130.1 StringTie transcript 608584 610102 1000 + . gene_id "SS.2541"; transcript_id "SS.2541.2"; cov "1199.239506"; FPKM "58.648208"; TPM "125.410204"; +CM143130.1 StringTie exon 608584 608685 1000 + . gene_id "SS.2541"; transcript_id "SS.2541.2"; exon_number "1"; cov "297.804810"; +CM143130.1 StringTie exon 608805 608851 1000 + . gene_id "SS.2541"; transcript_id "SS.2541.2"; exon_number "2"; cov "862.436768"; +CM143130.1 StringTie exon 608941 610102 1000 + . gene_id "SS.2541"; transcript_id "SS.2541.2"; exon_number "3"; cov "1291.989990"; +CM143130.1 StringTie transcript 610363 612236 1000 . . gene_id "SS.2542"; transcript_id "SS.2542.1"; cov "30.078442"; FPKM "1.470971"; TPM "3.145446"; +CM143130.1 StringTie exon 610363 612236 1000 . . gene_id "SS.2542"; transcript_id "SS.2542.1"; exon_number "1"; cov "30.078442"; +CM143130.1 StringTie transcript 612578 618273 1000 + . gene_id "SS.2543"; transcript_id "SS.2543.1"; cov "726.102390"; FPKM "35.509674"; TPM "75.931995"; +CM143130.1 StringTie exon 612578 614663 1000 + . gene_id "SS.2543"; transcript_id "SS.2543.1"; exon_number "1"; cov "476.011993"; +CM143130.1 StringTie exon 614754 618273 1000 + . gene_id "SS.2543"; transcript_id "SS.2543.1"; exon_number "2"; cov "874.309387"; +CM143130.1 StringTie transcript 618553 619125 1000 . . gene_id "SS.2544"; transcript_id "SS.2544.1"; cov "1065.773124"; FPKM "52.121101"; TPM "111.452987"; +CM143130.1 StringTie exon 618553 619125 1000 . . gene_id "SS.2544"; transcript_id "SS.2544.1"; exon_number "1"; cov "1065.773071"; +CM143130.1 StringTie transcript 619505 620797 1000 . . gene_id "SS.2545"; transcript_id "SS.2545.1"; cov "2199.981439"; FPKM "107.588991"; TPM "230.062568"; +CM143130.1 StringTie exon 619505 620797 1000 . . gene_id "SS.2545"; transcript_id "SS.2545.1"; exon_number "1"; cov "2199.981445"; +CM143130.1 StringTie transcript 621045 633680 1000 + . gene_id "SS.2546"; transcript_id "SS.2546.1"; cov "53.378054"; FPKM "2.610427"; TPM "5.581998"; +CM143130.1 StringTie exon 621045 627253 1000 + . gene_id "SS.2546"; transcript_id "SS.2546.1"; exon_number "1"; cov "27.789537"; +CM143130.1 StringTie exon 627485 627507 1000 + . gene_id "SS.2546"; transcript_id "SS.2546.1"; exon_number "2"; cov "33.801704"; +CM143130.1 StringTie exon 627589 633680 1000 + . gene_id "SS.2546"; transcript_id "SS.2546.1"; exon_number "3"; cov "79.531921"; +CM143130.1 StringTie transcript 621095 630474 1000 + . gene_id "SS.2546"; transcript_id "SS.2546.2"; cov "238.504290"; FPKM "11.663933"; TPM "24.941533"; +CM143130.1 StringTie exon 621095 627503 1000 + . gene_id "SS.2546"; transcript_id "SS.2546.2"; exon_number "1"; cov "170.897141"; +CM143130.1 StringTie exon 627589 630474 1000 + . gene_id "SS.2546"; transcript_id "SS.2546.2"; exon_number "2"; cov "388.640900"; +CM143130.1 StringTie transcript 621095 630474 1000 + . gene_id "SS.2546"; transcript_id "SS.2546.3"; cov "162.064329"; FPKM "7.925675"; TPM "16.947841"; +CM143130.1 StringTie exon 621095 627253 1000 + . gene_id "SS.2546"; transcript_id "SS.2546.3"; exon_number "1"; cov "115.535255"; +CM143130.1 StringTie exon 627485 627503 1000 + . gene_id "SS.2546"; transcript_id "SS.2546.3"; exon_number "2"; cov "122.046646"; +CM143130.1 StringTie exon 627589 630474 1000 + . gene_id "SS.2546"; transcript_id "SS.2546.3"; exon_number "3"; cov "261.625275"; +CM143130.1 StringTie transcript 631469 633680 1000 . . gene_id "SS.2547"; transcript_id "SS.2547.1"; cov "563.137997"; FPKM "27.539982"; TPM "58.890030"; +CM143130.1 StringTie exon 631469 633680 1000 . . gene_id "SS.2547"; transcript_id "SS.2547.1"; exon_number "1"; cov "563.138000"; +CM143130.1 StringTie transcript 633881 635433 1000 . . gene_id "SS.2548"; transcript_id "SS.2548.1"; cov "313.443014"; FPKM "15.328774"; TPM "32.778233"; +CM143130.1 StringTie exon 633881 635433 1000 . . gene_id "SS.2548"; transcript_id "SS.2548.1"; exon_number "1"; cov "313.443024"; +CM143130.1 StringTie transcript 636074 639273 1000 . . gene_id "SS.2549"; transcript_id "SS.2549.1"; cov "746.672812"; FPKM "36.515660"; TPM "78.083143"; +CM143130.1 StringTie exon 636074 639273 1000 . . gene_id "SS.2549"; transcript_id "SS.2549.1"; exon_number "1"; cov "746.672791"; +CM143130.1 StringTie transcript 640718 642530 1000 . . gene_id "SS.2550"; transcript_id "SS.2550.1"; cov "5668.147821"; FPKM "277.197932"; TPM "592.745294"; +CM143130.1 StringTie exon 640718 642530 1000 . . gene_id "SS.2550"; transcript_id "SS.2550.1"; exon_number "1"; cov "5668.147949"; +CM143130.1 StringTie transcript 642923 644034 1000 . . gene_id "SS.2551"; transcript_id "SS.2551.1"; cov "407.267986"; FPKM "19.917237"; TPM "42.589959"; +CM143130.1 StringTie exon 642923 644034 1000 . . gene_id "SS.2551"; transcript_id "SS.2551.1"; exon_number "1"; cov "407.267975"; +CM143130.1 StringTie transcript 644358 648582 1000 . . gene_id "SS.2552"; transcript_id "SS.2552.1"; cov "419.104379"; FPKM "20.496090"; TPM "43.827747"; +CM143130.1 StringTie exon 644358 648582 1000 . . gene_id "SS.2552"; transcript_id "SS.2552.1"; exon_number "1"; cov "419.104370"; +CM143130.1 StringTie transcript 648786 653383 1000 - . gene_id "SS.2553"; transcript_id "SS.2553.1"; cov "1100.072064"; FPKM "53.798474"; TPM "115.039791"; +CM143130.1 StringTie exon 648786 652605 1000 - . gene_id "SS.2553"; transcript_id "SS.2553.1"; exon_number "1"; cov "725.847107"; +CM143130.1 StringTie exon 652819 653383 1000 - . gene_id "SS.2553"; transcript_id "SS.2553.1"; exon_number "2"; cov "3630.229980"; +CM143130.1 StringTie transcript 653591 657532 1000 . . gene_id "SS.2554"; transcript_id "SS.2554.1"; cov "286.781583"; FPKM "14.024910"; TPM "29.990120"; +CM143130.1 StringTie exon 653591 657532 1000 . . gene_id "SS.2554"; transcript_id "SS.2554.1"; exon_number "1"; cov "286.781586"; +CM143130.1 StringTie transcript 662673 666189 1000 + . gene_id "SS.2555"; transcript_id "SS.2555.1"; cov "543.934886"; FPKM "26.600863"; TPM "56.881869"; +CM143130.1 StringTie exon 662673 663386 1000 + . gene_id "SS.2555"; transcript_id "SS.2555.1"; exon_number "1"; cov "811.530823"; +CM143130.1 StringTie exon 663456 665003 1000 + . gene_id "SS.2555"; transcript_id "SS.2555.1"; exon_number "2"; cov "527.324951"; +CM143130.1 StringTie exon 665104 666189 1000 + . gene_id "SS.2555"; transcript_id "SS.2555.1"; exon_number "3"; cov "391.677704"; +CM143130.1 StringTie transcript 668201 672020 1000 . . gene_id "SS.2556"; transcript_id "SS.2556.1"; cov "1682.454712"; FPKM "82.279605"; TPM "175.942326"; +CM143130.1 StringTie exon 668201 672020 1000 . . gene_id "SS.2556"; transcript_id "SS.2556.1"; exon_number "1"; cov "1682.454712"; +CM143130.1 StringTie transcript 672252 672491 1000 . . gene_id "SS.2557"; transcript_id "SS.2557.1"; cov "5.000000"; FPKM "0.244522"; TPM "0.522874"; +CM143130.1 StringTie exon 672252 672491 1000 . . gene_id "SS.2557"; transcript_id "SS.2557.1"; exon_number "1"; cov "5.000000"; +CM143130.1 StringTie transcript 703777 704271 1000 . . gene_id "SS.2558"; transcript_id "SS.2558.1"; cov "7.800000"; FPKM "0.381455"; TPM "0.815683"; +CM143130.1 StringTie exon 703777 704271 1000 . . gene_id "SS.2558"; transcript_id "SS.2558.1"; exon_number "1"; cov "7.800000"; +CM143130.1 StringTie transcript 675356 680380 1000 . . gene_id "SS.2559"; transcript_id "SS.2559.1"; cov "612.928358"; FPKM "29.974955"; TPM "64.096846"; +CM143130.1 StringTie exon 675356 680380 1000 . . gene_id "SS.2559"; transcript_id "SS.2559.1"; exon_number "1"; cov "612.928345"; +CM143130.1 StringTie transcript 680622 685089 1000 . . gene_id "SS.2560"; transcript_id "SS.2560.1"; cov "447.449642"; FPKM "21.882301"; TPM "46.791946"; +CM143130.1 StringTie exon 680622 685089 1000 . . gene_id "SS.2560"; transcript_id "SS.2560.1"; exon_number "1"; cov "447.449646"; +CM143130.1 StringTie transcript 685673 689892 1000 . . gene_id "SS.2561"; transcript_id "SS.2561.1"; cov "474.867299"; FPKM "23.223148"; TPM "49.659142"; +CM143130.1 StringTie exon 685673 689892 1000 . . gene_id "SS.2561"; transcript_id "SS.2561.1"; exon_number "1"; cov "474.867310"; +CM143130.1 StringTie transcript 690210 691962 1000 . . gene_id "SS.2562"; transcript_id "SS.2562.1"; cov "228.982886"; FPKM "11.198293"; TPM "23.945834"; +CM143130.1 StringTie exon 690210 691962 1000 . . gene_id "SS.2562"; transcript_id "SS.2562.1"; exon_number "1"; cov "228.982880"; +CM143130.1 StringTie transcript 692282 696947 1000 . . gene_id "SS.2563"; transcript_id "SS.2563.1"; cov "100.107372"; FPKM "4.895701"; TPM "10.468706"; +CM143130.1 StringTie exon 692282 696947 1000 . . gene_id "SS.2563"; transcript_id "SS.2563.1"; exon_number "1"; cov "100.107376"; +CM143130.1 StringTie transcript 697343 699770 1000 . . gene_id "SS.2564"; transcript_id "SS.2564.1"; cov "149.648682"; FPKM "7.318494"; TPM "15.649478"; +CM143130.1 StringTie exon 697343 699770 1000 . . gene_id "SS.2564"; transcript_id "SS.2564.1"; exon_number "1"; cov "149.648682"; +CM143130.1 StringTie transcript 701398 703227 1000 . . gene_id "SS.2565"; transcript_id "SS.2565.1"; cov "1124.565574"; FPKM "54.996316"; TPM "117.601194"; +CM143130.1 StringTie exon 701398 703227 1000 . . gene_id "SS.2565"; transcript_id "SS.2565.1"; exon_number "1"; cov "1124.565552"; +CM143130.1 StringTie transcript 709076 711247 1000 - . gene_id "SS.2566"; transcript_id "SS.2566.1"; cov "3523.015597"; FPKM "172.291314"; TPM "368.418570"; +CM143130.1 StringTie exon 709076 709887 1000 - . gene_id "SS.2566"; transcript_id "SS.2566.1"; exon_number "1"; cov "4167.051758"; +CM143130.1 StringTie exon 710393 711247 1000 - . gene_id "SS.2566"; transcript_id "SS.2566.1"; exon_number "2"; cov "2911.369629"; +CM143130.1 StringTie transcript 720083 725021 1000 . . gene_id "SS.2567"; transcript_id "SS.2567.1"; cov "379.035837"; FPKM "18.536558"; TPM "39.637588"; +CM143130.1 StringTie exon 720083 725021 1000 . . gene_id "SS.2567"; transcript_id "SS.2567.1"; exon_number "1"; cov "379.035828"; +CM143130.1 StringTie transcript 725286 725872 1000 . . gene_id "SS.2568"; transcript_id "SS.2568.1"; cov "231.798978"; FPKM "11.336013"; TPM "24.240326"; +CM143130.1 StringTie exon 725286 725872 1000 . . gene_id "SS.2568"; transcript_id "SS.2568.1"; exon_number "1"; cov "231.798981"; +CM143130.1 StringTie transcript 726566 735122 1000 . . gene_id "SS.2569"; transcript_id "SS.2569.1"; cov "81.329467"; FPKM "3.977377"; TPM "8.505011"; +CM143130.1 StringTie exon 726566 735122 1000 . . gene_id "SS.2569"; transcript_id "SS.2569.1"; exon_number "1"; cov "81.329468"; +CM143130.1 StringTie transcript 726566 735122 1000 + . gene_id "SS.2570"; transcript_id "SS.2570.1"; cov "9.090464"; FPKM "0.444565"; TPM "0.950633"; +CM143130.1 StringTie exon 726566 726755 1000 + . gene_id "SS.2570"; transcript_id "SS.2570.1"; exon_number "1"; cov "1.956457"; +CM143130.1 StringTie exon 726964 735122 1000 + . gene_id "SS.2570"; transcript_id "SS.2570.1"; exon_number "2"; cov "9.256595"; +CM143130.1 StringTie transcript 741292 743516 1000 + . gene_id "SS.2571"; transcript_id "SS.2571.1"; cov "264.001391"; FPKM "12.910856"; TPM "27.607887"; +CM143130.1 StringTie exon 741292 741477 1000 + . gene_id "SS.2571"; transcript_id "SS.2571.1"; exon_number "1"; cov "86.440857"; +CM143130.1 StringTie exon 741547 743516 1000 + . gene_id "SS.2571"; transcript_id "SS.2571.1"; exon_number "2"; cov "280.765991"; +CM143130.1 StringTie transcript 783948 784629 1000 . . gene_id "SS.2572"; transcript_id "SS.2572.1"; cov "5.791789"; FPKM "0.283245"; TPM "0.605675"; +CM143130.1 StringTie exon 783948 784629 1000 . . gene_id "SS.2572"; transcript_id "SS.2572.1"; exon_number "1"; cov "5.791789"; +CM143130.1 StringTie transcript 743774 746130 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.1"; cov "8.294295"; FPKM "0.405628"; TPM "0.867374"; +CM143130.1 StringTie exon 743774 745011 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.1"; exon_number "1"; cov "3.768089"; +CM143130.1 StringTie exon 745090 745463 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.1"; exon_number "2"; cov "2.619524"; +CM143130.1 StringTie exon 745541 745594 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.1"; exon_number "3"; cov "30.878670"; +CM143130.1 StringTie exon 745701 745791 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.1"; exon_number "4"; cov "39.353218"; +CM143130.1 StringTie exon 745848 745938 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.1"; exon_number "5"; cov "43.436378"; +CM143130.1 StringTie exon 746010 746130 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.1"; exon_number "6"; cov "12.277430"; +CM143130.1 StringTie transcript 743774 749978 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.2"; cov "26.486423"; FPKM "1.295305"; TPM "2.769812"; +CM143130.1 StringTie exon 743774 745011 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.2"; exon_number "1"; cov "9.401813"; +CM143130.1 StringTie exon 745090 745791 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.2"; exon_number "2"; cov "45.379414"; +CM143130.1 StringTie exon 745848 749978 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.2"; exon_number "3"; cov "28.395857"; +CM143130.1 StringTie transcript 743774 749978 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.3"; cov "19.942153"; FPKM "0.975261"; TPM "2.085446"; +CM143130.1 StringTie exon 743774 745011 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.3"; exon_number "1"; cov "7.779657"; +CM143130.1 StringTie exon 745090 745594 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.3"; exon_number "2"; cov "16.706987"; +CM143130.1 StringTie exon 745701 745791 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.3"; exon_number "3"; cov "81.249283"; +CM143130.1 StringTie exon 745848 745938 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.3"; exon_number "4"; cov "89.679443"; +CM143130.1 StringTie exon 746010 749978 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.3"; exon_number "5"; cov "21.142929"; +CM143130.1 StringTie transcript 743774 755044 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.4"; cov "34.407519"; FPKM "1.682682"; TPM "3.598159"; +CM143130.1 StringTie exon 743774 745011 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.4"; exon_number "1"; cov "14.077744"; +CM143130.1 StringTie exon 745090 745594 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.4"; exon_number "2"; cov "30.232265"; +CM143130.1 StringTie exon 745701 745791 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.4"; exon_number "3"; cov "147.025314"; +CM143130.1 StringTie exon 745848 755044 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.4"; exon_number "4"; cov "36.259052"; +CM143130.1 StringTie transcript 744245 746130 1000 . . gene_id "SS.2574"; transcript_id "SS.2574.1"; cov "159.834819"; FPKM "7.816642"; TPM "16.714691"; +CM143130.1 StringTie exon 744245 746130 1000 . . gene_id "SS.2574"; transcript_id "SS.2574.1"; exon_number "1"; cov "159.834824"; +CM143130.1 StringTie transcript 744245 746130 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.5"; cov "26.125793"; FPKM "1.277669"; TPM "2.732099"; +CM143130.1 StringTie exon 744245 745011 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.5"; exon_number "1"; cov "8.435301"; +CM143130.1 StringTie exon 745090 746130 1000 + . gene_id "SS.2573"; transcript_id "SS.2573.5"; exon_number "2"; cov "39.160000"; +CM143130.1 StringTie transcript 746376 749978 1000 . . gene_id "SS.2575"; transcript_id "SS.2575.1"; cov "730.744727"; FPKM "35.736705"; TPM "76.417467"; +CM143130.1 StringTie exon 746376 749978 1000 . . gene_id "SS.2575"; transcript_id "SS.2575.1"; exon_number "1"; cov "730.744751"; +CM143130.1 StringTie transcript 750343 755044 1000 . . gene_id "SS.2576"; transcript_id "SS.2576.1"; cov "1042.257337"; FPKM "50.971073"; TPM "108.993828"; +CM143130.1 StringTie exon 750343 755044 1000 . . gene_id "SS.2576"; transcript_id "SS.2576.1"; exon_number "1"; cov "1042.257324"; +CM143130.1 StringTie transcript 758017 759142 1000 + . gene_id "SS.2577"; transcript_id "SS.2577.1"; cov "16456.111732"; FPKM "804.777906"; TPM "1720.894212"; +CM143130.1 StringTie exon 758017 758110 1000 + . gene_id "SS.2577"; transcript_id "SS.2577.1"; exon_number "1"; cov "2024.946777"; +CM143130.1 StringTie exon 758700 759142 1000 + . gene_id "SS.2577"; transcript_id "SS.2577.1"; exon_number "2"; cov "19518.255859"; +CM143130.1 StringTie transcript 779716 781197 1000 . . gene_id "SS.2578"; transcript_id "SS.2578.1"; cov "3290.776653"; FPKM "160.933785"; TPM "344.132234"; +CM143130.1 StringTie exon 779716 781197 1000 . . gene_id "SS.2578"; transcript_id "SS.2578.1"; exon_number "1"; cov "3290.776611"; +CM143130.1 StringTie transcript 789224 792353 1000 . . gene_id "SS.2579"; transcript_id "SS.2579.1"; cov "6835.021086"; FPKM "334.263285"; TPM "714.770805"; +CM143130.1 StringTie exon 789224 792353 1000 . . gene_id "SS.2579"; transcript_id "SS.2579.1"; exon_number "1"; cov "6835.020996"; +CM143130.1 StringTie transcript 792972 794169 1000 + . gene_id "SS.2580"; transcript_id "SS.2580.1"; cov "3359.540616"; FPKM "164.296652"; TPM "351.323210"; +CM143130.1 StringTie exon 792972 793418 1000 + . gene_id "SS.2580"; transcript_id "SS.2580.1"; exon_number "1"; cov "632.975403"; +CM143130.1 StringTie exon 793546 794169 1000 + . gene_id "SS.2580"; transcript_id "SS.2580.1"; exon_number "2"; cov "5312.705078"; +CM143130.1 StringTie transcript 794762 795224 1000 . . gene_id "SS.2581"; transcript_id "SS.2581.1"; cov "9534.315335"; FPKM "466.270919"; TPM "997.048899"; +CM143130.1 StringTie exon 794762 795224 1000 . . gene_id "SS.2581"; transcript_id "SS.2581.1"; exon_number "1"; cov "9534.315430"; +CM143130.1 StringTie transcript 797551 800022 1000 . . gene_id "SS.2582"; transcript_id "SS.2582.1"; cov "6034.527104"; FPKM "295.115527"; TPM "631.059325"; +CM143130.1 StringTie exon 797551 800022 1000 . . gene_id "SS.2582"; transcript_id "SS.2582.1"; exon_number "1"; cov "6034.527344"; +CM143130.1 StringTie transcript 802341 806422 1000 . . gene_id "SS.2583"; transcript_id "SS.2583.1"; cov "216.628858"; FPKM "10.594126"; TPM "22.653914"; +CM143130.1 StringTie exon 802341 806422 1000 . . gene_id "SS.2583"; transcript_id "SS.2583.1"; exon_number "1"; cov "216.628860"; +CM143130.1 StringTie transcript 806691 808342 1000 . . gene_id "SS.2584"; transcript_id "SS.2584.1"; cov "1564.067191"; FPKM "76.489923"; TPM "163.561977"; +CM143130.1 StringTie exon 806691 808342 1000 . . gene_id "SS.2584"; transcript_id "SS.2584.1"; exon_number "1"; cov "1564.067139"; +CM143130.1 StringTie transcript 808644 811378 1000 + . gene_id "SS.2585"; transcript_id "SS.2585.1"; cov "895.704675"; FPKM "43.803989"; TPM "93.668117"; +CM143130.1 StringTie exon 808644 808781 1000 + . gene_id "SS.2585"; transcript_id "SS.2585.1"; exon_number "1"; cov "498.557983"; +CM143130.1 StringTie exon 808886 811378 1000 + . gene_id "SS.2585"; transcript_id "SS.2585.1"; exon_number "2"; cov "917.688721"; +CM143130.1 StringTie transcript 824365 828810 1000 - . gene_id "SS.2586"; transcript_id "SS.2586.1"; cov "1410.810780"; FPKM "68.994995"; TPM "147.535223"; +CM143130.1 StringTie exon 824365 828489 1000 - . gene_id "SS.2586"; transcript_id "SS.2586.1"; exon_number "1"; cov "1439.995117"; +CM143130.1 StringTie exon 828576 828810 1000 - . gene_id "SS.2586"; transcript_id "SS.2586.1"; exon_number "2"; cov "898.531921"; +CM143130.1 StringTie transcript 829202 830562 1000 . . gene_id "SS.2587"; transcript_id "SS.2587.1"; cov "2071.085231"; FPKM "101.285386"; TPM "216.583276"; +CM143130.1 StringTie exon 829202 830562 1000 . . gene_id "SS.2587"; transcript_id "SS.2587.1"; exon_number "1"; cov "2071.085205"; +CM143130.1 StringTie transcript 831458 832684 1000 . . gene_id "SS.2588"; transcript_id "SS.2588.1"; cov "88408.651997"; FPKM "4323.580868"; TPM "9245.315055"; +CM143130.1 StringTie exon 831458 832684 1000 . . gene_id "SS.2588"; transcript_id "SS.2588.1"; exon_number "1"; cov "88408.648438"; +CM143130.1 StringTie transcript 835803 838896 1000 . . gene_id "SS.2589"; transcript_id "SS.2589.1"; cov "160.026180"; FPKM "7.826000"; TPM "16.734702"; +CM143130.1 StringTie exon 835803 838896 1000 . . gene_id "SS.2589"; transcript_id "SS.2589.1"; exon_number "1"; cov "160.026184"; +CM143130.1 StringTie transcript 842442 850430 1000 . . gene_id "SS.2590"; transcript_id "SS.2590.1"; cov "418.650958"; FPKM "20.473916"; TPM "43.780331"; +CM143130.1 StringTie exon 842442 850430 1000 . . gene_id "SS.2590"; transcript_id "SS.2590.1"; exon_number "1"; cov "418.650970"; +CM143130.1 StringTie transcript 842442 850430 1000 + . gene_id "SS.2591"; transcript_id "SS.2591.1"; cov "47.027086"; FPKM "2.299836"; TPM "4.917847"; +CM143130.1 StringTie exon 842442 850096 1000 + . gene_id "SS.2591"; transcript_id "SS.2591.1"; exon_number "1"; cov "48.466980"; +CM143130.1 StringTie exon 850169 850430 1000 + . gene_id "SS.2591"; transcript_id "SS.2591.1"; exon_number "2"; cov "4.956956"; +CM143130.1 StringTie transcript 859423 863400 1000 . . gene_id "SS.2592"; transcript_id "SS.2592.1"; cov "439.352438"; FPKM "21.486311"; TPM "45.945183"; +CM143130.1 StringTie exon 859423 863400 1000 . . gene_id "SS.2592"; transcript_id "SS.2592.1"; exon_number "1"; cov "439.352448"; +CM143130.1 StringTie transcript 850885 852708 1000 . . gene_id "SS.2593"; transcript_id "SS.2593.1"; cov "34.759320"; FPKM "1.699887"; TPM "3.634948"; +CM143130.1 StringTie exon 850885 852708 1000 . . gene_id "SS.2593"; transcript_id "SS.2593.1"; exon_number "1"; cov "34.759319"; +CM143130.1 StringTie transcript 853753 856266 1000 . . gene_id "SS.2594"; transcript_id "SS.2594.1"; cov "15643.319014"; FPKM "765.028685"; TPM "1635.896595"; +CM143130.1 StringTie exon 853753 856266 1000 . . gene_id "SS.2594"; transcript_id "SS.2594.1"; exon_number "1"; cov "15643.319336"; +CM143130.1 StringTie transcript 857156 858417 1000 - . gene_id "SS.2595"; transcript_id "SS.2595.1"; cov "2604.126927"; FPKM "127.353524"; TPM "272.325992"; +CM143130.1 StringTie exon 857156 858030 1000 - . gene_id "SS.2595"; transcript_id "SS.2595.1"; exon_number "1"; cov "2806.445801"; +CM143130.1 StringTie exon 858113 858160 1000 - . gene_id "SS.2595"; transcript_id "SS.2595.1"; exon_number "2"; cov "2771.916748"; +CM143130.1 StringTie exon 858238 858417 1000 - . gene_id "SS.2595"; transcript_id "SS.2595.1"; exon_number "3"; cov "1575.888916"; +CM143130.1 StringTie transcript 863676 866549 1000 + . gene_id "SS.2596"; transcript_id "SS.2596.1"; cov "854.229526"; FPKM "41.775667"; TPM "89.330862"; +CM143130.1 StringTie exon 863676 864827 1000 + . gene_id "SS.2596"; transcript_id "SS.2596.1"; exon_number "1"; cov "1105.314209"; +CM143130.1 StringTie exon 864918 866549 1000 + . gene_id "SS.2596"; transcript_id "SS.2596.1"; exon_number "2"; cov "676.993286"; +CM143130.1 StringTie transcript 870774 872336 1000 . . gene_id "SS.2597"; transcript_id "SS.2597.1"; cov "12.056942"; FPKM "0.589639"; TPM "1.260852"; +CM143130.1 StringTie exon 870774 872336 1000 . . gene_id "SS.2597"; transcript_id "SS.2597.1"; exon_number "1"; cov "12.056942"; +CM143130.1 StringTie transcript 867195 868042 1000 + . gene_id "SS.2598"; transcript_id "SS.2598.1"; cov "29804.645833"; FPKM "1457.581284"; TPM "3116.814187"; +CM143130.1 StringTie exon 867195 867247 1000 + . gene_id "SS.2598"; transcript_id "SS.2598.1"; exon_number "1"; cov "1220.151001"; +CM143130.1 StringTie exon 867664 868042 1000 + . gene_id "SS.2598"; transcript_id "SS.2598.1"; exon_number "2"; cov "33801.949219"; +CM143130.1 StringTie transcript 872804 875967 1000 . . gene_id "SS.2599"; transcript_id "SS.2599.1"; cov "634.917509"; FPKM "31.050323"; TPM "66.396357"; +CM143130.1 StringTie exon 872804 875967 1000 . . gene_id "SS.2599"; transcript_id "SS.2599.1"; exon_number "1"; cov "634.917480"; +CM143130.1 StringTie transcript 877177 881723 1000 . . gene_id "SS.2600"; transcript_id "SS.2600.1"; cov "982.511106"; FPKM "48.049214"; TPM "102.745880"; +CM143130.1 StringTie exon 877177 881723 1000 . . gene_id "SS.2600"; transcript_id "SS.2600.1"; exon_number "1"; cov "982.511108"; +CM143130.1 StringTie transcript 890583 891810 1000 - . gene_id "SS.2601"; transcript_id "SS.2601.1"; cov "16567.545235"; FPKM "810.227506"; TPM "1732.547346"; +CM143130.1 StringTie exon 890583 891276 1000 - . gene_id "SS.2601"; transcript_id "SS.2601.1"; exon_number "1"; cov "19631.875000"; +CM143130.1 StringTie exon 891676 891810 1000 - . gene_id "SS.2601"; transcript_id "SS.2601.1"; exon_number "2"; cov "814.622192"; +CM143130.1 StringTie transcript 895628 896435 1000 . . gene_id "SS.2602"; transcript_id "SS.2602.1"; cov "8640.514851"; FPKM "422.560053"; TPM "903.579912"; +CM143130.1 StringTie exon 895628 896435 1000 . . gene_id "SS.2602"; transcript_id "SS.2602.1"; exon_number "1"; cov "8640.514648"; +CM143130.1 StringTie transcript 896868 901389 1000 . . gene_id "SS.2603"; transcript_id "SS.2603.1"; cov "570.211632"; FPKM "27.885914"; TPM "59.629754"; +CM143130.1 StringTie exon 896868 901389 1000 . . gene_id "SS.2603"; transcript_id "SS.2603.1"; exon_number "1"; cov "570.211609"; +CM143130.1 StringTie transcript 901691 905776 1000 . . gene_id "SS.2604"; transcript_id "SS.2604.1"; cov "949.149780"; FPKM "46.417695"; TPM "99.257126"; +CM143130.1 StringTie exon 901691 905776 1000 . . gene_id "SS.2604"; transcript_id "SS.2604.1"; exon_number "1"; cov "949.149780"; +CM143130.1 StringTie transcript 910439 912203 1000 + . gene_id "SS.2605"; transcript_id "SS.2605.1"; cov "384.825126"; FPKM "18.819680"; TPM "40.243002"; +CM143130.1 StringTie exon 910439 911279 1000 + . gene_id "SS.2605"; transcript_id "SS.2605.1"; exon_number "1"; cov "86.059029"; +CM143130.1 StringTie exon 911357 911388 1000 + . gene_id "SS.2605"; transcript_id "SS.2605.1"; exon_number "2"; cov "156.038406"; +CM143130.1 StringTie exon 911528 912203 1000 + . gene_id "SS.2605"; transcript_id "SS.2605.1"; exon_number "3"; cov "767.345032"; +CM143130.1 StringTie transcript 910439 912030 1000 + . gene_id "SS.2605"; transcript_id "SS.2605.2"; cov "126.546845"; FPKM "6.188710"; TPM "13.233608"; +CM143130.1 StringTie exon 910439 911279 1000 + . gene_id "SS.2605"; transcript_id "SS.2605.2"; exon_number "1"; cov "36.970516"; +CM143130.1 StringTie exon 911357 912030 1000 + . gene_id "SS.2605"; transcript_id "SS.2605.2"; exon_number "2"; cov "238.317902"; +CM143130.1 StringTie transcript 910439 912203 1000 + . gene_id "SS.2605"; transcript_id "SS.2605.3"; cov "41.703787"; FPKM "2.039503"; TPM "4.361164"; +CM143130.1 StringTie exon 910439 911106 1000 + . gene_id "SS.2605"; transcript_id "SS.2605.3"; exon_number "1"; cov "6.501722"; +CM143130.1 StringTie exon 911357 911388 1000 + . gene_id "SS.2605"; transcript_id "SS.2605.3"; exon_number "2"; cov "15.803288"; +CM143130.1 StringTie exon 911528 912203 1000 + . gene_id "SS.2605"; transcript_id "SS.2605.3"; exon_number "3"; cov "77.715317"; +CM143130.1 StringTie transcript 912392 913238 1000 - . gene_id "SS.2606"; transcript_id "SS.2606.1"; cov "3926.156077"; FPKM "192.006698"; TPM "410.576896"; +CM143130.1 StringTie exon 912392 913065 1000 - . gene_id "SS.2606"; transcript_id "SS.2606.1"; exon_number "1"; cov "4196.154297"; +CM143130.1 StringTie exon 913189 913238 1000 - . gene_id "SS.2606"; transcript_id "SS.2606.1"; exon_number "2"; cov "286.579987"; +CM143130.1 StringTie transcript 918721 920129 1000 . . gene_id "SS.2607"; transcript_id "SS.2607.1"; cov "232.090135"; FPKM "11.350252"; TPM "24.270774"; +CM143130.1 StringTie exon 918721 920129 1000 . . gene_id "SS.2607"; transcript_id "SS.2607.1"; exon_number "1"; cov "232.090134"; +CM143130.1 StringTie transcript 920574 922108 1000 . . gene_id "SS.2608"; transcript_id "SS.2608.1"; cov "6022.796091"; FPKM "294.541828"; TPM "629.832557"; +CM143130.1 StringTie exon 920574 922108 1000 . . gene_id "SS.2608"; transcript_id "SS.2608.1"; exon_number "1"; cov "6022.795898"; +CM143130.1 StringTie transcript 924374 924949 1000 . . gene_id "SS.2609"; transcript_id "SS.2609.1"; cov "12925.314236"; FPKM "632.106022"; TPM "1351.661852"; +CM143130.1 StringTie exon 924374 924949 1000 . . gene_id "SS.2609"; transcript_id "SS.2609.1"; exon_number "1"; cov "12925.314453"; +CM143130.1 StringTie transcript 925320 927389 1000 . . gene_id "SS.2610"; transcript_id "SS.2610.1"; cov "346.291787"; FPKM "16.935226"; TPM "36.213386"; +CM143130.1 StringTie exon 925320 927389 1000 . . gene_id "SS.2610"; transcript_id "SS.2610.1"; exon_number "1"; cov "346.291779"; +CM143130.1 StringTie transcript 927757 928337 1000 . . gene_id "SS.2611"; transcript_id "SS.2611.1"; cov "14.180723"; FPKM "0.693501"; TPM "1.482946"; +CM143130.1 StringTie exon 927757 928337 1000 . . gene_id "SS.2611"; transcript_id "SS.2611.1"; exon_number "1"; cov "14.180723"; +CM143130.1 StringTie transcript 928939 933136 1000 . . gene_id "SS.2612"; transcript_id "SS.2612.1"; cov "750.481658"; FPKM "36.701930"; TPM "78.481452"; +CM143130.1 StringTie exon 928939 933136 1000 . . gene_id "SS.2612"; transcript_id "SS.2612.1"; exon_number "1"; cov "750.481628"; +CM143130.1 StringTie transcript 933379 936721 1000 - . gene_id "SS.2613"; transcript_id "SS.2613.1"; cov "227.522038"; FPKM "11.126851"; TPM "23.793066"; +CM143130.1 StringTie exon 933379 934164 1000 - . gene_id "SS.2613"; transcript_id "SS.2613.1"; exon_number "1"; cov "371.573792"; +CM143130.1 StringTie exon 934248 936721 1000 - . gene_id "SS.2613"; transcript_id "SS.2613.1"; exon_number "2"; cov "181.756195"; +CM143130.1 StringTie transcript 934949 936721 1000 . . gene_id "SS.2614"; transcript_id "SS.2614.1"; cov "1108.766004"; FPKM "54.223646"; TPM "115.948957"; +CM143130.1 StringTie exon 934949 936721 1000 . . gene_id "SS.2614"; transcript_id "SS.2614.1"; exon_number "1"; cov "1108.765991"; +CM143130.1 StringTie transcript 936942 946190 1000 . . gene_id "SS.2615"; transcript_id "SS.2615.1"; cov "128.094821"; FPKM "6.264413"; TPM "13.395487"; +CM143130.1 StringTie exon 936942 946190 1000 . . gene_id "SS.2615"; transcript_id "SS.2615.1"; exon_number "1"; cov "128.094818"; +CM143130.1 StringTie transcript 958316 961904 1000 + . gene_id "SS.2616"; transcript_id "SS.2616.1"; cov "852.778539"; FPKM "41.704708"; TPM "89.179125"; +CM143130.1 StringTie exon 958316 958397 1000 + . gene_id "SS.2616"; transcript_id "SS.2616.1"; exon_number "1"; cov "203.487808"; +CM143130.1 StringTie exon 958483 961904 1000 + . gene_id "SS.2616"; transcript_id "SS.2616.1"; exon_number "2"; cov "868.337219"; +CM143130.1 StringTie transcript 965450 968141 1000 . . gene_id "SS.2617"; transcript_id "SS.2617.1"; cov "1431.172734"; FPKM "69.990786"; TPM "149.664569"; +CM143130.1 StringTie exon 965450 968141 1000 . . gene_id "SS.2617"; transcript_id "SS.2617.1"; exon_number "1"; cov "1431.172729"; +CM143130.1 StringTie transcript 969222 972584 1000 . . gene_id "SS.2618"; transcript_id "SS.2618.1"; cov "1993.986619"; FPKM "97.514917"; TPM "208.520706"; +CM143130.1 StringTie exon 969222 972584 1000 . . gene_id "SS.2618"; transcript_id "SS.2618.1"; exon_number "1"; cov "1993.986572"; +CM143130.1 StringTie transcript 973473 981865 1000 . . gene_id "SS.2619"; transcript_id "SS.2619.1"; cov "338.008340"; FPKM "16.530129"; TPM "35.347147"; +CM143130.1 StringTie exon 973473 981865 1000 . . gene_id "SS.2619"; transcript_id "SS.2619.1"; exon_number "1"; cov "338.008331"; +CM143130.1 StringTie transcript 982216 984837 1000 . . gene_id "SS.2620"; transcript_id "SS.2620.1"; cov "727.193745"; FPKM "35.563046"; TPM "76.046124"; +CM143130.1 StringTie exon 982216 984837 1000 . . gene_id "SS.2620"; transcript_id "SS.2620.1"; exon_number "1"; cov "727.193726"; +CM143130.1 StringTie transcript 985343 987921 1000 . . gene_id "SS.2621"; transcript_id "SS.2621.1"; cov "366.121753"; FPKM "17.905001"; TPM "38.287101"; +CM143130.1 StringTie exon 985343 987921 1000 . . gene_id "SS.2621"; transcript_id "SS.2621.1"; exon_number "1"; cov "366.121765"; +CM143130.1 StringTie transcript 990030 991940 1000 . . gene_id "SS.2622"; transcript_id "SS.2622.1"; cov "1101.647828"; FPKM "53.875536"; TPM "115.204576"; +CM143130.1 StringTie exon 990030 991940 1000 . . gene_id "SS.2622"; transcript_id "SS.2622.1"; exon_number "1"; cov "1101.647827"; +CM143130.1 StringTie transcript 992217 995402 1000 . . gene_id "SS.2623"; transcript_id "SS.2623.1"; cov "124.537351"; FPKM "6.090437"; TPM "13.023466"; +CM143130.1 StringTie exon 992217 995402 1000 . . gene_id "SS.2623"; transcript_id "SS.2623.1"; exon_number "1"; cov "124.537354"; +CM143130.1 StringTie transcript 995464 997112 1000 . . gene_id "SS.2624"; transcript_id "SS.2624.1"; cov "9.664645"; FPKM "0.472645"; TPM "1.010678"; +CM143130.1 StringTie exon 995464 997112 1000 . . gene_id "SS.2624"; transcript_id "SS.2624.1"; exon_number "1"; cov "9.664645"; +CM143130.1 StringTie transcript 997368 998751 1000 . . gene_id "SS.2625"; transcript_id "SS.2625.1"; cov "2022.255780"; FPKM "98.897407"; TPM "211.476947"; +CM143130.1 StringTie exon 997368 998751 1000 . . gene_id "SS.2625"; transcript_id "SS.2625.1"; exon_number "1"; cov "2022.255737"; +CM143130.1 StringTie transcript 999418 1002082 1000 . . gene_id "SS.2626"; transcript_id "SS.2626.1"; cov "1584.660038"; FPKM "77.497006"; TPM "165.715470"; +CM143130.1 StringTie exon 999418 1002082 1000 . . gene_id "SS.2626"; transcript_id "SS.2626.1"; exon_number "1"; cov "1584.660034"; +CM143130.1 StringTie transcript 1002331 1003997 1000 + . gene_id "SS.2627"; transcript_id "SS.2627.1"; cov "854.394375"; FPKM "41.783729"; TPM "89.348101"; +CM143130.1 StringTie exon 1002331 1002480 1000 + . gene_id "SS.2627"; transcript_id "SS.2627.1"; exon_number "1"; cov "168.613327"; +CM143130.1 StringTie exon 1002548 1003997 1000 + . gene_id "SS.2627"; transcript_id "SS.2627.1"; exon_number "2"; cov "925.337219"; +CM143130.1 StringTie transcript 1004322 1012399 1000 . . gene_id "SS.2628"; transcript_id "SS.2628.1"; cov "138.454351"; FPKM "6.771041"; TPM "14.478833"; +CM143130.1 StringTie exon 1004322 1012399 1000 . . gene_id "SS.2628"; transcript_id "SS.2628.1"; exon_number "1"; cov "138.454346"; +CM143130.1 StringTie transcript 1015534 1019800 1000 - . gene_id "SS.2629"; transcript_id "SS.2629.1"; cov "601.762868"; FPKM "29.428912"; TPM "62.929218"; +CM143130.1 StringTie exon 1015534 1018181 1000 - . gene_id "SS.2629"; transcript_id "SS.2629.1"; exon_number "1"; cov "444.834961"; +CM143130.1 StringTie exon 1018272 1019800 1000 - . gene_id "SS.2629"; transcript_id "SS.2629.1"; exon_number "2"; cov "873.538574"; +CM143130.1 StringTie transcript 1018768 1019800 1000 . . gene_id "SS.2630"; transcript_id "SS.2630.1"; cov "2086.091481"; FPKM "102.019260"; TPM "218.152551"; +CM143130.1 StringTie exon 1018768 1019800 1000 . . gene_id "SS.2630"; transcript_id "SS.2630.1"; exon_number "1"; cov "2086.091553"; +CM143130.1 StringTie transcript 1020112 1022558 1000 - . gene_id "SS.2631"; transcript_id "SS.2631.1"; cov "887.886697"; FPKM "43.421654"; TPM "92.850553"; +CM143130.1 StringTie exon 1020112 1022028 1000 - . gene_id "SS.2631"; transcript_id "SS.2631.1"; exon_number "1"; cov "884.538879"; +CM143130.1 StringTie exon 1022093 1022558 1000 - . gene_id "SS.2631"; transcript_id "SS.2631.1"; exon_number "2"; cov "901.658813"; +CM143130.1 StringTie transcript 1023405 1027209 1000 . . gene_id "SS.2632"; transcript_id "SS.2632.1"; cov "2788.930355"; FPKM "136.391243"; TPM "291.651770"; +CM143130.1 StringTie exon 1023405 1027209 1000 . . gene_id "SS.2632"; transcript_id "SS.2632.1"; exon_number "1"; cov "2788.930420"; +CM143130.1 StringTie transcript 1027411 1028980 1000 . . gene_id "SS.2633"; transcript_id "SS.2633.1"; cov "706.680892"; FPKM "34.559875"; TPM "73.900997"; +CM143130.1 StringTie exon 1027411 1028980 1000 . . gene_id "SS.2633"; transcript_id "SS.2633.1"; exon_number "1"; cov "706.680908"; +CM143130.1 StringTie transcript 1032138 1033563 1000 - . gene_id "SS.2634"; transcript_id "SS.2634.1"; cov "9519.796398"; FPKM "465.560877"; TPM "995.530584"; +CM143130.1 StringTie exon 1032138 1033375 1000 - . gene_id "SS.2634"; transcript_id "SS.2634.1"; exon_number "1"; cov "9804.309570"; +CM143130.1 StringTie exon 1033525 1033563 1000 - . gene_id "SS.2634"; transcript_id "SS.2634.1"; exon_number "2"; cov "488.333344"; +CM143130.1 StringTie transcript 1033951 1036296 1000 + . gene_id "SS.2635"; transcript_id "SS.2635.1"; cov "870.568292"; FPKM "42.574707"; TPM "91.039485"; +CM143130.1 StringTie exon 1033951 1034098 1000 + . gene_id "SS.2635"; transcript_id "SS.2635.1"; exon_number "1"; cov "104.006760"; +CM143130.1 StringTie exon 1034168 1036296 1000 + . gene_id "SS.2635"; transcript_id "SS.2635.1"; exon_number "2"; cov "923.856750"; +CM143130.1 StringTie transcript 1071179 1073112 1000 . . gene_id "SS.2636"; transcript_id "SS.2636.1"; cov "42.119959"; FPKM "2.059856"; TPM "4.404685"; +CM143130.1 StringTie exon 1071179 1073112 1000 . . gene_id "SS.2636"; transcript_id "SS.2636.1"; exon_number "1"; cov "42.119957"; +CM143130.1 StringTie transcript 1051896 1055816 1000 . . gene_id "SS.2637"; transcript_id "SS.2637.1"; cov "292.155318"; FPKM "14.287710"; TPM "30.552077"; +CM143130.1 StringTie exon 1051896 1055816 1000 . . gene_id "SS.2637"; transcript_id "SS.2637.1"; exon_number "1"; cov "292.155304"; +CM143130.1 StringTie transcript 1056685 1061704 1000 . . gene_id "SS.2638"; transcript_id "SS.2638.1"; cov "6350.431873"; FPKM "310.564692"; TPM "664.094996"; +CM143130.1 StringTie exon 1056685 1061704 1000 . . gene_id "SS.2638"; transcript_id "SS.2638.1"; exon_number "1"; cov "6350.431641"; +CM143130.1 StringTie transcript 1062245 1063648 1000 . . gene_id "SS.2639"; transcript_id "SS.2639.1"; cov "1505.338319"; FPKM "73.617817"; TPM "157.420419"; +CM143130.1 StringTie exon 1062245 1063648 1000 . . gene_id "SS.2639"; transcript_id "SS.2639.1"; exon_number "1"; cov "1505.338379"; +CM143130.1 StringTie transcript 1063937 1066459 1000 . . gene_id "SS.2640"; transcript_id "SS.2640.1"; cov "1243.420531"; FPKM "60.808859"; TPM "130.030425"; +CM143130.1 StringTie exon 1063937 1066459 1000 . . gene_id "SS.2640"; transcript_id "SS.2640.1"; exon_number "1"; cov "1243.420532"; +CM143130.1 StringTie transcript 1067520 1070576 1000 . . gene_id "SS.2641"; transcript_id "SS.2641.1"; cov "11280.885836"; FPKM "551.686075"; TPM "1179.696119"; +CM143130.1 StringTie exon 1067520 1070576 1000 . . gene_id "SS.2641"; transcript_id "SS.2641.1"; exon_number "1"; cov "11280.885742"; +CM143130.1 StringTie transcript 1074426 1075032 1000 . . gene_id "SS.2642"; transcript_id "SS.2642.1"; cov "189.166392"; FPKM "9.251088"; TPM "19.782033"; +CM143130.1 StringTie exon 1074426 1075032 1000 . . gene_id "SS.2642"; transcript_id "SS.2642.1"; exon_number "1"; cov "189.166397"; +CM143130.1 StringTie transcript 1076329 1080605 1000 . . gene_id "SS.2643"; transcript_id "SS.2643.1"; cov "2025.226794"; FPKM "99.042703"; TPM "211.787640"; +CM143130.1 StringTie exon 1076329 1080605 1000 . . gene_id "SS.2643"; transcript_id "SS.2643.1"; exon_number "1"; cov "2025.226807"; +CM143130.1 StringTie transcript 1080944 1081396 1000 . . gene_id "SS.2644"; transcript_id "SS.2644.1"; cov "10542.090508"; FPKM "515.555659"; TPM "1102.436762"; +CM143130.1 StringTie exon 1080944 1081396 1000 . . gene_id "SS.2644"; transcript_id "SS.2644.1"; exon_number "1"; cov "10542.090820"; +CM143130.1 StringTie transcript 1085112 1087232 1000 . . gene_id "SS.2645"; transcript_id "SS.2645.1"; cov "12230.342291"; FPKM "598.118767"; TPM "1278.985316"; +CM143130.1 StringTie exon 1085112 1087232 1000 . . gene_id "SS.2645"; transcript_id "SS.2645.1"; exon_number "1"; cov "12230.342773"; +CM143130.1 StringTie transcript 1087477 1089766 1000 . . gene_id "SS.2646"; transcript_id "SS.2646.1"; cov "267.272052"; FPKM "13.070806"; TPM "27.949915"; +CM143130.1 StringTie exon 1087477 1089766 1000 . . gene_id "SS.2646"; transcript_id "SS.2646.1"; exon_number "1"; cov "267.272064"; +CM143130.1 StringTie transcript 1092923 1094431 1000 - . gene_id "SS.2647"; transcript_id "SS.2647.1"; cov "4110.368364"; FPKM "201.015507"; TPM "429.840854"; +CM143130.1 StringTie exon 1092923 1093738 1000 - . gene_id "SS.2647"; transcript_id "SS.2647.1"; exon_number "1"; cov "4336.689941"; +CM143130.1 StringTie exon 1094325 1094431 1000 - . gene_id "SS.2647"; transcript_id "SS.2647.1"; exon_number "2"; cov "2384.401855"; +CM143130.1 StringTie transcript 1094875 1095831 1000 + . gene_id "SS.2648"; transcript_id "SS.2648.1"; cov "706.144064"; FPKM "34.533622"; TPM "73.844858"; +CM143130.1 StringTie exon 1094875 1094991 1000 + . gene_id "SS.2648"; transcript_id "SS.2648.1"; exon_number "1"; cov "413.147217"; +CM143130.1 StringTie exon 1095062 1095831 1000 + . gene_id "SS.2648"; transcript_id "SS.2648.1"; exon_number "2"; cov "750.664368"; +CM143130.1 StringTie transcript 1094882 1095831 1000 . . gene_id "SS.2649"; transcript_id "SS.2649.1"; cov "867.437105"; FPKM "42.421577"; TPM "90.712042"; +CM143130.1 StringTie exon 1094882 1095831 1000 . . gene_id "SS.2649"; transcript_id "SS.2649.1"; exon_number "1"; cov "867.437134"; +CM143130.1 StringTie transcript 1096177 1097818 1000 . . gene_id "SS.2650"; transcript_id "SS.2650.1"; cov "388.126066"; FPKM "18.981111"; TPM "40.588197"; +CM143130.1 StringTie exon 1096177 1097818 1000 . . gene_id "SS.2650"; transcript_id "SS.2650.1"; exon_number "1"; cov "388.126068"; +CM143130.1 StringTie transcript 1098346 1098877 1000 . . gene_id "SS.2651"; transcript_id "SS.2651.1"; cov "2664.665414"; FPKM "130.314128"; TPM "278.656791"; +CM143130.1 StringTie exon 1098346 1098877 1000 . . gene_id "SS.2651"; transcript_id "SS.2651.1"; exon_number "1"; cov "2664.665527"; +CM143130.1 StringTie transcript 1100418 1102372 1000 . . gene_id "SS.2652"; transcript_id "SS.2652.1"; cov "1267.257289"; FPKM "61.974583"; TPM "132.523148"; +CM143130.1 StringTie exon 1100418 1102372 1000 . . gene_id "SS.2652"; transcript_id "SS.2652.1"; exon_number "1"; cov "1267.257324"; +CM143130.1 StringTie transcript 1103328 1105671 1000 + . gene_id "SS.2653"; transcript_id "SS.2653.1"; cov "10858.977307"; FPKM "531.052849"; TPM "1135.575129"; +CM143130.1 StringTie exon 1103328 1103516 1000 + . gene_id "SS.2653"; transcript_id "SS.2653.1"; exon_number "1"; cov "3154.888916"; +CM143130.1 StringTie exon 1103766 1103911 1000 + . gene_id "SS.2653"; transcript_id "SS.2653.1"; exon_number "2"; cov "8996.931641"; +CM143130.1 StringTie exon 1104024 1105671 1000 + . gene_id "SS.2653"; transcript_id "SS.2653.1"; exon_number "3"; cov "11907.479492"; +CM143130.1 StringTie transcript 1108690 1110407 1000 . . gene_id "SS.2654"; transcript_id "SS.2654.1"; cov "3933.444121"; FPKM "192.363116"; TPM "411.339041"; +CM143130.1 StringTie exon 1108690 1110407 1000 . . gene_id "SS.2654"; transcript_id "SS.2654.1"; exon_number "1"; cov "3933.444092"; +CM143130.1 StringTie transcript 1110739 1113506 1000 . . gene_id "SS.2655"; transcript_id "SS.2655.1"; cov "1551.107298"; FPKM "75.856126"; TPM "162.206700"; +CM143130.1 StringTie exon 1110739 1113506 1000 . . gene_id "SS.2655"; transcript_id "SS.2655.1"; exon_number "1"; cov "1551.107300"; +CM143130.1 StringTie transcript 1113893 1116279 1000 . . gene_id "SS.2656"; transcript_id "SS.2656.1"; cov "386.413490"; FPKM "18.897358"; TPM "40.409104"; +CM143130.1 StringTie exon 1113893 1116279 1000 . . gene_id "SS.2656"; transcript_id "SS.2656.1"; exon_number "1"; cov "386.413483"; +CM143130.1 StringTie transcript 1117357 1124995 1000 . . gene_id "SS.2657"; transcript_id "SS.2657.1"; cov "1631.806912"; FPKM "79.802700"; TPM "170.645844"; +CM143130.1 StringTie exon 1117357 1124995 1000 . . gene_id "SS.2657"; transcript_id "SS.2657.1"; exon_number "1"; cov "1631.806885"; +CM143130.1 StringTie transcript 1125280 1128910 1000 . . gene_id "SS.2658"; transcript_id "SS.2658.1"; cov "385.401542"; FPKM "18.847869"; TPM "40.303280"; +CM143130.1 StringTie exon 1125280 1128910 1000 . . gene_id "SS.2658"; transcript_id "SS.2658.1"; exon_number "1"; cov "385.401550"; +CM143130.1 StringTie transcript 1129314 1131200 1000 . . gene_id "SS.2659"; transcript_id "SS.2659.1"; cov "725.568627"; FPKM "35.483570"; TPM "75.876177"; +CM143130.1 StringTie exon 1129314 1131200 1000 . . gene_id "SS.2659"; transcript_id "SS.2659.1"; exon_number "1"; cov "725.568604"; +CM143130.1 StringTie transcript 1137956 1139868 1000 - . gene_id "SS.2660"; transcript_id "SS.2660.1"; cov "181.326063"; FPKM "8.867660"; TPM "18.962133"; +CM143130.1 StringTie exon 1137956 1139763 1000 - . gene_id "SS.2660"; transcript_id "SS.2660.1"; exon_number "1"; cov "183.066376"; +CM143130.1 StringTie exon 1139843 1139868 1000 - . gene_id "SS.2660"; transcript_id "SS.2660.1"; exon_number "2"; cov "60.307693"; +CM143130.1 StringTie transcript 1140388 1142178 1000 . . gene_id "SS.2661"; transcript_id "SS.2661.1"; cov "252.023451"; FPKM "12.325081"; TPM "26.355296"; +CM143130.1 StringTie exon 1140388 1142178 1000 . . gene_id "SS.2661"; transcript_id "SS.2661.1"; exon_number "1"; cov "252.023453"; +CM143130.1 StringTie transcript 1142524 1156359 1000 . . gene_id "SS.2662"; transcript_id "SS.2662.1"; cov "406.862388"; FPKM "19.897401"; TPM "42.547543"; +CM143130.1 StringTie exon 1142524 1156359 1000 . . gene_id "SS.2662"; transcript_id "SS.2662.1"; exon_number "1"; cov "406.862396"; +CM143130.1 StringTie transcript 1157093 1160818 1000 . . gene_id "SS.2663"; transcript_id "SS.2663.1"; cov "1337.351315"; FPKM "65.402497"; TPM "139.853215"; +CM143130.1 StringTie exon 1157093 1160818 1000 . . gene_id "SS.2663"; transcript_id "SS.2663.1"; exon_number "1"; cov "1337.351318"; +CM143130.1 StringTie transcript 1161303 1164817 1000 . . gene_id "SS.2664"; transcript_id "SS.2664.1"; cov "882.393172"; FPKM "43.152996"; TPM "92.276069"; +CM143130.1 StringTie exon 1161303 1164817 1000 . . gene_id "SS.2664"; transcript_id "SS.2664.1"; exon_number "1"; cov "882.393188"; +CM143130.1 StringTie transcript 1181764 1185612 1000 . . gene_id "SS.2665"; transcript_id "SS.2665.1"; cov "353.497532"; FPKM "17.287620"; TPM "36.966926"; +CM143130.1 StringTie exon 1181764 1185612 1000 . . gene_id "SS.2665"; transcript_id "SS.2665.1"; exon_number "1"; cov "353.497528"; +CM143130.1 StringTie transcript 1165371 1166558 1000 + . gene_id "SS.2666"; transcript_id "SS.2666.1"; cov "3442.901163"; FPKM "168.373358"; TPM "360.040621"; +CM143130.1 StringTie exon 1165371 1165493 1000 + . gene_id "SS.2666"; transcript_id "SS.2666.1"; exon_number "1"; cov "4196.105469"; +CM143130.1 StringTie exon 1165564 1166558 1000 + . gene_id "SS.2666"; transcript_id "SS.2666.1"; exon_number "2"; cov "3349.791504"; +CM143130.1 StringTie transcript 1169809 1171578 1000 + . gene_id "SS.2667"; transcript_id "SS.2667.1"; cov "6959.321893"; FPKM "340.342153"; TPM "727.769534"; +CM143130.1 StringTie exon 1169809 1170001 1000 + . gene_id "SS.2667"; transcript_id "SS.2667.1"; exon_number "1"; cov "2221.461182"; +CM143130.1 StringTie exon 1170082 1171578 1000 + . gene_id "SS.2667"; transcript_id "SS.2667.1"; exon_number "2"; cov "7570.148438"; +CM143130.1 StringTie transcript 1173598 1176127 1000 . . gene_id "SS.2668"; transcript_id "SS.2668.1"; cov "584.710672"; FPKM "28.594983"; TPM "61.145988"; +CM143130.1 StringTie exon 1173598 1176127 1000 . . gene_id "SS.2668"; transcript_id "SS.2668.1"; exon_number "1"; cov "584.710693"; +CM143130.1 StringTie transcript 1178396 1181242 1000 . . gene_id "SS.2669"; transcript_id "SS.2669.1"; cov "1378.830348"; FPKM "67.431008"; TPM "144.190876"; +CM143130.1 StringTie exon 1178396 1181242 1000 . . gene_id "SS.2669"; transcript_id "SS.2669.1"; exon_number "1"; cov "1378.830322"; +CM143130.1 StringTie transcript 1185908 1189048 1000 . . gene_id "SS.2670"; transcript_id "SS.2670.1"; cov "760.812798"; FPKM "37.207169"; TPM "79.561829"; +CM143130.1 StringTie exon 1185908 1189048 1000 . . gene_id "SS.2670"; transcript_id "SS.2670.1"; exon_number "1"; cov "760.812805"; +CM143130.1 StringTie transcript 1189479 1191250 1000 . . gene_id "SS.2671"; transcript_id "SS.2671.1"; cov "46.129233"; FPKM "2.255927"; TPM "4.823954"; +CM143130.1 StringTie exon 1189479 1191250 1000 . . gene_id "SS.2671"; transcript_id "SS.2671.1"; exon_number "1"; cov "46.129234"; +CM143130.1 StringTie transcript 1191479 1191817 1000 . . gene_id "SS.2672"; transcript_id "SS.2672.1"; cov "10.920354"; FPKM "0.534054"; TPM "1.141994"; +CM143130.1 StringTie exon 1191479 1191817 1000 . . gene_id "SS.2672"; transcript_id "SS.2672.1"; exon_number "1"; cov "10.920354"; +CM143130.1 StringTie transcript 1192218 1193950 1000 . . gene_id "SS.2673"; transcript_id "SS.2673.1"; cov "67.811887"; FPKM "3.316306"; TPM "7.091413"; +CM143130.1 StringTie exon 1192218 1193950 1000 . . gene_id "SS.2673"; transcript_id "SS.2673.1"; exon_number "1"; cov "67.811890"; +CM143130.1 StringTie transcript 1194388 1205917 1000 . . gene_id "SS.2674"; transcript_id "SS.2674.1"; cov "1702.951258"; FPKM "83.281979"; TPM "178.085748"; +CM143130.1 StringTie exon 1194388 1205917 1000 . . gene_id "SS.2674"; transcript_id "SS.2674.1"; exon_number "1"; cov "1702.951294"; +CM143130.1 StringTie transcript 1206478 1209873 1000 . . gene_id "SS.2675"; transcript_id "SS.2675.1"; cov "291.237927"; FPKM "14.242845"; TPM "30.456141"; +CM143130.1 StringTie exon 1206478 1209873 1000 . . gene_id "SS.2675"; transcript_id "SS.2675.1"; exon_number "1"; cov "291.237915"; +CM143130.1 StringTie transcript 1210123 1211674 1000 . . gene_id "SS.2676"; transcript_id "SS.2676.1"; cov "462.009665"; FPKM "22.594351"; TPM "48.314558"; +CM143130.1 StringTie exon 1210123 1211674 1000 . . gene_id "SS.2676"; transcript_id "SS.2676.1"; exon_number "1"; cov "462.009674"; +CM143130.1 StringTie transcript 1214829 1218483 1000 + . gene_id "SS.2677"; transcript_id "SS.2677.1"; cov "1701.181574"; FPKM "83.195433"; TPM "177.900683"; +CM143130.1 StringTie exon 1214829 1214913 1000 + . gene_id "SS.2677"; transcript_id "SS.2677.1"; exon_number "1"; cov "1400.941162"; +CM143130.1 StringTie exon 1215595 1218483 1000 + . gene_id "SS.2677"; transcript_id "SS.2677.1"; exon_number "2"; cov "1710.015259"; +CM143130.1 StringTie transcript 1218660 1221482 1000 + . gene_id "SS.2678"; transcript_id "SS.2678.1"; cov "6336.220908"; FPKM "309.869712"; TPM "662.608888"; +CM143130.1 StringTie exon 1218660 1218809 1000 + . gene_id "SS.2678"; transcript_id "SS.2678.1"; exon_number "1"; cov "1524.119995"; +CM143130.1 StringTie exon 1219012 1221482 1000 + . gene_id "SS.2678"; transcript_id "SS.2678.1"; exon_number "2"; cov "6628.335449"; +CM143130.1 StringTie transcript 1223366 1230520 1000 . . gene_id "SS.2679"; transcript_id "SS.2679.1"; cov "744.173445"; FPKM "36.393430"; TPM "77.821772"; +CM143130.1 StringTie exon 1223366 1230520 1000 . . gene_id "SS.2679"; transcript_id "SS.2679.1"; exon_number "1"; cov "744.173462"; +CM143130.1 StringTie transcript 1230970 1232611 1000 + . gene_id "SS.2680"; transcript_id "SS.2680.1"; cov "12175.790102"; FPKM "595.450920"; TPM "1273.280533"; +CM143130.1 StringTie exon 1230970 1231068 1000 + . gene_id "SS.2680"; transcript_id "SS.2680.1"; exon_number "1"; cov "2812.055664"; +CM143130.1 StringTie exon 1231832 1232611 1000 + . gene_id "SS.2680"; transcript_id "SS.2680.1"; exon_number "2"; cov "13364.263672"; +CM143130.1 StringTie transcript 1234401 1235452 1000 . . gene_id "SS.2681"; transcript_id "SS.2681.1"; cov "4615.799430"; FPKM "225.733360"; TPM "482.696195"; +CM143130.1 StringTie exon 1234401 1235452 1000 . . gene_id "SS.2681"; transcript_id "SS.2681.1"; exon_number "1"; cov "4615.799316"; +CM143130.1 StringTie transcript 1244265 1246010 1000 . . gene_id "SS.2682"; transcript_id "SS.2682.1"; cov "2545.943872"; FPKM "124.508111"; TPM "266.241512"; +CM143130.1 StringTie exon 1244265 1246010 1000 . . gene_id "SS.2682"; transcript_id "SS.2682.1"; exon_number "1"; cov "2545.943848"; +CM143130.1 StringTie transcript 1246888 1250360 1000 . . gene_id "SS.2683"; transcript_id "SS.2683.1"; cov "384.733372"; FPKM "18.815193"; TPM "40.233407"; +CM143130.1 StringTie exon 1246888 1250360 1000 . . gene_id "SS.2683"; transcript_id "SS.2683.1"; exon_number "1"; cov "384.733368"; +CM143130.1 StringTie transcript 1250644 1252266 1000 - . gene_id "SS.2684"; transcript_id "SS.2684.1"; cov "993.202703"; FPKM "48.572081"; TPM "103.863951"; +CM143130.1 StringTie exon 1250644 1252119 1000 - . gene_id "SS.2684"; transcript_id "SS.2684.1"; exon_number "1"; cov "1033.913330"; +CM143130.1 StringTie exon 1252189 1252266 1000 - . gene_id "SS.2684"; transcript_id "SS.2684.1"; exon_number "2"; cov "222.833328"; +CM143130.1 StringTie transcript 1252523 1261418 1000 . . gene_id "SS.2685"; transcript_id "SS.2685.1"; cov "572.605047"; FPKM "28.002963"; TPM "59.880045"; +CM143130.1 StringTie exon 1252523 1261418 1000 . . gene_id "SS.2685"; transcript_id "SS.2685.1"; exon_number "1"; cov "572.605042"; +CM143130.1 StringTie transcript 1261659 1263953 1000 . . gene_id "SS.2686"; transcript_id "SS.2686.1"; cov "462.789107"; FPKM "22.632470"; TPM "48.396068"; +CM143130.1 StringTie exon 1261659 1263953 1000 . . gene_id "SS.2686"; transcript_id "SS.2686.1"; exon_number "1"; cov "462.789093"; +CM143130.1 StringTie transcript 1264194 1266322 1000 . . gene_id "SS.2687"; transcript_id "SS.2687.1"; cov "912.590418"; FPKM "44.629778"; TPM "95.433939"; +CM143130.1 StringTie exon 1264194 1266322 1000 . . gene_id "SS.2687"; transcript_id "SS.2687.1"; exon_number "1"; cov "912.590393"; +CM143130.1 StringTie transcript 1266608 1268865 1000 . . gene_id "SS.2688"; transcript_id "SS.2688.1"; cov "423.585031"; FPKM "20.715214"; TPM "44.296310"; +CM143130.1 StringTie exon 1266608 1268865 1000 . . gene_id "SS.2688"; transcript_id "SS.2688.1"; exon_number "1"; cov "423.585022"; +CM143130.1 StringTie transcript 1272276 1278765 1000 . . gene_id "SS.2689"; transcript_id "SS.2689.1"; cov "4552.647766"; FPKM "222.644960"; TPM "476.092124"; +CM143130.1 StringTie exon 1272276 1278765 1000 . . gene_id "SS.2689"; transcript_id "SS.2689.1"; exon_number "1"; cov "4552.647949"; +CM143130.1 StringTie transcript 1279370 1281472 1000 . . gene_id "SS.2690"; transcript_id "SS.2690.1"; cov "136.897765"; FPKM "6.694917"; TPM "14.316053"; +CM143130.1 StringTie exon 1279370 1281472 1000 . . gene_id "SS.2690"; transcript_id "SS.2690.1"; exon_number "1"; cov "136.897766"; +CM143130.1 StringTie transcript 1283763 1286257 1000 . . gene_id "SS.2691"; transcript_id "SS.2691.1"; cov "183.093387"; FPKM "8.954090"; TPM "19.146950"; +CM143130.1 StringTie exon 1283763 1286257 1000 . . gene_id "SS.2691"; transcript_id "SS.2691.1"; exon_number "1"; cov "183.093384"; +CM143130.1 StringTie transcript 1286566 1288218 1000 . . gene_id "SS.2692"; transcript_id "SS.2692.1"; cov "1441.384150"; FPKM "70.490170"; TPM "150.732426"; +CM143130.1 StringTie exon 1286566 1288218 1000 . . gene_id "SS.2692"; transcript_id "SS.2692.1"; exon_number "1"; cov "1441.384155"; +CM143130.1 StringTie transcript 1296404 1296701 1000 . . gene_id "SS.2693"; transcript_id "SS.2693.1"; cov "18.342282"; FPKM "0.897020"; TPM "1.918140"; +CM143130.1 StringTie exon 1296404 1296701 1000 . . gene_id "SS.2693"; transcript_id "SS.2693.1"; exon_number "1"; cov "18.342281"; +CM143130.1 StringTie transcript 1297573 1298873 1000 . . gene_id "SS.2694"; transcript_id "SS.2694.1"; cov "3680.675634"; FPKM "180.001599"; TPM "384.905833"; +CM143130.1 StringTie exon 1297573 1298873 1000 . . gene_id "SS.2694"; transcript_id "SS.2694.1"; exon_number "1"; cov "3680.675537"; +CM143130.1 StringTie transcript 1300145 1304447 1000 . . gene_id "SS.2695"; transcript_id "SS.2695.1"; cov "581.151755"; FPKM "28.420936"; TPM "60.773815"; +CM143130.1 StringTie exon 1300145 1304447 1000 . . gene_id "SS.2695"; transcript_id "SS.2695.1"; exon_number "1"; cov "581.151733"; +CM143130.1 StringTie transcript 1330704 1335051 1000 . . gene_id "SS.2696"; transcript_id "SS.2696.1"; cov "173.198942"; FPKM "8.470208"; TPM "18.112241"; +CM143130.1 StringTie exon 1330704 1335051 1000 . . gene_id "SS.2696"; transcript_id "SS.2696.1"; exon_number "1"; cov "173.198944"; +CM143130.1 StringTie transcript 1304910 1306878 1000 . . gene_id "SS.2697"; transcript_id "SS.2697.1"; cov "1474.755206"; FPKM "72.122165"; TPM "154.222197"; +CM143130.1 StringTie exon 1304910 1306878 1000 . . gene_id "SS.2697"; transcript_id "SS.2697.1"; exon_number "1"; cov "1474.755249"; +CM143130.1 StringTie transcript 1307112 1310879 1000 . . gene_id "SS.2698"; transcript_id "SS.2698.1"; cov "183.872877"; FPKM "8.992211"; TPM "19.228465"; +CM143130.1 StringTie exon 1307112 1310879 1000 . . gene_id "SS.2698"; transcript_id "SS.2698.1"; exon_number "1"; cov "183.872879"; +CM143130.1 StringTie transcript 1311257 1311892 1000 . . gene_id "SS.2699"; transcript_id "SS.2699.1"; cov "1414.831761"; FPKM "69.191639"; TPM "147.955716"; +CM143130.1 StringTie exon 1311257 1311892 1000 . . gene_id "SS.2699"; transcript_id "SS.2699.1"; exon_number "1"; cov "1414.831787"; +CM143130.1 StringTie transcript 1313719 1315541 1000 . . gene_id "SS.2700"; transcript_id "SS.2700.1"; cov "4858.544707"; FPKM "237.604697"; TPM "508.081229"; +CM143130.1 StringTie exon 1313719 1315541 1000 . . gene_id "SS.2700"; transcript_id "SS.2700.1"; exon_number "1"; cov "4858.544922"; +CM143130.1 StringTie transcript 1315937 1319775 1000 . . gene_id "SS.2701"; transcript_id "SS.2701.1"; cov "759.455066"; FPKM "37.140770"; TPM "79.419844"; +CM143130.1 StringTie exon 1315937 1319775 1000 . . gene_id "SS.2701"; transcript_id "SS.2701.1"; exon_number "1"; cov "759.455078"; +CM143130.1 StringTie transcript 1320650 1323793 1000 . . gene_id "SS.2702"; transcript_id "SS.2702.1"; cov "392.839695"; FPKM "19.211629"; TPM "41.081123"; +CM143130.1 StringTie exon 1320650 1323793 1000 . . gene_id "SS.2702"; transcript_id "SS.2702.1"; exon_number "1"; cov "392.839691"; +CM143130.1 StringTie transcript 1324187 1328685 1000 . . gene_id "SS.2703"; transcript_id "SS.2703.1"; cov "341.658813"; FPKM "16.708653"; TPM "35.728894"; +CM143130.1 StringTie exon 1324187 1328685 1000 . . gene_id "SS.2703"; transcript_id "SS.2703.1"; exon_number "1"; cov "341.658813"; +CM143130.1 StringTie transcript 1328888 1330033 1000 . . gene_id "SS.2704"; transcript_id "SS.2704.1"; cov "3014.648342"; FPKM "147.429868"; TPM "315.256178"; +CM143130.1 StringTie exon 1328888 1330033 1000 . . gene_id "SS.2704"; transcript_id "SS.2704.1"; exon_number "1"; cov "3014.648438"; +CM143130.1 StringTie transcript 1336271 1340197 1000 . . gene_id "SS.2705"; transcript_id "SS.2705.1"; cov "1381.116628"; FPKM "67.542817"; TPM "144.429963"; +CM143130.1 StringTie exon 1336271 1340197 1000 . . gene_id "SS.2705"; transcript_id "SS.2705.1"; exon_number "1"; cov "1381.116577"; +CM143130.1 StringTie transcript 1340473 1353623 1000 . . gene_id "SS.2706"; transcript_id "SS.2706.1"; cov "382.391453"; FPKM "18.700663"; TPM "39.988501"; +CM143130.1 StringTie exon 1340473 1353623 1000 . . gene_id "SS.2706"; transcript_id "SS.2706.1"; exon_number "1"; cov "382.391449"; +CM143130.1 StringTie transcript 1340523 1353527 1000 - . gene_id "SS.2707"; transcript_id "SS.2707.1"; cov "132.353324"; FPKM "6.472673"; TPM "13.840819"; +CM143130.1 StringTie exon 1340523 1342135 1000 - . gene_id "SS.2707"; transcript_id "SS.2707.1"; exon_number "1"; cov "361.719147"; +CM143130.1 StringTie exon 1342218 1353527 1000 - . gene_id "SS.2707"; transcript_id "SS.2707.1"; exon_number "2"; cov "99.641823"; +CM143130.1 StringTie transcript 1355001 1361250 1000 . . gene_id "SS.2708"; transcript_id "SS.2708.1"; cov "325.060320"; FPKM "15.896912"; TPM "33.993110"; +CM143130.1 StringTie exon 1355001 1361250 1000 . . gene_id "SS.2708"; transcript_id "SS.2708.1"; exon_number "1"; cov "325.060333"; +CM143130.1 StringTie transcript 1361551 1362580 1000 . . gene_id "SS.2709"; transcript_id "SS.2709.1"; cov "2942.718447"; FPKM "143.912173"; TPM "307.734125"; +CM143130.1 StringTie exon 1361551 1362580 1000 . . gene_id "SS.2709"; transcript_id "SS.2709.1"; exon_number "1"; cov "2942.718506"; +CM143130.1 StringTie transcript 1362865 1365128 1000 . . gene_id "SS.2710"; transcript_id "SS.2710.1"; cov "1332.686396"; FPKM "65.174361"; TPM "139.365382"; +CM143130.1 StringTie exon 1362865 1365128 1000 . . gene_id "SS.2710"; transcript_id "SS.2710.1"; exon_number "1"; cov "1332.686401"; +CM143130.1 StringTie transcript 1366329 1367980 1000 + . gene_id "SS.2711"; transcript_id "SS.2711.1"; cov "10.481766"; FPKM "0.512606"; TPM "1.096128"; +CM143130.1 StringTie exon 1366329 1366430 1000 + . gene_id "SS.2711"; transcript_id "SS.2711.1"; exon_number "1"; cov "12.000000"; +CM143130.1 StringTie exon 1366520 1367980 1000 + . gene_id "SS.2711"; transcript_id "SS.2711.1"; exon_number "2"; cov "10.375770"; +CM143130.1 StringTie transcript 1368910 1370698 1000 . . gene_id "SS.2712"; transcript_id "SS.2712.1"; cov "381.321968"; FPKM "18.648360"; TPM "39.876660"; +CM143130.1 StringTie exon 1368910 1370698 1000 . . gene_id "SS.2712"; transcript_id "SS.2712.1"; exon_number "1"; cov "381.321960"; +CM143130.1 StringTie transcript 1406239 1407637 1000 . . gene_id "SS.2713"; transcript_id "SS.2713.1"; cov "195.704789"; FPKM "9.570845"; TPM "20.465785"; +CM143130.1 StringTie exon 1406239 1407637 1000 . . gene_id "SS.2713"; transcript_id "SS.2713.1"; exon_number "1"; cov "195.704788"; +CM143130.1 StringTie transcript 1371162 1376107 1000 . . gene_id "SS.2714"; transcript_id "SS.2714.1"; cov "1119.075212"; FPKM "54.727813"; TPM "117.027041"; +CM143130.1 StringTie exon 1371162 1376107 1000 . . gene_id "SS.2714"; transcript_id "SS.2714.1"; exon_number "1"; cov "1119.075195"; +CM143130.1 StringTie transcript 1376207 1390006 1000 . . gene_id "SS.2715"; transcript_id "SS.2715.1"; cov "433.043043"; FPKM "21.177753"; TPM "45.285380"; +CM143130.1 StringTie exon 1376207 1390006 1000 . . gene_id "SS.2715"; transcript_id "SS.2715.1"; exon_number "1"; cov "433.043030"; +CM143130.1 StringTie transcript 1390359 1391488 1000 . . gene_id "SS.2716"; transcript_id "SS.2716.1"; cov "2668.504425"; FPKM "130.501873"; TPM "279.058255"; +CM143130.1 StringTie exon 1390359 1391488 1000 . . gene_id "SS.2716"; transcript_id "SS.2716.1"; exon_number "1"; cov "2668.504395"; +CM143130.1 StringTie transcript 1392204 1395616 1000 . . gene_id "SS.2717"; transcript_id "SS.2717.1"; cov "332.307061"; FPKM "16.251310"; TPM "34.750937"; +CM143130.1 StringTie exon 1392204 1395616 1000 . . gene_id "SS.2717"; transcript_id "SS.2717.1"; exon_number "1"; cov "332.307068"; +CM143130.1 StringTie transcript 1396023 1405912 1000 + . gene_id "SS.2718"; transcript_id "SS.2718.1"; cov "318.174865"; FPKM "15.560182"; TPM "33.273066"; +CM143130.1 StringTie exon 1396023 1396140 1000 + . gene_id "SS.2718"; transcript_id "SS.2718.1"; exon_number "1"; cov "198.576279"; +CM143130.1 StringTie exon 1396212 1405912 1000 + . gene_id "SS.2718"; transcript_id "SS.2718.1"; exon_number "2"; cov "319.629639"; +CM143130.1 StringTie transcript 1408445 1410713 1000 . . gene_id "SS.2719"; transcript_id "SS.2719.1"; cov "529.696342"; FPKM "25.904534"; TPM "55.392877"; +CM143130.1 StringTie exon 1408445 1410713 1000 . . gene_id "SS.2719"; transcript_id "SS.2719.1"; exon_number "1"; cov "529.696350"; +CM143130.1 StringTie transcript 1410978 1414063 1000 . . gene_id "SS.2720"; transcript_id "SS.2720.1"; cov "372.628321"; FPKM "18.223202"; TPM "38.967524"; +CM143130.1 StringTie exon 1410978 1414063 1000 . . gene_id "SS.2720"; transcript_id "SS.2720.1"; exon_number "1"; cov "372.628326"; +CM143130.1 StringTie transcript 1415198 1417563 1000 . . gene_id "SS.2721"; transcript_id "SS.2721.1"; cov "1278.907016"; FPKM "62.544307"; TPM "133.741416"; +CM143130.1 StringTie exon 1415198 1417563 1000 . . gene_id "SS.2721"; transcript_id "SS.2721.1"; exon_number "1"; cov "1278.906982"; +CM143130.1 StringTie transcript 1418181 1420901 1000 . . gene_id "SS.2722"; transcript_id "SS.2722.1"; cov "266.196986"; FPKM "13.018230"; TPM "27.837490"; +CM143130.1 StringTie exon 1418181 1420901 1000 . . gene_id "SS.2722"; transcript_id "SS.2722.1"; exon_number "1"; cov "266.196991"; +CM143130.1 StringTie transcript 1421345 1424494 1000 . . gene_id "SS.2723"; transcript_id "SS.2723.1"; cov "1281.177143"; FPKM "62.655327"; TPM "133.978814"; +CM143130.1 StringTie exon 1421345 1424494 1000 . . gene_id "SS.2723"; transcript_id "SS.2723.1"; exon_number "1"; cov "1281.177124"; +CM143130.1 StringTie transcript 1424712 1427932 1000 . . gene_id "SS.2724"; transcript_id "SS.2724.1"; cov "132.558212"; FPKM "6.482693"; TPM "13.862245"; +CM143130.1 StringTie exon 1424712 1427932 1000 . . gene_id "SS.2724"; transcript_id "SS.2724.1"; exon_number "1"; cov "132.558212"; +CM143130.1 StringTie transcript 1428540 1431273 1000 . . gene_id "SS.2725"; transcript_id "SS.2725.1"; cov "182.370885"; FPKM "8.918757"; TPM "19.071395"; +CM143130.1 StringTie exon 1428540 1431273 1000 . . gene_id "SS.2725"; transcript_id "SS.2725.1"; exon_number "1"; cov "182.370880"; +CM143130.1 StringTie transcript 1433201 1433926 1000 . . gene_id "SS.2726"; transcript_id "SS.2726.1"; cov "8940.783747"; FPKM "437.244553"; TPM "934.980465"; +CM143130.1 StringTie exon 1433201 1433926 1000 . . gene_id "SS.2726"; transcript_id "SS.2726.1"; exon_number "1"; cov "8940.784180"; +CM143130.1 StringTie transcript 1479144 1483124 1000 - . gene_id "SS.2727"; transcript_id "SS.2727.1"; cov "372.425798"; FPKM "18.213297"; TPM "38.946345"; +CM143130.1 StringTie exon 1479144 1482907 1000 - . gene_id "SS.2727"; transcript_id "SS.2727.1"; exon_number "1"; cov "380.295959"; +CM143130.1 StringTie exon 1482974 1483124 1000 - . gene_id "SS.2727"; transcript_id "SS.2727.1"; exon_number "2"; cov "176.245026"; +CM143130.1 StringTie transcript 1441944 1445249 1000 . . gene_id "SS.2728"; transcript_id "SS.2728.1"; cov "1020.015426"; FPKM "49.883344"; TPM "106.667886"; +CM143130.1 StringTie exon 1441944 1445249 1000 . . gene_id "SS.2728"; transcript_id "SS.2728.1"; exon_number "1"; cov "1020.015442"; +CM143130.1 StringTie transcript 1445407 1448051 1000 . . gene_id "SS.2729"; transcript_id "SS.2729.1"; cov "858.965217"; FPKM "42.007264"; TPM "89.826096"; +CM143130.1 StringTie exon 1445407 1448051 1000 . . gene_id "SS.2729"; transcript_id "SS.2729.1"; exon_number "1"; cov "858.965210"; +CM143130.1 StringTie transcript 1448299 1450630 1000 . . gene_id "SS.2730"; transcript_id "SS.2730.1"; cov "240.928388"; FPKM "11.782482"; TPM "25.195032"; +CM143130.1 StringTie exon 1448299 1450630 1000 . . gene_id "SS.2730"; transcript_id "SS.2730.1"; exon_number "1"; cov "240.928391"; +CM143130.1 StringTie transcript 1450986 1454664 1000 . . gene_id "SS.2731"; transcript_id "SS.2731.1"; cov "551.514814"; FPKM "26.971556"; TPM "57.674539"; +CM143130.1 StringTie exon 1450986 1454664 1000 . . gene_id "SS.2731"; transcript_id "SS.2731.1"; exon_number "1"; cov "551.514832"; +CM143130.1 StringTie transcript 1455074 1459760 1000 . . gene_id "SS.2732"; transcript_id "SS.2732.1"; cov "120.458929"; FPKM "5.890984"; TPM "12.596966"; +CM143130.1 StringTie exon 1455074 1459760 1000 . . gene_id "SS.2732"; transcript_id "SS.2732.1"; exon_number "1"; cov "120.458931"; +CM143130.1 StringTie transcript 1463038 1464374 1000 - . gene_id "SS.2733"; transcript_id "SS.2733.1"; cov "1830.828316"; FPKM "89.535742"; TPM "191.458463"; +CM143130.1 StringTie exon 1463038 1464189 1000 - . gene_id "SS.2733"; transcript_id "SS.2733.1"; exon_number "1"; cov "1934.225708"; +CM143130.1 StringTie exon 1464298 1464374 1000 - . gene_id "SS.2733"; transcript_id "SS.2733.1"; exon_number "2"; cov "283.896118"; +CM143130.1 StringTie transcript 1464649 1473499 1000 - . gene_id "SS.2734"; transcript_id "SS.2734.1"; cov "505.296659"; FPKM "24.711280"; TPM "52.841285"; +CM143130.1 StringTie exon 1464649 1473316 1000 - . gene_id "SS.2734"; transcript_id "SS.2734.1"; exon_number "1"; cov "507.298157"; +CM143130.1 StringTie exon 1473423 1473499 1000 - . gene_id "SS.2734"; transcript_id "SS.2734.1"; exon_number "2"; cov "279.984253"; +CM143130.1 StringTie transcript 1464649 1473499 1000 - . gene_id "SS.2734"; transcript_id "SS.2734.2"; cov "200.971528"; FPKM "9.828412"; TPM "21.016553"; +CM143130.1 StringTie exon 1464649 1472169 1000 - . gene_id "SS.2734"; transcript_id "SS.2734.2"; exon_number "1"; cov "199.904907"; +CM143130.1 StringTie exon 1473268 1473316 1000 - . gene_id "SS.2734"; transcript_id "SS.2734.2"; exon_number "2"; cov "466.679810"; +CM143130.1 StringTie exon 1473423 1473499 1000 - . gene_id "SS.2734"; transcript_id "SS.2734.2"; exon_number "3"; cov "136.067703"; +CM143130.1 StringTie transcript 1474096 1475334 1000 . . gene_id "SS.2735"; transcript_id "SS.2735.1"; cov "11496.159806"; FPKM "562.213940"; TPM "1202.208346"; +CM143130.1 StringTie exon 1474096 1475334 1000 . . gene_id "SS.2735"; transcript_id "SS.2735.1"; exon_number "1"; cov "11496.160156"; +CM143130.1 StringTie transcript 1506677 1512921 1000 - . gene_id "SS.2736"; transcript_id "SS.2736.1"; cov "147.416399"; FPKM "7.209325"; TPM "15.416037"; +CM143130.1 StringTie exon 1506677 1508775 1000 - . gene_id "SS.2736"; transcript_id "SS.2736.1"; exon_number "1"; cov "129.858307"; +CM143130.1 StringTie exon 1508838 1512921 1000 - . gene_id "SS.2736"; transcript_id "SS.2736.1"; exon_number "2"; cov "156.440506"; +CM143130.1 StringTie transcript 1506677 1508911 1000 - . gene_id "SS.2736"; transcript_id "SS.2736.2"; cov "6.736251"; FPKM "0.329433"; TPM "0.704442"; +CM143130.1 StringTie exon 1506677 1508765 1000 - . gene_id "SS.2736"; transcript_id "SS.2736.2"; exon_number "1"; cov "6.877188"; +CM143130.1 StringTie exon 1508838 1508911 1000 - . gene_id "SS.2736"; transcript_id "SS.2736.2"; exon_number "2"; cov "2.757633"; +CM143130.1 StringTie transcript 1516790 1518283 1000 - . gene_id "SS.2737"; transcript_id "SS.2737.1"; cov "3741.722417"; FPKM "182.987062"; TPM "391.289787"; +CM143130.1 StringTie exon 1516790 1518039 1000 - . gene_id "SS.2737"; transcript_id "SS.2737.1"; exon_number "1"; cov "3772.609619"; +CM143130.1 StringTie exon 1518111 1518283 1000 - . gene_id "SS.2737"; transcript_id "SS.2737.1"; exon_number "2"; cov "3518.549072"; +CM143130.1 StringTie transcript 1523080 1523705 1000 . . gene_id "SS.2738"; transcript_id "SS.2738.1"; cov "972.362620"; FPKM "47.552907"; TPM "101.684604"; +CM143130.1 StringTie exon 1523080 1523705 1000 . . gene_id "SS.2738"; transcript_id "SS.2738.1"; exon_number "1"; cov "972.362610"; +CM143130.1 StringTie transcript 1523932 1524996 1000 . . gene_id "SS.2739"; transcript_id "SS.2739.1"; cov "585.258216"; FPKM "28.621760"; TPM "61.203247"; +CM143130.1 StringTie exon 1523932 1524996 1000 . . gene_id "SS.2739"; transcript_id "SS.2739.1"; exon_number "1"; cov "585.258240"; +CM143130.1 StringTie transcript 1530215 1532327 1000 . . gene_id "SS.2740"; transcript_id "SS.2740.1"; cov "4952.251301"; FPKM "242.187371"; TPM "517.880575"; +CM143130.1 StringTie exon 1530215 1532327 1000 . . gene_id "SS.2740"; transcript_id "SS.2740.1"; exon_number "1"; cov "4952.251465"; +CM143130.1 StringTie transcript 1532826 1533533 1000 - . gene_id "SS.2741"; transcript_id "SS.2741.1"; cov "2963.895935"; FPKM "144.947847"; TPM "309.948756"; +CM143130.1 StringTie exon 1532826 1533267 1000 - . gene_id "SS.2741"; transcript_id "SS.2741.1"; exon_number "1"; cov "3436.321289"; +CM143130.1 StringTie exon 1533361 1533533 1000 - . gene_id "SS.2741"; transcript_id "SS.2741.1"; exon_number "2"; cov "1756.890137"; +CM143130.1 StringTie transcript 1533888 1537977 1000 . . gene_id "SS.2742"; transcript_id "SS.2742.1"; cov "357.571394"; FPKM "17.486850"; TPM "37.392949"; +CM143130.1 StringTie exon 1533888 1537977 1000 . . gene_id "SS.2742"; transcript_id "SS.2742.1"; exon_number "1"; cov "357.571381"; +CM143130.1 StringTie transcript 1538248 1545709 1000 . . gene_id "SS.2743"; transcript_id "SS.2743.1"; cov "122.841187"; FPKM "6.007487"; TPM "12.846090"; +CM143130.1 StringTie exon 1538248 1545709 1000 . . gene_id "SS.2743"; transcript_id "SS.2743.1"; exon_number "1"; cov "122.841187"; +CM143130.1 StringTie transcript 1544814 1548207 1000 - . gene_id "SS.2744"; transcript_id "SS.2744.1"; cov "11.890086"; FPKM "0.581479"; TPM "1.243403"; +CM143130.1 StringTie exon 1544814 1545359 1000 - . gene_id "SS.2744"; transcript_id "SS.2744.1"; exon_number "1"; cov "13.512012"; +CM143130.1 StringTie exon 1548082 1548207 1000 - . gene_id "SS.2744"; transcript_id "SS.2744.1"; exon_number "2"; cov "4.861743"; +CM143130.1 StringTie transcript 1546136 1548207 1000 . . gene_id "SS.2745"; transcript_id "SS.2745.1"; cov "326.916234"; FPKM "15.987675"; TPM "34.187192"; +CM143130.1 StringTie exon 1546136 1548207 1000 . . gene_id "SS.2745"; transcript_id "SS.2745.1"; exon_number "1"; cov "326.916229"; +CM143130.1 StringTie transcript 1548540 1549985 1000 . . gene_id "SS.2746"; transcript_id "SS.2746.1"; cov "1289.176349"; FPKM "63.046524"; TPM "134.815329"; +CM143130.1 StringTie exon 1548540 1549985 1000 . . gene_id "SS.2746"; transcript_id "SS.2746.1"; exon_number "1"; cov "1289.176392"; +CM143130.1 StringTie transcript 1550334 1554027 1000 . . gene_id "SS.2747"; transcript_id "SS.2747.1"; cov "252.369789"; FPKM "12.342018"; TPM "26.391514"; +CM143130.1 StringTie exon 1550334 1554027 1000 . . gene_id "SS.2747"; transcript_id "SS.2747.1"; exon_number "1"; cov "252.369781"; +CM143130.1 StringTie transcript 1554307 1555490 1000 . . gene_id "SS.2748"; transcript_id "SS.2748.1"; cov "523.569257"; FPKM "25.604892"; TPM "54.752138"; +CM143130.1 StringTie exon 1554307 1555490 1000 . . gene_id "SS.2748"; transcript_id "SS.2748.1"; exon_number "1"; cov "523.569275"; +CM143130.1 StringTie transcript 1557078 1558369 1000 - . gene_id "SS.2749"; transcript_id "SS.2749.1"; cov "1651.608735"; FPKM "80.771098"; TPM "172.716615"; +CM143130.1 StringTie exon 1557078 1558057 1000 - . gene_id "SS.2749"; transcript_id "SS.2749.1"; exon_number "1"; cov "1795.552002"; +CM143130.1 StringTie exon 1558189 1558257 1000 - . gene_id "SS.2749"; transcript_id "SS.2749.1"; exon_number "2"; cov "662.362305"; +CM143130.1 StringTie exon 1558320 1558369 1000 - . gene_id "SS.2749"; transcript_id "SS.2749.1"; exon_number "3"; cov "195.479996"; +CM143130.1 StringTie transcript 1561855 1564408 1000 . . gene_id "SS.2750"; transcript_id "SS.2750.1"; cov "831.819499"; FPKM "40.679716"; TPM "86.987338"; +CM143130.1 StringTie exon 1561855 1564408 1000 . . gene_id "SS.2750"; transcript_id "SS.2750.1"; exon_number "1"; cov "831.819519"; +CM143130.1 StringTie transcript 1564797 1569693 1000 . . gene_id "SS.2751"; transcript_id "SS.2751.1"; cov "191.893813"; FPKM "9.384471"; TPM "20.067253"; +CM143130.1 StringTie exon 1564797 1569693 1000 . . gene_id "SS.2751"; transcript_id "SS.2751.1"; exon_number "1"; cov "191.893814"; +CM143130.1 StringTie transcript 1569999 1571712 1000 . . gene_id "SS.2752"; transcript_id "SS.2752.1"; cov "1165.948075"; FPKM "57.020107"; TPM "121.928760"; +CM143130.1 StringTie exon 1569999 1571712 1000 . . gene_id "SS.2752"; transcript_id "SS.2752.1"; exon_number "1"; cov "1165.948120"; +CM143130.1 StringTie transcript 1573101 1582711 1000 . . gene_id "SS.2753"; transcript_id "SS.2753.1"; cov "607.146915"; FPKM "29.692216"; TPM "63.492253"; +CM143130.1 StringTie exon 1573101 1582711 1000 . . gene_id "SS.2753"; transcript_id "SS.2753.1"; exon_number "1"; cov "607.146912"; +CM143130.1 StringTie transcript 1583075 1584442 1000 . . gene_id "SS.2754"; transcript_id "SS.2754.1"; cov "15927.040936"; FPKM "778.903964"; TPM "1665.566752"; +CM143130.1 StringTie exon 1583075 1584442 1000 . . gene_id "SS.2754"; transcript_id "SS.2754.1"; exon_number "1"; cov "15927.041016"; +CM143130.1 StringTie transcript 1584890 1589917 1000 . . gene_id "SS.2755"; transcript_id "SS.2755.1"; cov "623.656126"; FPKM "30.499591"; TPM "65.218700"; +CM143130.1 StringTie exon 1584890 1589917 1000 . . gene_id "SS.2755"; transcript_id "SS.2755.1"; exon_number "1"; cov "623.656128"; +CM143130.1 StringTie transcript 1590236 1591873 1000 . . gene_id "SS.2756"; transcript_id "SS.2756.1"; cov "2448.804029"; FPKM "119.757535"; TPM "256.083135"; +CM143130.1 StringTie exon 1590236 1591873 1000 . . gene_id "SS.2756"; transcript_id "SS.2756.1"; exon_number "1"; cov "2448.803955"; +CM143130.1 StringTie transcript 1592086 1592711 1000 . . gene_id "SS.2757"; transcript_id "SS.2757.1"; cov "694.781150"; FPKM "33.977924"; TPM "72.656584"; +CM143130.1 StringTie exon 1592086 1592711 1000 . . gene_id "SS.2757"; transcript_id "SS.2757.1"; exon_number "1"; cov "694.781128"; +CM143130.1 StringTie transcript 1593026 1595872 1000 . . gene_id "SS.2758"; transcript_id "SS.2758.1"; cov "587.939937"; FPKM "28.752908"; TPM "61.483688"; +CM143130.1 StringTie exon 1593026 1595872 1000 . . gene_id "SS.2758"; transcript_id "SS.2758.1"; exon_number "1"; cov "587.939941"; +CM143130.1 StringTie transcript 1596491 1598010 1000 . . gene_id "SS.2759"; transcript_id "SS.2759.1"; cov "6874.984211"; FPKM "336.217661"; TPM "718.949940"; +CM143130.1 StringTie exon 1596491 1598010 1000 . . gene_id "SS.2759"; transcript_id "SS.2759.1"; exon_number "1"; cov "6874.984375"; +CM143130.1 StringTie transcript 1598363 1600986 1000 . . gene_id "SS.2760"; transcript_id "SS.2760.1"; cov "180.477134"; FPKM "8.826144"; TPM "18.873356"; +CM143130.1 StringTie exon 1598363 1600986 1000 . . gene_id "SS.2760"; transcript_id "SS.2760.1"; exon_number "1"; cov "180.477127"; +CM143130.1 StringTie transcript 1601287 1602469 1000 . . gene_id "SS.2761"; transcript_id "SS.2761.1"; cov "352.159763"; FPKM "17.222197"; TPM "36.827029"; +CM143130.1 StringTie exon 1601287 1602469 1000 . . gene_id "SS.2761"; transcript_id "SS.2761.1"; exon_number "1"; cov "352.159760"; +CM143130.1 StringTie transcript 1602798 1606276 1000 . . gene_id "SS.2762"; transcript_id "SS.2762.1"; cov "375.691865"; FPKM "18.373023"; TPM "39.287893"; +CM143130.1 StringTie exon 1602798 1606276 1000 . . gene_id "SS.2762"; transcript_id "SS.2762.1"; exon_number "1"; cov "375.691864"; +CM143130.1 StringTie transcript 1606995 1610144 1000 . . gene_id "SS.2763"; transcript_id "SS.2763.1"; cov "2596.335556"; FPKM "126.972491"; TPM "271.511211"; +CM143130.1 StringTie exon 1606995 1610144 1000 . . gene_id "SS.2763"; transcript_id "SS.2763.1"; exon_number "1"; cov "2596.335449"; +CM143130.1 StringTie transcript 1612190 1613337 1000 . . gene_id "SS.2764"; transcript_id "SS.2764.1"; cov "1993.912021"; FPKM "97.511269"; TPM "208.512905"; +CM143130.1 StringTie exon 1612190 1613337 1000 . . gene_id "SS.2764"; transcript_id "SS.2764.1"; exon_number "1"; cov "1993.911987"; +CM143130.1 StringTie transcript 1613835 1618969 1000 . . gene_id "SS.2765"; transcript_id "SS.2765.1"; cov "1263.989289"; FPKM "61.814763"; TPM "132.181398"; +CM143130.1 StringTie exon 1613835 1618969 1000 . . gene_id "SS.2765"; transcript_id "SS.2765.1"; exon_number "1"; cov "1263.989258"; +CM143130.1 StringTie transcript 1620148 1621317 1000 . . gene_id "SS.2766"; transcript_id "SS.2766.1"; cov "641.072650"; FPKM "31.351337"; TPM "67.040029"; +CM143130.1 StringTie exon 1620148 1621317 1000 . . gene_id "SS.2766"; transcript_id "SS.2766.1"; exon_number "1"; cov "641.072632"; +CM143130.1 StringTie transcript 1625236 1625725 1000 . . gene_id "SS.2767"; transcript_id "SS.2767.1"; cov "260.628571"; FPKM "12.745910"; TPM "27.255175"; +CM143130.1 StringTie exon 1625236 1625725 1000 . . gene_id "SS.2767"; transcript_id "SS.2767.1"; exon_number "1"; cov "260.628571"; +CM143130.1 StringTie transcript 1625992 1627187 1000 . . gene_id "SS.2768"; transcript_id "SS.2768.1"; cov "403.204013"; FPKM "19.718490"; TPM "42.164970"; +CM143130.1 StringTie exon 1625992 1627187 1000 . . gene_id "SS.2768"; transcript_id "SS.2768.1"; exon_number "1"; cov "403.204010"; +CM143130.1 StringTie transcript 1630450 1632541 1000 . . gene_id "SS.2769"; transcript_id "SS.2769.1"; cov "8463.738050"; FPKM "413.914872"; TPM "885.093518"; +CM143130.1 StringTie exon 1630450 1632541 1000 . . gene_id "SS.2769"; transcript_id "SS.2769.1"; exon_number "1"; cov "8463.738281"; +CM143130.1 StringTie transcript 1633069 1646592 1000 . . gene_id "SS.2770"; transcript_id "SS.2770.1"; cov "380.142413"; FPKM "18.590674"; TPM "39.753308"; +CM143130.1 StringTie exon 1633069 1646592 1000 . . gene_id "SS.2770"; transcript_id "SS.2770.1"; exon_number "1"; cov "380.142426"; +CM143130.1 StringTie transcript 1646933 1653098 1000 . . gene_id "SS.2771"; transcript_id "SS.2771.1"; cov "199.953292"; FPKM "9.778616"; TPM "20.910071"; +CM143130.1 StringTie exon 1646933 1653098 1000 . . gene_id "SS.2771"; transcript_id "SS.2771.1"; exon_number "1"; cov "199.953293"; +CM143130.1 StringTie transcript 1656513 1658019 1000 - . gene_id "SS.2772"; transcript_id "SS.2772.1"; cov "7143.803383"; FPKM "349.364128"; TPM "747.061645"; +CM143130.1 StringTie exon 1656513 1657853 1000 - . gene_id "SS.2772"; transcript_id "SS.2772.1"; exon_number "1"; cov "7389.988770"; +CM143130.1 StringTie exon 1657942 1658019 1000 - . gene_id "SS.2772"; transcript_id "SS.2772.1"; exon_number "2"; cov "2911.307617"; +CM143130.1 StringTie transcript 1658950 1665185 1000 + . gene_id "SS.2773"; transcript_id "SS.2773.1"; cov "729.424312"; FPKM "35.672131"; TPM "76.279385"; +CM143130.1 StringTie exon 1658950 1659045 1000 + . gene_id "SS.2773"; transcript_id "SS.2773.1"; exon_number "1"; cov "464.677094"; +CM143130.1 StringTie exon 1659211 1665185 1000 + . gene_id "SS.2773"; transcript_id "SS.2773.1"; exon_number "2"; cov "733.677979"; +CM143130.1 StringTie transcript 1668936 1669521 1000 . . gene_id "SS.2774"; transcript_id "SS.2774.1"; cov "30497.051195"; FPKM "1491.443022"; TPM "3189.222324"; +CM143130.1 StringTie exon 1668936 1669521 1000 . . gene_id "SS.2774"; transcript_id "SS.2774.1"; exon_number "1"; cov "30497.050781"; +CM143130.1 StringTie transcript 1669813 1672285 1000 . . gene_id "SS.2775"; transcript_id "SS.2775.1"; cov "690.943793"; FPKM "33.790260"; TPM "72.255293"; +CM143130.1 StringTie exon 1669813 1672285 1000 . . gene_id "SS.2775"; transcript_id "SS.2775.1"; exon_number "1"; cov "690.943787"; +CM143130.1 StringTie transcript 1672835 1673761 1000 . . gene_id "SS.2776"; transcript_id "SS.2776.1"; cov "8406.233010"; FPKM "411.102617"; TPM "879.079941"; +CM143130.1 StringTie exon 1672835 1673761 1000 . . gene_id "SS.2776"; transcript_id "SS.2776.1"; exon_number "1"; cov "8406.233398"; +CM143130.1 StringTie transcript 1675232 1686509 1000 . . gene_id "SS.2777"; transcript_id "SS.2777.1"; cov "325.999291"; FPKM "15.942832"; TPM "34.091303"; +CM143130.1 StringTie exon 1675232 1686509 1000 . . gene_id "SS.2777"; transcript_id "SS.2777.1"; exon_number "1"; cov "325.999298"; +CM143130.1 StringTie transcript 1686924 1688145 1000 . . gene_id "SS.2778"; transcript_id "SS.2778.1"; cov "1615.537643"; FPKM "79.007060"; TPM "168.944489"; +CM143130.1 StringTie exon 1686924 1688145 1000 . . gene_id "SS.2778"; transcript_id "SS.2778.1"; exon_number "1"; cov "1615.537598"; +CM143130.1 StringTie transcript 1688349 1689553 1000 . . gene_id "SS.2779"; transcript_id "SS.2779.1"; cov "1084.084647"; FPKM "53.016617"; TPM "113.367910"; +CM143130.1 StringTie exon 1688349 1689553 1000 . . gene_id "SS.2779"; transcript_id "SS.2779.1"; exon_number "1"; cov "1084.084595"; +CM143130.1 StringTie transcript 1689840 1691138 1000 . . gene_id "SS.2780"; transcript_id "SS.2780.1"; cov "1811.792148"; FPKM "88.604788"; TPM "189.467760"; +CM143130.1 StringTie exon 1689840 1691138 1000 . . gene_id "SS.2780"; transcript_id "SS.2780.1"; exon_number "1"; cov "1811.792114"; +CM143130.1 StringTie transcript 1693096 1695210 1000 . . gene_id "SS.2781"; transcript_id "SS.2781.1"; cov "491.461939"; FPKM "24.034700"; TPM "51.394523"; +CM143130.1 StringTie exon 1693096 1695210 1000 . . gene_id "SS.2781"; transcript_id "SS.2781.1"; exon_number "1"; cov "491.461945"; +CM143130.1 StringTie transcript 1695453 1702118 1000 - . gene_id "SS.2782"; transcript_id "SS.2782.1"; cov "286.417188"; FPKM "14.007089"; TPM "29.952014"; +CM143130.1 StringTie exon 1695453 1701889 1000 - . gene_id "SS.2782"; transcript_id "SS.2782.1"; exon_number "1"; cov "288.170105"; +CM143130.1 StringTie exon 1702005 1702118 1000 - . gene_id "SS.2782"; transcript_id "SS.2782.1"; exon_number "2"; cov "187.438599"; +CM143130.1 StringTie transcript 1703329 1706186 1000 . . gene_id "SS.2783"; transcript_id "SS.2783.1"; cov "342.697341"; FPKM "16.759442"; TPM "35.837498"; +CM143130.1 StringTie exon 1703329 1706186 1000 . . gene_id "SS.2783"; transcript_id "SS.2783.1"; exon_number "1"; cov "342.697327"; +CM143130.1 StringTie transcript 1706440 1712382 1000 . . gene_id "SS.2784"; transcript_id "SS.2784.1"; cov "261.174491"; FPKM "12.772608"; TPM "27.312264"; +CM143130.1 StringTie exon 1706440 1712382 1000 . . gene_id "SS.2784"; transcript_id "SS.2784.1"; exon_number "1"; cov "261.174500"; +CM143130.1 StringTie transcript 1715188 1716415 1000 . . gene_id "SS.2785"; transcript_id "SS.2785.1"; cov "4180.947883"; FPKM "204.467163"; TPM "437.221692"; +CM143130.1 StringTie exon 1715188 1716415 1000 . . gene_id "SS.2785"; transcript_id "SS.2785.1"; exon_number "1"; cov "4180.947754"; +CM143130.1 StringTie transcript 1716804 1719344 1000 . . gene_id "SS.2786"; transcript_id "SS.2786.1"; cov "2244.829201"; FPKM "109.782248"; TPM "234.752513"; +CM143130.1 StringTie exon 1716804 1719344 1000 . . gene_id "SS.2786"; transcript_id "SS.2786.1"; exon_number "1"; cov "2244.829102"; +CM143130.1 StringTie transcript 1721619 1724002 1000 . . gene_id "SS.2787"; transcript_id "SS.2787.1"; cov "358.456376"; FPKM "17.530130"; TPM "37.485496"; +CM143130.1 StringTie exon 1721619 1724002 1000 . . gene_id "SS.2787"; transcript_id "SS.2787.1"; exon_number "1"; cov "358.456390"; +CM143130.1 StringTie transcript 1724980 1726199 1000 . . gene_id "SS.2788"; transcript_id "SS.2788.1"; cov "12443.840984"; FPKM "608.559814"; TPM "1301.311894"; +CM143130.1 StringTie exon 1724980 1726199 1000 . . gene_id "SS.2788"; transcript_id "SS.2788.1"; exon_number "1"; cov "12443.840820"; +CM143130.1 StringTie transcript 1727043 1730488 1000 . . gene_id "SS.2789"; transcript_id "SS.2789.1"; cov "383.753337"; FPKM "18.767265"; TPM "40.130920"; +CM143130.1 StringTie exon 1727043 1730488 1000 . . gene_id "SS.2789"; transcript_id "SS.2789.1"; exon_number "1"; cov "383.753326"; +CM143130.1 StringTie transcript 1730900 1731677 1000 + . gene_id "SS.2790"; transcript_id "SS.2790.1"; cov "4542.387464"; FPKM "222.143185"; TPM "475.019155"; +CM143130.1 StringTie exon 1730900 1731043 1000 + . gene_id "SS.2790"; transcript_id "SS.2790.1"; exon_number "1"; cov "951.500000"; +CM143130.1 StringTie exon 1731120 1731677 1000 + . gene_id "SS.2790"; transcript_id "SS.2790.1"; exon_number "2"; cov "5469.067871"; +CM143130.1 StringTie transcript 1736461 1736990 1000 . . gene_id "SS.2791"; transcript_id "SS.2791.1"; cov "12.822642"; FPKM "0.627085"; TPM "1.340925"; +CM143130.1 StringTie exon 1736461 1736990 1000 . . gene_id "SS.2791"; transcript_id "SS.2791.1"; exon_number "1"; cov "12.822641"; +CM143130.1 StringTie transcript 1737288 1739862 1000 . . gene_id "SS.2792"; transcript_id "SS.2792.1"; cov "128.347961"; FPKM "6.276793"; TPM "13.421959"; +CM143130.1 StringTie exon 1737288 1739862 1000 . . gene_id "SS.2792"; transcript_id "SS.2792.1"; exon_number "1"; cov "128.347961"; +CM143130.1 StringTie transcript 1740685 1743172 1000 . . gene_id "SS.2793"; transcript_id "SS.2793.1"; cov "269.390273"; FPKM "13.174396"; TPM "28.171428"; +CM143130.1 StringTie exon 1740685 1743172 1000 . . gene_id "SS.2793"; transcript_id "SS.2793.1"; exon_number "1"; cov "269.390259"; +CM143130.1 StringTie transcript 1743529 1744233 1000 . . gene_id "SS.2794"; transcript_id "SS.2794.1"; cov "23999.906383"; FPKM "1173.703407"; TPM "2509.784855"; +CM143130.1 StringTie exon 1743529 1744233 1000 . . gene_id "SS.2794"; transcript_id "SS.2794.1"; exon_number "1"; cov "23999.906250"; +CM143130.1 StringTie transcript 1744707 1745355 1000 . . gene_id "SS.2795"; transcript_id "SS.2795.1"; cov "2900.995378"; FPKM "141.871727"; TPM "303.370944"; +CM143130.1 StringTie exon 1744707 1745355 1000 . . gene_id "SS.2795"; transcript_id "SS.2795.1"; exon_number "1"; cov "2900.995361"; +CM143130.1 StringTie transcript 1745569 1748827 1000 . . gene_id "SS.2796"; transcript_id "SS.2796.1"; cov "493.795643"; FPKM "24.148829"; TPM "51.638569"; +CM143130.1 StringTie exon 1745569 1748827 1000 . . gene_id "SS.2796"; transcript_id "SS.2796.1"; exon_number "1"; cov "493.795654"; +CM143130.1 StringTie transcript 1749657 1755101 1000 . . gene_id "SS.2797"; transcript_id "SS.2797.1"; cov "2070.963085"; FPKM "101.279413"; TPM "216.570502"; +CM143130.1 StringTie exon 1749657 1755101 1000 . . gene_id "SS.2797"; transcript_id "SS.2797.1"; exon_number "1"; cov "2070.963135"; +CM143130.1 StringTie transcript 1755464 1757392 1000 . . gene_id "SS.2798"; transcript_id "SS.2798.1"; cov "412.289787"; FPKM "20.162826"; TPM "43.115112"; +CM143130.1 StringTie exon 1755464 1757392 1000 . . gene_id "SS.2798"; transcript_id "SS.2798.1"; exon_number "1"; cov "412.289795"; +CM143130.1 StringTie transcript 1762448 1763806 1000 . . gene_id "SS.2799"; transcript_id "SS.2799.1"; cov "442.852097"; FPKM "21.657460"; TPM "46.311159"; +CM143130.1 StringTie exon 1762448 1763806 1000 . . gene_id "SS.2799"; transcript_id "SS.2799.1"; exon_number "1"; cov "442.852112"; +CM143130.1 StringTie transcript 1766595 1769659 1000 - . gene_id "SS.2800"; transcript_id "SS.2800.1"; cov "1097.889904"; FPKM "53.691756"; TPM "114.811592"; +CM143130.1 StringTie exon 1766595 1767787 1000 - . gene_id "SS.2800"; transcript_id "SS.2800.1"; exon_number "1"; cov "1967.523071"; +CM143130.1 StringTie exon 1767857 1768069 1000 - . gene_id "SS.2800"; transcript_id "SS.2800.1"; exon_number "2"; cov "667.661194"; +CM143130.1 StringTie exon 1768142 1769659 1000 - . gene_id "SS.2800"; transcript_id "SS.2800.1"; exon_number "3"; cov "474.811096"; +CM143130.1 StringTie transcript 1766595 1769659 1000 - . gene_id "SS.2800"; transcript_id "SS.2800.2"; cov "113.597479"; FPKM "5.555428"; TPM "11.879431"; +CM143130.1 StringTie exon 1766595 1767787 1000 - . gene_id "SS.2800"; transcript_id "SS.2800.2"; exon_number "1"; cov "204.361374"; +CM143130.1 StringTie exon 1767857 1769659 1000 - . gene_id "SS.2800"; transcript_id "SS.2800.2"; exon_number "2"; cov "53.541275"; +CM143130.1 StringTie transcript 1770008 1771086 1000 . . gene_id "SS.2801"; transcript_id "SS.2801.1"; cov "587.683040"; FPKM "28.740345"; TPM "61.456823"; +CM143130.1 StringTie exon 1770008 1771086 1000 . . gene_id "SS.2801"; transcript_id "SS.2801.1"; exon_number "1"; cov "587.683044"; +CM143130.1 StringTie transcript 1771376 1772750 1000 . . gene_id "SS.2802"; transcript_id "SS.2802.1"; cov "8418.418909"; FPKM "411.698562"; TPM "880.354279"; +CM143130.1 StringTie exon 1771376 1772750 1000 . . gene_id "SS.2802"; transcript_id "SS.2802.1"; exon_number "1"; cov "8418.418945"; +CM143130.1 StringTie transcript 1773257 1778748 1000 . . gene_id "SS.2803"; transcript_id "SS.2803.1"; cov "1141.888565"; FPKM "55.843489"; TPM "119.412742"; +CM143130.1 StringTie exon 1773257 1778748 1000 . . gene_id "SS.2803"; transcript_id "SS.2803.1"; exon_number "1"; cov "1141.888550"; +CM143130.1 StringTie transcript 1781783 1782518 1000 . . gene_id "SS.2804"; transcript_id "SS.2804.1"; cov "16365.139946"; FPKM "800.328977"; TPM "1711.380858"; +CM143130.1 StringTie exon 1781783 1782518 1000 . . gene_id "SS.2804"; transcript_id "SS.2804.1"; exon_number "1"; cov "16365.139648"; +CM143130.1 StringTie transcript 1783774 1785880 1000 + . gene_id "SS.2805"; transcript_id "SS.2805.1"; cov "5456.311553"; FPKM "266.838185"; TPM "570.592563"; +CM143130.1 StringTie exon 1783774 1783875 1000 + . gene_id "SS.2805"; transcript_id "SS.2805.1"; exon_number "1"; cov "3488.754883"; +CM143130.1 StringTie exon 1784070 1785880 1000 + . gene_id "SS.2805"; transcript_id "SS.2805.1"; exon_number "2"; cov "5567.129395"; +CM143130.1 StringTie transcript 1786166 1790501 1000 . . gene_id "SS.2806"; transcript_id "SS.2806.1"; cov "823.556734"; FPKM "40.275630"; TPM "86.123262"; +CM143130.1 StringTie exon 1786166 1790501 1000 . . gene_id "SS.2806"; transcript_id "SS.2806.1"; exon_number "1"; cov "823.556763"; +CM143130.1 StringTie transcript 1790820 1792389 1000 - . gene_id "SS.2807"; transcript_id "SS.2807.1"; cov "4880.518113"; FPKM "238.679295"; TPM "510.379093"; +CM143130.1 StringTie exon 1790820 1792197 1000 - . gene_id "SS.2807"; transcript_id "SS.2807.1"; exon_number "1"; cov "5081.666016"; +CM143130.1 StringTie exon 1792305 1792389 1000 - . gene_id "SS.2807"; transcript_id "SS.2807.1"; exon_number "2"; cov "1619.552979"; +CM143130.1 StringTie transcript 1792832 1793698 1000 . . gene_id "SS.2808"; transcript_id "SS.2808.1"; cov "1562.575548"; FPKM "76.416975"; TPM "163.405989"; +CM143130.1 StringTie exon 1792832 1793698 1000 . . gene_id "SS.2808"; transcript_id "SS.2808.1"; exon_number "1"; cov "1562.575562"; +CM143130.1 StringTie transcript 1794504 1796190 1000 . . gene_id "SS.2809"; transcript_id "SS.2809.1"; cov "955.401304"; FPKM "46.723422"; TPM "99.910878"; +CM143130.1 StringTie exon 1794504 1796190 1000 . . gene_id "SS.2809"; transcript_id "SS.2809.1"; exon_number "1"; cov "955.401306"; +CM143130.1 StringTie transcript 1796512 1801624 1000 . . gene_id "SS.2810"; transcript_id "SS.2810.1"; cov "205.341874"; FPKM "10.042142"; TPM "21.473581"; +CM143130.1 StringTie exon 1796512 1801624 1000 . . gene_id "SS.2810"; transcript_id "SS.2810.1"; exon_number "1"; cov "205.341873"; +CM143130.1 StringTie transcript 1801951 1805207 1000 . . gene_id "SS.2811"; transcript_id "SS.2811.1"; cov "863.494627"; FPKM "42.228772"; TPM "90.299758"; +CM143130.1 StringTie exon 1801951 1805207 1000 . . gene_id "SS.2811"; transcript_id "SS.2811.1"; exon_number "1"; cov "863.494629"; +CM143130.1 StringTie transcript 1805547 1811612 1000 . . gene_id "SS.2812"; transcript_id "SS.2812.1"; cov "156.190529"; FPKM "7.638420"; TPM "16.333590"; +CM143130.1 StringTie exon 1805547 1811612 1000 . . gene_id "SS.2812"; transcript_id "SS.2812.1"; exon_number "1"; cov "156.190536"; +CM143130.1 StringTie transcript 1805547 1811612 1000 + . gene_id "SS.2813"; transcript_id "SS.2813.1"; cov "71.002205"; FPKM "3.472327"; TPM "7.425040"; +CM143130.1 StringTie exon 1805547 1805579 1000 + . gene_id "SS.2813"; transcript_id "SS.2813.1"; exon_number "1"; cov "7.070989"; +CM143130.1 StringTie exon 1805637 1811612 1000 + . gene_id "SS.2813"; transcript_id "SS.2813.1"; exon_number "2"; cov "71.355240"; +CM143130.1 StringTie transcript 1811957 1812842 1000 . . gene_id "SS.2814"; transcript_id "SS.2814.1"; cov "2557.284424"; FPKM "125.062715"; TPM "267.427448"; +CM143130.1 StringTie exon 1811957 1812842 1000 . . gene_id "SS.2814"; transcript_id "SS.2814.1"; exon_number "1"; cov "2557.284424"; +CM143130.1 StringTie transcript 1813231 1816610 1000 . . gene_id "SS.2815"; transcript_id "SS.2815.1"; cov "162.154364"; FPKM "7.930078"; TPM "16.957256"; +CM143130.1 StringTie exon 1813231 1816610 1000 . . gene_id "SS.2815"; transcript_id "SS.2815.1"; exon_number "1"; cov "162.154358"; +CM143130.1 StringTie transcript 1819434 1822610 1000 - . gene_id "SS.2816"; transcript_id "SS.2816.1"; cov "581.984140"; FPKM "28.461643"; TPM "60.860862"; +CM143130.1 StringTie exon 1819434 1819583 1000 - . gene_id "SS.2816"; transcript_id "SS.2816.1"; exon_number "1"; cov "148.398956"; +CM143130.1 StringTie exon 1822097 1822610 1000 - . gene_id "SS.2816"; transcript_id "SS.2816.1"; exon_number "2"; cov "708.516785"; +CM143130.1 StringTie transcript 1819434 1822610 1000 - . gene_id "SS.2816"; transcript_id "SS.2816.2"; cov "527.430182"; FPKM "25.793709"; TPM "55.155894"; +CM143130.1 StringTie exon 1819434 1819666 1000 - . gene_id "SS.2816"; transcript_id "SS.2816.2"; exon_number "1"; cov "322.657654"; +CM143130.1 StringTie exon 1822180 1822610 1000 - . gene_id "SS.2816"; transcript_id "SS.2816.2"; exon_number "2"; cov "638.130859"; +CM143130.1 StringTie transcript 1819434 1822610 1000 - . gene_id "SS.2816"; transcript_id "SS.2816.3"; cov "319.721060"; FPKM "15.635798"; TPM "33.434759"; +CM143130.1 StringTie exon 1819434 1819680 1000 - . gene_id "SS.2816"; transcript_id "SS.2816.3"; exon_number "1"; cov "226.625641"; +CM143130.1 StringTie exon 1822180 1822610 1000 - . gene_id "SS.2816"; transcript_id "SS.2816.3"; exon_number "2"; cov "373.072723"; +CM143130.1 StringTie transcript 1822839 1827220 1000 . . gene_id "SS.2817"; transcript_id "SS.2817.1"; cov "1413.540050"; FPKM "69.128469"; TPM "147.820635"; +CM143130.1 StringTie exon 1822839 1827220 1000 . . gene_id "SS.2817"; transcript_id "SS.2817.1"; exon_number "1"; cov "1413.540039"; +CM143130.1 StringTie transcript 1832417 1833815 1000 . . gene_id "SS.2818"; transcript_id "SS.2818.1"; cov "364.820608"; FPKM "17.841369"; TPM "38.151034"; +CM143130.1 StringTie exon 1832417 1833815 1000 . . gene_id "SS.2818"; transcript_id "SS.2818.1"; exon_number "1"; cov "364.820618"; +CM143130.1 StringTie transcript 1836179 1839047 1000 . . gene_id "SS.2819"; transcript_id "SS.2819.1"; cov "1597.749913"; FPKM "78.137160"; TPM "167.084341"; +CM143130.1 StringTie exon 1836179 1839047 1000 . . gene_id "SS.2819"; transcript_id "SS.2819.1"; exon_number "1"; cov "1597.749878"; +CM143130.1 StringTie transcript 1839611 1842771 1000 . . gene_id "SS.2820"; transcript_id "SS.2820.1"; cov "1005.740351"; FPKM "49.185228"; TPM "105.175073"; +CM143130.1 StringTie exon 1839611 1842771 1000 . . gene_id "SS.2820"; transcript_id "SS.2820.1"; exon_number "1"; cov "1005.740356"; +CM143130.1 StringTie transcript 1843040 1843977 1000 . . gene_id "SS.2821"; transcript_id "SS.2821.1"; cov "15.175906"; FPKM "0.742170"; TPM "1.587017"; +CM143130.1 StringTie exon 1843040 1843977 1000 . . gene_id "SS.2821"; transcript_id "SS.2821.1"; exon_number "1"; cov "15.175906"; +CM143130.1 StringTie transcript 1868596 1870076 1000 . . gene_id "SS.2822"; transcript_id "SS.2822.1"; cov "14.553005"; FPKM "0.711707"; TPM "1.521877"; +CM143130.1 StringTie exon 1868596 1870076 1000 . . gene_id "SS.2822"; transcript_id "SS.2822.1"; exon_number "1"; cov "14.553004"; +CM143130.1 StringTie transcript 1845643 1847050 1000 . . gene_id "SS.2823"; transcript_id "SS.2823.1"; cov "1738.505682"; FPKM "85.020750"; TPM "181.803844"; +CM143130.1 StringTie exon 1845643 1847050 1000 . . gene_id "SS.2823"; transcript_id "SS.2823.1"; exon_number "1"; cov "1738.505737"; +CM143130.1 StringTie transcript 1847456 1849342 1000 + . gene_id "SS.2824"; transcript_id "SS.2824.1"; cov "779.409245"; FPKM "38.116619"; TPM "81.506548"; +CM143130.1 StringTie exon 1847456 1847538 1000 + . gene_id "SS.2824"; transcript_id "SS.2824.1"; exon_number "1"; cov "145.144577"; +CM143130.1 StringTie exon 1847652 1849342 1000 + . gene_id "SS.2824"; transcript_id "SS.2824.1"; exon_number "2"; cov "810.541077"; +CM143130.1 StringTie transcript 1862032 1864761 1000 . . gene_id "SS.2825"; transcript_id "SS.2825.1"; cov "2508.321429"; FPKM "122.668204"; TPM "262.307154"; +CM143130.1 StringTie exon 1862032 1864761 1000 . . gene_id "SS.2825"; transcript_id "SS.2825.1"; exon_number "1"; cov "2508.321533"; +CM143130.1 StringTie transcript 1862032 1864761 1000 + . gene_id "SS.2826"; transcript_id "SS.2826.1"; cov "253.426189"; FPKM "12.393681"; TPM "26.501987"; +CM143130.1 StringTie exon 1862032 1862296 1000 + . gene_id "SS.2826"; transcript_id "SS.2826.1"; exon_number "1"; cov "107.885612"; +CM143130.1 StringTie exon 1863024 1864761 1000 + . gene_id "SS.2826"; transcript_id "SS.2826.1"; exon_number "2"; cov "275.617371"; +CM143130.1 StringTie transcript 1870434 1871096 1000 . . gene_id "SS.2827"; transcript_id "SS.2827.1"; cov "2882.656109"; FPKM "140.974854"; TPM "301.453119"; +CM143130.1 StringTie exon 1870434 1871096 1000 . . gene_id "SS.2827"; transcript_id "SS.2827.1"; exon_number "1"; cov "2882.656006"; +CM143130.1 StringTie transcript 1872750 1874195 1000 . . gene_id "SS.2828"; transcript_id "SS.2828.1"; cov "1418.299447"; FPKM "69.361224"; TPM "148.318348"; +CM143130.1 StringTie exon 1872750 1874195 1000 . . gene_id "SS.2828"; transcript_id "SS.2828.1"; exon_number "1"; cov "1418.299438"; +CM143130.1 StringTie transcript 1874802 1877349 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.1"; cov "308.601244"; FPKM "15.091989"; TPM "32.271906"; +CM143130.1 StringTie exon 1874802 1875849 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.1"; exon_number "1"; cov "326.215973"; +CM143130.1 StringTie exon 1876086 1876163 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.1"; exon_number "2"; cov "353.224976"; +CM143130.1 StringTie exon 1876613 1876664 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.1"; exon_number "3"; cov "310.599304"; +CM143130.1 StringTie exon 1877244 1877349 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.1"; exon_number "4"; cov "100.631523"; +CM143130.1 StringTie transcript 1874802 1877349 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.2"; cov "122.836844"; FPKM "6.007274"; TPM "12.845636"; +CM143130.1 StringTie exon 1874802 1875849 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.2"; exon_number "1"; cov "128.441574"; +CM143130.1 StringTie exon 1876086 1876388 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.2"; exon_number "2"; cov "132.656418"; +CM143130.1 StringTie exon 1876613 1876664 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.2"; exon_number "3"; cov "122.292793"; +CM143130.1 StringTie exon 1877244 1877349 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.2"; exon_number "4"; cov "39.621822"; +CM143130.1 StringTie transcript 1874802 1877349 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.3"; cov "114.071106"; FPKM "5.578590"; TPM "11.928960"; +CM143130.1 StringTie exon 1874802 1876388 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.3"; exon_number "1"; cov "123.267715"; +CM143130.1 StringTie exon 1876613 1877349 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.3"; exon_number "2"; cov "94.267830"; +CM143130.1 StringTie transcript 1874802 1877349 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.4"; cov "81.524041"; FPKM "3.986892"; TPM "8.525358"; +CM143130.1 StringTie exon 1874802 1876388 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.4"; exon_number "1"; cov "85.270805"; +CM143130.1 StringTie exon 1876613 1876969 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.4"; exon_number "2"; cov "81.357819"; +CM143130.1 StringTie exon 1877245 1877349 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.4"; exon_number "3"; cov "25.459538"; +CM143130.1 StringTie transcript 1874802 1877349 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.5"; cov "68.694472"; FPKM "3.359469"; TPM "7.183709"; +CM143130.1 StringTie exon 1874802 1876163 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.5"; exon_number "1"; cov "72.285126"; +CM143130.1 StringTie exon 1876613 1876969 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.5"; exon_number "2"; cov "68.861938"; +CM143130.1 StringTie exon 1877245 1877349 1000 - . gene_id "SS.2829"; transcript_id "SS.2829.5"; exon_number "3"; cov "21.549166"; +CM143130.1 StringTie transcript 1877905 1881958 1000 . . gene_id "SS.2830"; transcript_id "SS.2830.1"; cov "446.985940"; FPKM "21.859624"; TPM "46.743455"; +CM143130.1 StringTie exon 1877905 1881958 1000 . . gene_id "SS.2830"; transcript_id "SS.2830.1"; exon_number "1"; cov "446.985931"; +CM143130.1 StringTie transcript 1883845 1885608 1000 . . gene_id "SS.2831"; transcript_id "SS.2831.1"; cov "401.083900"; FPKM "19.614807"; TPM "41.943259"; +CM143130.1 StringTie exon 1883845 1885608 1000 . . gene_id "SS.2831"; transcript_id "SS.2831.1"; exon_number "1"; cov "401.083893"; +CM143130.1 StringTie transcript 1906088 1909072 1000 . . gene_id "SS.2832"; transcript_id "SS.2832.1"; cov "167.173199"; FPKM "8.175522"; TPM "17.482100"; +CM143130.1 StringTie exon 1906088 1909072 1000 . . gene_id "SS.2832"; transcript_id "SS.2832.1"; exon_number "1"; cov "167.173203"; +CM143130.1 StringTie transcript 1886014 1895340 1000 . . gene_id "SS.2833"; transcript_id "SS.2833.1"; cov "569.207462"; FPKM "27.836806"; TPM "59.524743"; +CM143130.1 StringTie exon 1886014 1895340 1000 . . gene_id "SS.2833"; transcript_id "SS.2833.1"; exon_number "1"; cov "569.207458"; +CM143130.1 StringTie transcript 1895684 1896466 1000 . . gene_id "SS.2834"; transcript_id "SS.2834.1"; cov "2357.190294"; FPKM "115.277211"; TPM "246.502649"; +CM143130.1 StringTie exon 1895684 1896466 1000 . . gene_id "SS.2834"; transcript_id "SS.2834.1"; exon_number "1"; cov "2357.190186"; +CM143130.1 StringTie transcript 1899285 1902089 1000 . . gene_id "SS.2835"; transcript_id "SS.2835.1"; cov "470.616756"; FPKM "23.015277"; TPM "49.214642"; +CM143130.1 StringTie exon 1899285 1902089 1000 . . gene_id "SS.2835"; transcript_id "SS.2835.1"; exon_number "1"; cov "470.616760"; +CM143130.1 StringTie transcript 1902870 1905742 1000 . . gene_id "SS.2836"; transcript_id "SS.2836.1"; cov "645.435781"; FPKM "31.564714"; TPM "67.496303"; +CM143130.1 StringTie exon 1902870 1905742 1000 . . gene_id "SS.2836"; transcript_id "SS.2836.1"; exon_number "1"; cov "645.435791"; +CM143130.1 StringTie transcript 1910824 1913917 1000 . . gene_id "SS.2837"; transcript_id "SS.2837.1"; cov "537.984163"; FPKM "26.309846"; TPM "56.259574"; +CM143130.1 StringTie exon 1910824 1913917 1000 . . gene_id "SS.2837"; transcript_id "SS.2837.1"; exon_number "1"; cov "537.984192"; +CM143130.1 StringTie transcript 1914123 1916447 1000 . . gene_id "SS.2838"; transcript_id "SS.2838.1"; cov "978.388387"; FPKM "47.847594"; TPM "102.314747"; +CM143130.1 StringTie exon 1914123 1916447 1000 . . gene_id "SS.2838"; transcript_id "SS.2838.1"; exon_number "1"; cov "978.388367"; +CM143130.1 StringTie transcript 1916753 1918002 1000 . . gene_id "SS.2839"; transcript_id "SS.2839.1"; cov "589.630400"; FPKM "28.835580"; TPM "61.660468"; +CM143130.1 StringTie exon 1916753 1918002 1000 . . gene_id "SS.2839"; transcript_id "SS.2839.1"; exon_number "1"; cov "589.630371"; +CM143130.1 StringTie transcript 1918473 1922198 1000 . . gene_id "SS.2840"; transcript_id "SS.2840.1"; cov "475.830918"; FPKM "23.270273"; TPM "49.759912"; +CM143130.1 StringTie exon 1918473 1922198 1000 . . gene_id "SS.2840"; transcript_id "SS.2840.1"; exon_number "1"; cov "475.830933"; +CM143130.1 StringTie transcript 1925480 1927799 1000 . . gene_id "SS.2841"; transcript_id "SS.2841.1"; cov "12418.681034"; FPKM "607.329379"; TPM "1298.680798"; +CM143130.1 StringTie exon 1925480 1927799 1000 . . gene_id "SS.2841"; transcript_id "SS.2841.1"; exon_number "1"; cov "12418.680664"; +CM143130.1 StringTie transcript 1928172 1931547 1000 . . gene_id "SS.2842"; transcript_id "SS.2842.1"; cov "296.674171"; FPKM "14.508702"; TPM "31.024635"; +CM143130.1 StringTie exon 1928172 1931547 1000 . . gene_id "SS.2842"; transcript_id "SS.2842.1"; exon_number "1"; cov "296.674164"; +CM143130.1 StringTie transcript 1931826 1933884 1000 . . gene_id "SS.2843"; transcript_id "SS.2843.1"; cov "212.904322"; FPKM "10.411979"; TPM "22.264422"; +CM143130.1 StringTie exon 1931826 1933884 1000 . . gene_id "SS.2843"; transcript_id "SS.2843.1"; exon_number "1"; cov "212.904327"; +CM143130.1 StringTie transcript 1934220 1938826 1000 - . gene_id "SS.2844"; transcript_id "SS.2844.1"; cov "864.016097"; FPKM "42.254275"; TPM "90.354291"; +CM143130.1 StringTie exon 1934220 1938579 1000 - . gene_id "SS.2844"; transcript_id "SS.2844.1"; exon_number "1"; cov "831.298401"; +CM143130.1 StringTie exon 1938652 1938826 1000 - . gene_id "SS.2844"; transcript_id "SS.2844.1"; exon_number "2"; cov "1679.154297"; +CM143130.1 StringTie transcript 1942829 1944712 1000 . . gene_id "SS.2845"; transcript_id "SS.2845.1"; cov "2927.059979"; FPKM "143.146403"; TPM "306.096644"; +CM143130.1 StringTie exon 1942829 1944712 1000 . . gene_id "SS.2845"; transcript_id "SS.2845.1"; exon_number "1"; cov "2927.060059"; +CM143130.1 StringTie transcript 1946036 1949625 1000 . . gene_id "SS.2846"; transcript_id "SS.2846.1"; cov "1075.542061"; FPKM "52.598846"; TPM "112.474571"; +CM143130.1 StringTie exon 1946036 1949625 1000 . . gene_id "SS.2846"; transcript_id "SS.2846.1"; exon_number "1"; cov "1075.542114"; +CM143130.1 StringTie transcript 1951048 1961475 1000 . . gene_id "SS.2847"; transcript_id "SS.2847.1"; cov "983.338416"; FPKM "48.089673"; TPM "102.832395"; +CM143130.1 StringTie exon 1951048 1961475 1000 . . gene_id "SS.2847"; transcript_id "SS.2847.1"; exon_number "1"; cov "983.338440"; +CM143130.1 StringTie transcript 1961724 1962961 1000 . . gene_id "SS.2848"; transcript_id "SS.2848.1"; cov "1001.814216"; FPKM "48.993223"; TPM "104.764498"; +CM143130.1 StringTie exon 1961724 1962961 1000 . . gene_id "SS.2848"; transcript_id "SS.2848.1"; exon_number "1"; cov "1001.814209"; +CM143130.1 StringTie transcript 1970231 1972244 1000 - . gene_id "SS.2849"; transcript_id "SS.2849.1"; cov "2591.778802"; FPKM "126.749645"; TPM "271.034690"; +CM143130.1 StringTie exon 1970231 1972133 1000 - . gene_id "SS.2849"; transcript_id "SS.2849.1"; exon_number "1"; cov "2640.165527"; +CM143130.1 StringTie exon 1972195 1972244 1000 - . gene_id "SS.2849"; transcript_id "SS.2849.1"; exon_number "2"; cov "750.179993"; +CM143130.1 StringTie transcript 1973135 1973603 1000 . . gene_id "SS.2850"; transcript_id "SS.2850.1"; cov "50110.550107"; FPKM "2450.631368"; TPM "5240.299596"; +CM143130.1 StringTie exon 1973135 1973603 1000 . . gene_id "SS.2850"; transcript_id "SS.2850.1"; exon_number "1"; cov "50110.550781"; +CM143130.1 StringTie transcript 1974579 1975192 1000 . . gene_id "SS.2851"; transcript_id "SS.2851.1"; cov "14.469055"; FPKM "0.707602"; TPM "1.513098"; +CM143130.1 StringTie exon 1974579 1975192 1000 . . gene_id "SS.2851"; transcript_id "SS.2851.1"; exon_number "1"; cov "14.469055"; +CM143130.1 StringTie transcript 1981064 1985626 1000 . . gene_id "SS.2852"; transcript_id "SS.2852.1"; cov "167.115933"; FPKM "8.172721"; TPM "17.476111"; +CM143130.1 StringTie exon 1981064 1985626 1000 . . gene_id "SS.2852"; transcript_id "SS.2852.1"; exon_number "1"; cov "167.115936"; +CM143130.1 StringTie transcript 1985902 1988571 1000 . . gene_id "SS.2853"; transcript_id "SS.2853.1"; cov "30.554307"; FPKM "1.494243"; TPM "3.195210"; +CM143130.1 StringTie exon 1985902 1988571 1000 . . gene_id "SS.2853"; transcript_id "SS.2853.1"; exon_number "1"; cov "30.554308"; +CM143130.1 StringTie transcript 1976751 1977693 1000 + . gene_id "SS.2854"; transcript_id "SS.2854.1"; cov "185.975535"; FPKM "9.095040"; TPM "19.448350"; +CM143130.1 StringTie exon 1976751 1976894 1000 + . gene_id "SS.2854"; transcript_id "SS.2854.1"; exon_number "1"; cov "91.527779"; +CM143130.1 StringTie exon 1977184 1977693 1000 + . gene_id "SS.2854"; transcript_id "SS.2854.1"; exon_number "2"; cov "212.643143"; +CM143130.1 StringTie transcript 1978796 1980181 1000 - . gene_id "SS.2855"; transcript_id "SS.2855.1"; cov "19804.599717"; FPKM "968.534035"; TPM "2071.061596"; +CM143130.1 StringTie exon 1978796 1979305 1000 - . gene_id "SS.2855"; transcript_id "SS.2855.1"; exon_number "1"; cov "26674.330078"; +CM143130.1 StringTie exon 1979985 1980181 1000 - . gene_id "SS.2855"; transcript_id "SS.2855.1"; exon_number "2"; cov "2020.020264"; +CM143130.1 StringTie transcript 1989265 1995521 1000 . . gene_id "SS.2856"; transcript_id "SS.2856.1"; cov "532.918331"; FPKM "26.062104"; TPM "55.729816"; +CM143130.1 StringTie exon 1989265 1995521 1000 . . gene_id "SS.2856"; transcript_id "SS.2856.1"; exon_number "1"; cov "532.918335"; +CM143130.1 StringTie transcript 1995800 2000030 1000 + . gene_id "SS.2857"; transcript_id "SS.2857.1"; cov "266.986545"; FPKM "13.056843"; TPM "27.920058"; +CM143130.1 StringTie exon 1995800 1995854 1000 + . gene_id "SS.2857"; transcript_id "SS.2857.1"; exon_number "1"; cov "411.927277"; +CM143130.1 StringTie exon 1995924 2000030 1000 + . gene_id "SS.2857"; transcript_id "SS.2857.1"; exon_number "2"; cov "265.045532"; +CM143130.1 StringTie transcript 2003731 2005681 1000 . . gene_id "SS.2858"; transcript_id "SS.2858.1"; cov "1849.534085"; FPKM "90.450539"; TPM "193.414614"; +CM143130.1 StringTie exon 2003731 2005681 1000 . . gene_id "SS.2858"; transcript_id "SS.2858.1"; exon_number "1"; cov "1849.534058"; +CM143130.1 StringTie transcript 2006064 2009117 1000 . . gene_id "SS.2859"; transcript_id "SS.2859.1"; cov "357.965619"; FPKM "17.506129"; TPM "37.434175"; +CM143130.1 StringTie exon 2006064 2009117 1000 . . gene_id "SS.2859"; transcript_id "SS.2859.1"; exon_number "1"; cov "357.965607"; +CM143130.1 StringTie transcript 2009408 2011680 1000 . . gene_id "SS.2860"; transcript_id "SS.2860.1"; cov "356.573691"; FPKM "17.438058"; TPM "37.288614"; +CM143130.1 StringTie exon 2009408 2011680 1000 . . gene_id "SS.2860"; transcript_id "SS.2860.1"; exon_number "1"; cov "356.573700"; +CM143130.1 StringTie transcript 2011999 2012630 1000 + . gene_id "SS.2861"; transcript_id "SS.2861.1"; cov "504.183124"; FPKM "24.656823"; TPM "52.724838"; +CM143130.1 StringTie exon 2011999 2012127 1000 + . gene_id "SS.2861"; transcript_id "SS.2861.1"; exon_number "1"; cov "169.310074"; +CM143130.1 StringTie exon 2012203 2012630 1000 + . gene_id "SS.2861"; transcript_id "SS.2861.1"; exon_number "2"; cov "605.114502"; +CM143130.1 StringTie transcript 2013091 2013860 1000 - . gene_id "SS.2862"; transcript_id "SS.2862.1"; cov "13775.857658"; FPKM "673.701423"; TPM "1440.607241"; +CM143130.1 StringTie exon 2013091 2013518 1000 - . gene_id "SS.2862"; transcript_id "SS.2862.1"; exon_number "1"; cov "16374.724609"; +CM143130.1 StringTie exon 2013734 2013860 1000 - . gene_id "SS.2862"; transcript_id "SS.2862.1"; exon_number "2"; cov "5017.472656"; +CM143130.1 StringTie transcript 2016561 2017128 1000 . . gene_id "SS.2863"; transcript_id "SS.2863.1"; cov "1209.635563"; FPKM "59.156622"; TPM "126.497369"; +CM143130.1 StringTie exon 2016561 2017128 1000 . . gene_id "SS.2863"; transcript_id "SS.2863.1"; exon_number "1"; cov "1209.635620"; +CM143130.1 StringTie transcript 2017416 2021663 1000 . . gene_id "SS.2864"; transcript_id "SS.2864.1"; cov "467.215866"; FPKM "22.848958"; TPM "48.858995"; +CM143130.1 StringTie exon 2017416 2021663 1000 . . gene_id "SS.2864"; transcript_id "SS.2864.1"; exon_number "1"; cov "467.215881"; +CM143130.1 StringTie transcript 2022829 2028567 1000 . . gene_id "SS.2865"; transcript_id "SS.2865.1"; cov "702.597491"; FPKM "34.360179"; TPM "73.473976"; +CM143130.1 StringTie exon 2022829 2028567 1000 . . gene_id "SS.2865"; transcript_id "SS.2865.1"; exon_number "1"; cov "702.597473"; +CM143130.1 StringTie transcript 2028769 2030696 1000 . . gene_id "SS.2866"; transcript_id "SS.2866.1"; cov "931.524896"; FPKM "45.555759"; TPM "97.414008"; +CM143130.1 StringTie exon 2028769 2030696 1000 . . gene_id "SS.2866"; transcript_id "SS.2866.1"; exon_number "1"; cov "931.524902"; +CM143130.1 StringTie transcript 2031053 2033965 1000 . . gene_id "SS.2867"; transcript_id "SS.2867.1"; cov "446.162719"; FPKM "21.819364"; TPM "46.657367"; +CM143130.1 StringTie exon 2031053 2033965 1000 . . gene_id "SS.2867"; transcript_id "SS.2867.1"; exon_number "1"; cov "446.162720"; +CM143130.1 StringTie transcript 2034170 2036025 1000 . . gene_id "SS.2868"; transcript_id "SS.2868.1"; cov "942.049569"; FPKM "46.070463"; TPM "98.514623"; +CM143130.1 StringTie exon 2034170 2036025 1000 . . gene_id "SS.2868"; transcript_id "SS.2868.1"; exon_number "1"; cov "942.049561"; +CM143130.1 StringTie transcript 2036256 2045601 1000 . . gene_id "SS.2869"; transcript_id "SS.2869.1"; cov "394.323347"; FPKM "19.284186"; TPM "41.236276"; +CM143130.1 StringTie exon 2036256 2045601 1000 . . gene_id "SS.2869"; transcript_id "SS.2869.1"; exon_number "1"; cov "394.323334"; +CM143130.1 StringTie transcript 2046087 2050324 1000 . . gene_id "SS.2870"; transcript_id "SS.2870.1"; cov "222.175319"; FPKM "10.865373"; TPM "23.233934"; +CM143130.1 StringTie exon 2046087 2050324 1000 . . gene_id "SS.2870"; transcript_id "SS.2870.1"; exon_number "1"; cov "222.175323"; +CM143130.1 StringTie transcript 2050604 2052465 1000 . . gene_id "SS.2871"; transcript_id "SS.2871.1"; cov "236.580021"; FPKM "11.569827"; TPM "24.740303"; +CM143130.1 StringTie exon 2050604 2052465 1000 . . gene_id "SS.2871"; transcript_id "SS.2871.1"; exon_number "1"; cov "236.580017"; +CM143130.1 StringTie transcript 2052804 2054201 1000 . . gene_id "SS.2872"; transcript_id "SS.2872.1"; cov "230.545780"; FPKM "11.274726"; TPM "24.109273"; +CM143130.1 StringTie exon 2052804 2054201 1000 . . gene_id "SS.2872"; transcript_id "SS.2872.1"; exon_number "1"; cov "230.545776"; +CM143130.1 StringTie transcript 2054631 2056276 1000 . . gene_id "SS.2873"; transcript_id "SS.2873.1"; cov "2243.055893"; FPKM "109.695526"; TPM "234.567069"; +CM143130.1 StringTie exon 2054631 2056276 1000 . . gene_id "SS.2873"; transcript_id "SS.2873.1"; exon_number "1"; cov "2243.055908"; +CM143130.1 StringTie transcript 2057297 2058687 1000 . . gene_id "SS.2874"; transcript_id "SS.2874.1"; cov "300.734004"; FPKM "14.707246"; TPM "31.449191"; +CM143130.1 StringTie exon 2057297 2058687 1000 . . gene_id "SS.2874"; transcript_id "SS.2874.1"; exon_number "1"; cov "300.734009"; +CM143130.1 StringTie transcript 2059054 2065544 1000 . . gene_id "SS.2875"; transcript_id "SS.2875.1"; cov "517.067786"; FPKM "25.286941"; TPM "54.072248"; +CM143130.1 StringTie exon 2059054 2065544 1000 . . gene_id "SS.2875"; transcript_id "SS.2875.1"; exon_number "1"; cov "517.067810"; +CM143130.1 StringTie transcript 2080341 2081905 1000 . . gene_id "SS.2876"; transcript_id "SS.2876.1"; cov "399.106709"; FPKM "19.518114"; TPM "41.736495"; +CM143130.1 StringTie exon 2080341 2081905 1000 . . gene_id "SS.2876"; transcript_id "SS.2876.1"; exon_number "1"; cov "399.106720"; +CM143130.1 StringTie transcript 2082228 2082538 1000 . . gene_id "SS.2877"; transcript_id "SS.2877.1"; cov "5.305466"; FPKM "0.259461"; TPM "0.554818"; +CM143130.1 StringTie exon 2082228 2082538 1000 . . gene_id "SS.2877"; transcript_id "SS.2877.1"; exon_number "1"; cov "5.305466"; +CM143130.1 StringTie transcript 2082770 2083896 1000 . . gene_id "SS.2878"; transcript_id "SS.2878.1"; cov "35.785271"; FPKM "1.750061"; TPM "3.742237"; +CM143130.1 StringTie exon 2082770 2083896 1000 . . gene_id "SS.2878"; transcript_id "SS.2878.1"; exon_number "1"; cov "35.785271"; +CM143130.1 StringTie transcript 2084174 2084727 1000 . . gene_id "SS.2879"; transcript_id "SS.2879.1"; cov "6.684116"; FPKM "0.326883"; TPM "0.698990"; +CM143130.1 StringTie exon 2084174 2084727 1000 . . gene_id "SS.2879"; transcript_id "SS.2879.1"; exon_number "1"; cov "6.684115"; +CM143130.1 StringTie transcript 2065993 2067090 1000 + . gene_id "SS.2880"; transcript_id "SS.2880.1"; cov "17285.554031"; FPKM "845.341367"; TPM "1807.632956"; +CM143130.1 StringTie exon 2065993 2066097 1000 + . gene_id "SS.2880"; transcript_id "SS.2880.1"; exon_number "1"; cov "1253.171387"; +CM143130.1 StringTie exon 2066613 2067090 1000 + . gene_id "SS.2880"; transcript_id "SS.2880.1"; exon_number "2"; cov "20807.312500"; +CM143130.1 StringTie transcript 2071066 2073635 1000 . . gene_id "SS.2881"; transcript_id "SS.2881.1"; cov "525.722179"; FPKM "25.710180"; TPM "54.977280"; +CM143130.1 StringTie exon 2071066 2073635 1000 . . gene_id "SS.2881"; transcript_id "SS.2881.1"; exon_number "1"; cov "525.722168"; +CM143130.1 StringTie transcript 2073938 2074848 1000 - . gene_id "SS.2882"; transcript_id "SS.2882.1"; cov "442.437267"; FPKM "21.637173"; TPM "46.267778"; +CM143130.1 StringTie exon 2073938 2074627 1000 - . gene_id "SS.2882"; transcript_id "SS.2882.1"; exon_number "1"; cov "487.521729"; +CM143130.1 StringTie exon 2074734 2074848 1000 - . gene_id "SS.2882"; transcript_id "SS.2882.1"; exon_number "2"; cov "171.930435"; +CM143130.1 StringTie transcript 2076833 2077441 1000 + . gene_id "SS.2883"; transcript_id "SS.2883.1"; cov "1934.371324"; FPKM "94.599461"; TPM "202.286450"; +CM143130.1 StringTie exon 2076833 2077078 1000 + . gene_id "SS.2883"; transcript_id "SS.2883.1"; exon_number "1"; cov "1731.975586"; +CM143130.1 StringTie exon 2077144 2077441 1000 + . gene_id "SS.2883"; transcript_id "SS.2883.1"; exon_number "2"; cov "2101.449707"; +CM143130.1 StringTie transcript 2077900 2078512 1000 - . gene_id "SS.2884"; transcript_id "SS.2884.1"; cov "2402.871324"; FPKM "117.511219"; TPM "251.279733"; +CM143130.1 StringTie exon 2077900 2078197 1000 - . gene_id "SS.2884"; transcript_id "SS.2884.1"; exon_number "1"; cov "2990.348877"; +CM143130.1 StringTie exon 2078267 2078512 1000 - . gene_id "SS.2884"; transcript_id "SS.2884.1"; exon_number "2"; cov "1691.211426"; +CM143130.1 StringTie transcript 2129712 2130051 1000 . . gene_id "SS.2885"; transcript_id "SS.2885.1"; cov "5.361765"; FPKM "0.262214"; TPM "0.560705"; +CM143130.1 StringTie exon 2129712 2130051 1000 . . gene_id "SS.2885"; transcript_id "SS.2885.1"; exon_number "1"; cov "5.361765"; +CM143130.1 StringTie transcript 2087013 2088499 1000 . . gene_id "SS.2886"; transcript_id "SS.2886.1"; cov "1270.261601"; FPKM "62.121508"; TPM "132.837323"; +CM143130.1 StringTie exon 2087013 2088499 1000 . . gene_id "SS.2886"; transcript_id "SS.2886.1"; exon_number "1"; cov "1270.261597"; +CM143130.1 StringTie transcript 2090411 2092269 1000 . . gene_id "SS.2887"; transcript_id "SS.2887.1"; cov "1978.461538"; FPKM "96.755671"; TPM "206.897174"; +CM143130.1 StringTie exon 2090411 2092269 1000 . . gene_id "SS.2887"; transcript_id "SS.2887.1"; exon_number "1"; cov "1978.461548"; +CM143130.1 StringTie transcript 2092785 2097372 1000 . . gene_id "SS.2888"; transcript_id "SS.2888.1"; cov "983.193548"; FPKM "48.082588"; TPM "102.817246"; +CM143130.1 StringTie exon 2092785 2097372 1000 . . gene_id "SS.2888"; transcript_id "SS.2888.1"; exon_number "1"; cov "983.193542"; +CM143130.1 StringTie transcript 2097849 2098513 1000 . . gene_id "SS.2889"; transcript_id "SS.2889.1"; cov "828.096241"; FPKM "40.497632"; TPM "86.597980"; +CM143130.1 StringTie exon 2097849 2098513 1000 . . gene_id "SS.2889"; transcript_id "SS.2889.1"; exon_number "1"; cov "828.096252"; +CM143130.1 StringTie transcript 2098747 2099853 1000 - . gene_id "SS.2890"; transcript_id "SS.2890.1"; cov "2549.470219"; FPKM "124.680565"; TPM "266.610279"; +CM143130.1 StringTie exon 2098747 2099543 1000 - . gene_id "SS.2890"; transcript_id "SS.2890.1"; exon_number "1"; cov "2805.545898"; +CM143130.1 StringTie exon 2099694 2099853 1000 - . gene_id "SS.2890"; transcript_id "SS.2890.1"; exon_number "2"; cov "1273.893799"; +CM143130.1 StringTie transcript 2101777 2102834 1000 . . gene_id "SS.2891"; transcript_id "SS.2891.1"; cov "6523.914934"; FPKM "319.048794"; TPM "682.236948"; +CM143130.1 StringTie exon 2101777 2102834 1000 . . gene_id "SS.2891"; transcript_id "SS.2891.1"; exon_number "1"; cov "6523.915039"; +CM143130.1 StringTie transcript 2106887 2107605 1000 . . gene_id "SS.2892"; transcript_id "SS.2892.1"; cov "1256.802503"; FPKM "61.463297"; TPM "131.429841"; +CM143130.1 StringTie exon 2106887 2107605 1000 . . gene_id "SS.2892"; transcript_id "SS.2892.1"; exon_number "1"; cov "1256.802490"; +CM143130.1 StringTie transcript 2109035 2115093 1000 . . gene_id "SS.2893"; transcript_id "SS.2893.1"; cov "399.141442"; FPKM "19.519812"; TPM "41.740127"; +CM143130.1 StringTie exon 2109035 2115093 1000 . . gene_id "SS.2893"; transcript_id "SS.2893.1"; exon_number "1"; cov "399.141449"; +CM143130.1 StringTie transcript 2115327 2118144 1000 . . gene_id "SS.2894"; transcript_id "SS.2894.1"; cov "227.025905"; FPKM "11.102588"; TPM "23.741183"; +CM143130.1 StringTie exon 2115327 2118144 1000 . . gene_id "SS.2894"; transcript_id "SS.2894.1"; exon_number "1"; cov "227.025909"; +CM143130.1 StringTie transcript 2118422 2121067 1000 . . gene_id "SS.2895"; transcript_id "SS.2895.1"; cov "487.238473"; FPKM "23.828154"; TPM "50.952855"; +CM143130.1 StringTie exon 2118422 2121067 1000 . . gene_id "SS.2895"; transcript_id "SS.2895.1"; exon_number "1"; cov "487.238464"; +CM143130.1 StringTie transcript 2121400 2124144 1000 . . gene_id "SS.2896"; transcript_id "SS.2896.1"; cov "244.124590"; FPKM "11.938791"; TPM "25.529275"; +CM143130.1 StringTie exon 2121400 2124144 1000 . . gene_id "SS.2896"; transcript_id "SS.2896.1"; exon_number "1"; cov "244.124588"; +CM143130.1 StringTie transcript 2124601 2128410 1000 . . gene_id "SS.2897"; transcript_id "SS.2897.1"; cov "1464.847769"; FPKM "71.637647"; TPM "153.186129"; +CM143130.1 StringTie exon 2124601 2128410 1000 . . gene_id "SS.2897"; transcript_id "SS.2897.1"; exon_number "1"; cov "1464.847778"; +CM143130.1 StringTie transcript 2128661 2129017 1000 . . gene_id "SS.2898"; transcript_id "SS.2898.1"; cov "45.341737"; FPKM "2.217415"; TPM "4.741602"; +CM143130.1 StringTie exon 2128661 2129017 1000 . . gene_id "SS.2898"; transcript_id "SS.2898.1"; exon_number "1"; cov "45.341736"; +CM143130.1 StringTie transcript 2130486 2134145 1000 . . gene_id "SS.2899"; transcript_id "SS.2899.1"; cov "762.712295"; FPKM "37.300063"; TPM "79.760468"; +CM143130.1 StringTie exon 2130486 2134145 1000 . . gene_id "SS.2899"; transcript_id "SS.2899.1"; exon_number "1"; cov "762.712280"; +CM143130.1 StringTie transcript 2134589 2135595 1000 . . gene_id "SS.2900"; transcript_id "SS.2900.1"; cov "6110.958292"; FPKM "298.853356"; TPM "639.052100"; +CM143130.1 StringTie exon 2134589 2135595 1000 . . gene_id "SS.2900"; transcript_id "SS.2900.1"; exon_number "1"; cov "6110.958496"; +CM143130.1 StringTie transcript 2135850 2145589 1000 . . gene_id "SS.2901"; transcript_id "SS.2901.1"; cov "826.409959"; FPKM "40.415165"; TPM "86.421637"; +CM143130.1 StringTie exon 2135850 2145589 1000 . . gene_id "SS.2901"; transcript_id "SS.2901.1"; exon_number "1"; cov "826.409973"; +CM143130.1 StringTie transcript 2145902 2147526 1000 . . gene_id "SS.2902"; transcript_id "SS.2902.1"; cov "1309.589538"; FPKM "64.044821"; TPM "136.950034"; +CM143130.1 StringTie exon 2145902 2147526 1000 . . gene_id "SS.2902"; transcript_id "SS.2902.1"; exon_number "1"; cov "1309.589478"; +CM143130.1 StringTie transcript 2147790 2156672 1000 . . gene_id "SS.2903"; transcript_id "SS.2903.1"; cov "387.278510"; FPKM "18.939662"; TPM "40.499564"; +CM143130.1 StringTie exon 2147790 2156672 1000 . . gene_id "SS.2903"; transcript_id "SS.2903.1"; exon_number "1"; cov "387.278503"; +CM143130.1 StringTie transcript 2156922 2159276 1000 . . gene_id "SS.2904"; transcript_id "SS.2904.1"; cov "1299.287898"; FPKM "63.541024"; TPM "135.872742"; +CM143130.1 StringTie exon 2156922 2159276 1000 . . gene_id "SS.2904"; transcript_id "SS.2904.1"; exon_number "1"; cov "1299.287842"; +CM143130.1 StringTie transcript 2160539 2161591 1000 . . gene_id "SS.2905"; transcript_id "SS.2905.1"; cov "244.918329"; FPKM "11.977608"; TPM "25.612280"; +CM143130.1 StringTie exon 2160539 2161591 1000 . . gene_id "SS.2905"; transcript_id "SS.2905.1"; exon_number "1"; cov "244.918335"; +CM143130.1 StringTie transcript 2161805 2173427 1000 . . gene_id "SS.2906"; transcript_id "SS.2906.1"; cov "533.765723"; FPKM "26.103545"; TPM "55.818431"; +CM143130.1 StringTie exon 2161805 2173427 1000 . . gene_id "SS.2906"; transcript_id "SS.2906.1"; exon_number "1"; cov "533.765747"; +CM143130.1 StringTie transcript 2173727 2175143 1000 . . gene_id "SS.2907"; transcript_id "SS.2907.1"; cov "113.429076"; FPKM "5.547192"; TPM "11.861820"; +CM143130.1 StringTie exon 2173727 2175143 1000 . . gene_id "SS.2907"; transcript_id "SS.2907.1"; exon_number "1"; cov "113.429077"; +CM143130.1 StringTie transcript 2175569 2178364 1000 . . gene_id "SS.2908"; transcript_id "SS.2908.1"; cov "114.285765"; FPKM "5.589088"; TPM "11.951408"; +CM143130.1 StringTie exon 2175569 2178364 1000 . . gene_id "SS.2908"; transcript_id "SS.2908.1"; exon_number "1"; cov "114.285767"; +CM143130.1 StringTie transcript 2178731 2191765 1000 . . gene_id "SS.2909"; transcript_id "SS.2909.1"; cov "1274.163406"; FPKM "62.312324"; TPM "133.245354"; +CM143130.1 StringTie exon 2178731 2191765 1000 . . gene_id "SS.2909"; transcript_id "SS.2909.1"; exon_number "1"; cov "1274.163452"; +CM143130.1 StringTie transcript 2192280 2195546 1000 . . gene_id "SS.2910"; transcript_id "SS.2910.1"; cov "781.611876"; FPKM "38.224338"; TPM "81.736888"; +CM143130.1 StringTie exon 2192280 2195546 1000 . . gene_id "SS.2910"; transcript_id "SS.2910.1"; exon_number "1"; cov "781.611877"; +CM143130.1 StringTie transcript 2210788 2213198 1000 . . gene_id "SS.2911"; transcript_id "SS.2911.1"; cov "269.817503"; FPKM "13.195290"; TPM "28.216105"; +CM143130.1 StringTie exon 2210788 2213198 1000 . . gene_id "SS.2911"; transcript_id "SS.2911.1"; exon_number "1"; cov "269.817505"; +CM143130.1 StringTie transcript 2213513 2213730 1000 . . gene_id "SS.2912"; transcript_id "SS.2912.1"; cov "9.000000"; FPKM "0.440140"; TPM "0.941173"; +CM143130.1 StringTie exon 2213513 2213730 1000 . . gene_id "SS.2912"; transcript_id "SS.2912.1"; exon_number "1"; cov "9.000000"; +CM143130.1 StringTie transcript 2197824 2199021 1000 . . gene_id "SS.2913"; transcript_id "SS.2913.1"; cov "5336.451586"; FPKM "260.976493"; TPM "558.058234"; +CM143130.1 StringTie exon 2197824 2199021 1000 . . gene_id "SS.2913"; transcript_id "SS.2913.1"; exon_number "1"; cov "5336.451660"; +CM143130.1 StringTie transcript 2199354 2207235 1000 . . gene_id "SS.2914"; transcript_id "SS.2914.1"; cov "403.588207"; FPKM "19.737279"; TPM "42.205147"; +CM143130.1 StringTie exon 2199354 2207235 1000 . . gene_id "SS.2914"; transcript_id "SS.2914.1"; exon_number "1"; cov "403.588196"; +CM143130.1 StringTie transcript 2199354 2200299 1000 - . gene_id "SS.2915"; transcript_id "SS.2915.1"; cov "3.761595"; FPKM "0.183959"; TPM "0.393368"; +CM143130.1 StringTie exon 2199354 2200041 1000 - . gene_id "SS.2915"; transcript_id "SS.2915.1"; exon_number "1"; cov "4.676692"; +CM143130.1 StringTie exon 2200123 2200299 1000 - . gene_id "SS.2915"; transcript_id "SS.2915.1"; exon_number "2"; cov "0.204607"; +CM143130.1 StringTie transcript 2207587 2210339 1000 . . gene_id "SS.2916"; transcript_id "SS.2916.1"; cov "2950.616782"; FPKM "144.298437"; TPM "308.560092"; +CM143130.1 StringTie exon 2207587 2210339 1000 . . gene_id "SS.2916"; transcript_id "SS.2916.1"; exon_number "1"; cov "2950.616699"; +CM143130.1 StringTie transcript 2216903 2218227 1000 - . gene_id "SS.2917"; transcript_id "SS.2917.1"; cov "25.106655"; FPKM "1.227828"; TPM "2.625523"; +CM143130.1 StringTie exon 2216903 2217581 1000 - . gene_id "SS.2917"; transcript_id "SS.2917.1"; exon_number "1"; cov "13.157576"; +CM143130.1 StringTie exon 2217829 2218227 1000 - . gene_id "SS.2917"; transcript_id "SS.2917.1"; exon_number "2"; cov "45.441055"; +CM143130.1 StringTie transcript 2218447 2221029 1000 - . gene_id "SS.2918"; transcript_id "SS.2918.1"; cov "30.489004"; FPKM "1.491049"; TPM "3.188381"; +CM143130.1 StringTie exon 2218447 2219703 1000 - . gene_id "SS.2918"; transcript_id "SS.2918.1"; exon_number "1"; cov "7.345528"; +CM143130.1 StringTie exon 2219791 2220217 1000 - . gene_id "SS.2918"; transcript_id "SS.2918.1"; exon_number "2"; cov "12.617224"; +CM143130.1 StringTie exon 2220267 2221029 1000 - . gene_id "SS.2918"; transcript_id "SS.2918.1"; exon_number "3"; cov "78.618233"; +CM143130.1 StringTie transcript 2233221 2233489 1000 . . gene_id "SS.2919"; transcript_id "SS.2919.1"; cov "9.000000"; FPKM "0.440140"; TPM "0.941173"; +CM143130.1 StringTie exon 2233221 2233489 1000 . . gene_id "SS.2919"; transcript_id "SS.2919.1"; exon_number "1"; cov "9.000000"; +CM143130.1 StringTie transcript 2235670 2235950 1000 . . gene_id "SS.2920"; transcript_id "SS.2920.1"; cov "9.672598"; FPKM "0.473034"; TPM "1.011510"; +CM143130.1 StringTie exon 2235670 2235950 1000 . . gene_id "SS.2920"; transcript_id "SS.2920.1"; exon_number "1"; cov "9.672598"; +CM143130.1 StringTie transcript 2238457 2239523 1000 . . gene_id "SS.2921"; transcript_id "SS.2921.1"; cov "120.425492"; FPKM "5.889348"; TPM "12.593469"; +CM143130.1 StringTie exon 2238457 2239523 1000 . . gene_id "SS.2921"; transcript_id "SS.2921.1"; exon_number "1"; cov "120.425491"; +CM143130.1 StringTie transcript 2240507 2241115 1000 + . gene_id "SS.2922"; transcript_id "SS.2922.1"; cov "7.855042"; FPKM "0.384147"; TPM "0.821439"; +CM143130.1 StringTie exon 2240507 2240561 1000 + . gene_id "SS.2922"; transcript_id "SS.2922.1"; exon_number "1"; cov "1.000000"; +CM143130.1 StringTie exon 2240695 2241115 1000 + . gene_id "SS.2922"; transcript_id "SS.2922.1"; exon_number "2"; cov "8.750594"; +CM143130.1 StringTie transcript 2241442 2242439 1000 . . gene_id "SS.2923"; transcript_id "SS.2923.1"; cov "5.874749"; FPKM "0.287302"; TPM "0.614351"; +CM143130.1 StringTie exon 2241442 2242439 1000 . . gene_id "SS.2923"; transcript_id "SS.2923.1"; exon_number "1"; cov "5.874750"; +CM143130.1 StringTie transcript 2242693 2243152 1000 . . gene_id "SS.2924"; transcript_id "SS.2924.1"; cov "12.047826"; FPKM "0.589193"; TPM "1.259899"; +CM143130.1 StringTie exon 2242693 2243152 1000 . . gene_id "SS.2924"; transcript_id "SS.2924.1"; exon_number "1"; cov "12.047826"; +CM143130.1 StringTie transcript 2243572 2243819 1000 . . gene_id "SS.2925"; transcript_id "SS.2925.1"; cov "9.891129"; FPKM "0.483721"; TPM "1.034363"; +CM143130.1 StringTie exon 2243572 2243819 1000 . . gene_id "SS.2925"; transcript_id "SS.2925.1"; exon_number "1"; cov "9.891129"; +CM143130.1 StringTie transcript 2245906 2247041 1000 . . gene_id "SS.2926"; transcript_id "SS.2926.1"; cov "5.398768"; FPKM "0.264024"; TPM "0.564575"; +CM143130.1 StringTie exon 2245906 2247041 1000 . . gene_id "SS.2926"; transcript_id "SS.2926.1"; exon_number "1"; cov "5.398767"; +CM143130.1 StringTie transcript 2248112 2248432 1000 - . gene_id "SS.2927"; transcript_id "SS.2927.1"; cov "3.272727"; FPKM "0.160051"; TPM "0.342245"; +CM143130.1 StringTie exon 2248112 2248150 1000 - . gene_id "SS.2927"; transcript_id "SS.2927.1"; exon_number "1"; cov "4.000000"; +CM143130.1 StringTie exon 2248197 2248432 1000 - . gene_id "SS.2927"; transcript_id "SS.2927.1"; exon_number "2"; cov "3.152542"; +CM143130.1 StringTie transcript 2249454 2249807 1000 . . gene_id "SS.2928"; transcript_id "SS.2928.1"; cov "9.731638"; FPKM "0.475921"; TPM "1.017684"; +CM143130.1 StringTie exon 2249454 2249807 1000 . . gene_id "SS.2928"; transcript_id "SS.2928.1"; exon_number "1"; cov "9.731638"; +CM143131.1 StringTie transcript 673 2420 1000 . . gene_id "SS.2929"; transcript_id "SS.2929.1"; cov "9.291762"; FPKM "0.454409"; TPM "0.971684"; +CM143131.1 StringTie exon 673 2420 1000 . . gene_id "SS.2929"; transcript_id "SS.2929.1"; exon_number "1"; cov "9.291762"; +CM143131.1 StringTie transcript 5080 5920 1000 . . gene_id "SS.2930"; transcript_id "SS.2930.1"; cov "8.883435"; FPKM "0.434440"; TPM "0.928983"; +CM143131.1 StringTie exon 5080 5920 1000 . . gene_id "SS.2930"; transcript_id "SS.2930.1"; exon_number "1"; cov "8.883435"; +CM143131.1 StringTie transcript 11486 12285 1000 . . gene_id "SS.2931"; transcript_id "SS.2931.1"; cov "5.346250"; FPKM "0.261456"; TPM "0.559083"; +CM143131.1 StringTie exon 11486 12285 1000 . . gene_id "SS.2931"; transcript_id "SS.2931.1"; exon_number "1"; cov "5.346250"; +CM143131.1 StringTie transcript 20942 29463 1000 . . gene_id "SS.2932"; transcript_id "SS.2932.1"; cov "451.815595"; FPKM "22.095815"; TPM "47.248515"; +CM143131.1 StringTie exon 20942 29463 1000 . . gene_id "SS.2932"; transcript_id "SS.2932.1"; exon_number "1"; cov "451.815582"; +CM143131.1 StringTie transcript 29721 31467 1000 . . gene_id "SS.2933"; transcript_id "SS.2933.1"; cov "2060.970235"; FPKM "100.790718"; TPM "215.525502"; +CM143131.1 StringTie exon 29721 31467 1000 . . gene_id "SS.2933"; transcript_id "SS.2933.1"; exon_number "1"; cov "2060.970215"; +CM143131.1 StringTie transcript 32647 33754 1000 . . gene_id "SS.2934"; transcript_id "SS.2934.1"; cov "1513.290614"; FPKM "74.006720"; TPM "158.252028"; +CM143131.1 StringTie exon 32647 33754 1000 . . gene_id "SS.2934"; transcript_id "SS.2934.1"; exon_number "1"; cov "1513.290649"; +CM143131.1 StringTie transcript 34097 36934 1000 . . gene_id "SS.2935"; transcript_id "SS.2935.1"; cov "602.849894"; FPKM "29.482072"; TPM "63.042893"; +CM143131.1 StringTie exon 34097 36934 1000 . . gene_id "SS.2935"; transcript_id "SS.2935.1"; exon_number "1"; cov "602.849915"; +CM143131.1 StringTie transcript 37321 40183 1000 . . gene_id "SS.2936"; transcript_id "SS.2936.1"; cov "393.867272"; FPKM "19.261882"; TPM "41.188582"; +CM143131.1 StringTie exon 37321 40183 1000 . . gene_id "SS.2936"; transcript_id "SS.2936.1"; exon_number "1"; cov "393.867279"; +CM143131.1 StringTie transcript 40437 46900 1000 . . gene_id "SS.2937"; transcript_id "SS.2937.1"; cov "195.496442"; FPKM "9.560656"; TPM "20.443997"; +CM143131.1 StringTie exon 40437 46900 1000 . . gene_id "SS.2937"; transcript_id "SS.2937.1"; exon_number "1"; cov "195.496445"; +CM143131.1 StringTie transcript 47178 51413 1000 . . gene_id "SS.2938"; transcript_id "SS.2938.1"; cov "131.439093"; FPKM "6.427963"; TPM "13.745214"; +CM143131.1 StringTie exon 47178 51413 1000 . . gene_id "SS.2938"; transcript_id "SS.2938.1"; exon_number "1"; cov "131.439087"; +CM143131.1 StringTie transcript 51762 53657 1000 . . gene_id "SS.2939"; transcript_id "SS.2939.1"; cov "173.035865"; FPKM "8.462232"; TPM "18.095187"; +CM143131.1 StringTie exon 51762 53657 1000 . . gene_id "SS.2939"; transcript_id "SS.2939.1"; exon_number "1"; cov "173.035858"; +CM143131.1 StringTie transcript 53943 55542 1000 . . gene_id "SS.2940"; transcript_id "SS.2940.1"; cov "489.584375"; FPKM "23.942879"; TPM "51.198177"; +CM143131.1 StringTie exon 53943 55542 1000 . . gene_id "SS.2940"; transcript_id "SS.2940.1"; exon_number "1"; cov "489.584381"; +CM143131.1 StringTie transcript 55838 58520 1000 . . gene_id "SS.2941"; transcript_id "SS.2941.1"; cov "417.216549"; FPKM "20.403766"; TPM "43.630328"; +CM143131.1 StringTie exon 55838 58520 1000 . . gene_id "SS.2941"; transcript_id "SS.2941.1"; exon_number "1"; cov "417.216553"; +CM143131.1 StringTie transcript 64040 64516 1000 . . gene_id "SS.2942"; transcript_id "SS.2942.1"; cov "1832.870021"; FPKM "89.635591"; TPM "191.671973"; +CM143131.1 StringTie exon 64040 64516 1000 . . gene_id "SS.2942"; transcript_id "SS.2942.1"; exon_number "1"; cov "1832.869995"; +CM143131.1 StringTie transcript 64834 67508 1000 . . gene_id "SS.2943"; transcript_id "SS.2943.1"; cov "153.174206"; FPKM "7.490908"; TPM "16.018158"; +CM143131.1 StringTie exon 64834 67508 1000 . . gene_id "SS.2943"; transcript_id "SS.2943.1"; exon_number "1"; cov "153.174210"; +CM143131.1 StringTie transcript 69011 70174 1000 . . gene_id "SS.2944"; transcript_id "SS.2944.1"; cov "1122.988832"; FPKM "54.919207"; TPM "117.436307"; +CM143131.1 StringTie exon 69011 70174 1000 . . gene_id "SS.2944"; transcript_id "SS.2944.1"; exon_number "1"; cov "1122.988892"; +CM143131.1 StringTie transcript 70524 74547 1000 . . gene_id "SS.2945"; transcript_id "SS.2945.1"; cov "116.088221"; FPKM "5.677236"; TPM "12.139900"; +CM143131.1 StringTie exon 70524 74547 1000 . . gene_id "SS.2945"; transcript_id "SS.2945.1"; exon_number "1"; cov "116.088219"; +CM143131.1 StringTie transcript 75509 76265 1000 . . gene_id "SS.2946"; transcript_id "SS.2946.1"; cov "4654.585205"; FPKM "227.630159"; TPM "486.752209"; +CM143131.1 StringTie exon 75509 76265 1000 . . gene_id "SS.2946"; transcript_id "SS.2946.1"; exon_number "1"; cov "4654.584961"; +CM143131.1 StringTie transcript 76944 80100 1000 . . gene_id "SS.2947"; transcript_id "SS.2947.1"; cov "1817.967691"; FPKM "88.906800"; TPM "190.113566"; +CM143131.1 StringTie exon 76944 80100 1000 . . gene_id "SS.2947"; transcript_id "SS.2947.1"; exon_number "1"; cov "1817.967651"; +CM143131.1 StringTie transcript 80383 82004 1000 . . gene_id "SS.2948"; transcript_id "SS.2948.1"; cov "2067.882244"; FPKM "101.128746"; TPM "216.248324"; +CM143131.1 StringTie exon 80383 82004 1000 . . gene_id "SS.2948"; transcript_id "SS.2948.1"; exon_number "1"; cov "2067.882324"; +CM143131.1 StringTie transcript 82400 85447 1000 . . gene_id "SS.2949"; transcript_id "SS.2949.1"; cov "674.776903"; FPKM "32.999627"; TPM "70.564644"; +CM143131.1 StringTie exon 82400 85447 1000 . . gene_id "SS.2949"; transcript_id "SS.2949.1"; exon_number "1"; cov "674.776917"; +CM143131.1 StringTie transcript 87002 89518 1000 . . gene_id "SS.2950"; transcript_id "SS.2950.1"; cov "323.110846"; FPKM "15.801574"; TPM "33.789245"; +CM143131.1 StringTie exon 87002 89518 1000 . . gene_id "SS.2950"; transcript_id "SS.2950.1"; exon_number "1"; cov "323.110840"; +CM143131.1 StringTie transcript 89757 90449 1000 + . gene_id "SS.2951"; transcript_id "SS.2951.1"; cov "59.310195"; FPKM "2.900535"; TPM "6.202350"; +CM143131.1 StringTie exon 89757 89847 1000 + . gene_id "SS.2951"; transcript_id "SS.2951.1"; exon_number "1"; cov "13.881371"; +CM143131.1 StringTie exon 89974 90449 1000 + . gene_id "SS.2951"; transcript_id "SS.2951.1"; exon_number "2"; cov "67.995117"; +CM143131.1 StringTie transcript 89757 96927 1000 . . gene_id "SS.2952"; transcript_id "SS.2952.1"; cov "356.451680"; FPKM "17.432091"; TPM "37.275855"; +CM143131.1 StringTie exon 89757 96927 1000 . . gene_id "SS.2952"; transcript_id "SS.2952.1"; exon_number "1"; cov "356.451691"; +CM143131.1 StringTie transcript 104717 106567 1000 . . gene_id "SS.2953"; transcript_id "SS.2953.1"; cov "3594.691518"; FPKM "175.796589"; TPM "375.914063"; +CM143131.1 StringTie exon 104717 106567 1000 . . gene_id "SS.2953"; transcript_id "SS.2953.1"; exon_number "1"; cov "3594.691406"; +CM143131.1 StringTie transcript 111459 114329 1000 . . gene_id "SS.2954"; transcript_id "SS.2954.1"; cov "2684.987113"; FPKM "131.307951"; TPM "280.781928"; +CM143131.1 StringTie exon 111459 114329 1000 . . gene_id "SS.2954"; transcript_id "SS.2954.1"; exon_number "1"; cov "2684.987061"; +CM143131.1 StringTie transcript 116710 117648 1000 - . gene_id "SS.2955"; transcript_id "SS.2955.1"; cov "3352.644578"; FPKM "163.959405"; TPM "350.602059"; +CM143131.1 StringTie exon 116710 117449 1000 - . gene_id "SS.2955"; transcript_id "SS.2955.1"; exon_number "1"; cov "3585.756836"; +CM143131.1 StringTie exon 117559 117648 1000 - . gene_id "SS.2955"; transcript_id "SS.2955.1"; exon_number "2"; cov "1435.944458"; +CM143131.1 StringTie transcript 117993 120221 1000 . . gene_id "SS.2956"; transcript_id "SS.2956.1"; cov "1141.278600"; FPKM "55.813659"; TPM "119.348955"; +CM143131.1 StringTie exon 117993 120221 1000 . . gene_id "SS.2956"; transcript_id "SS.2956.1"; exon_number "1"; cov "1141.278564"; +CM143131.1 StringTie transcript 120514 121775 1000 . . gene_id "SS.2957"; transcript_id "SS.2957.1"; cov "13.983360"; FPKM "0.683849"; TPM "1.462307"; +CM143131.1 StringTie exon 120514 121775 1000 . . gene_id "SS.2957"; transcript_id "SS.2957.1"; exon_number "1"; cov "13.983359"; +CM143131.1 StringTie transcript 122481 125167 1000 . . gene_id "SS.2958"; transcript_id "SS.2958.1"; cov "194.630071"; FPKM "9.518286"; TPM "20.353396"; +CM143131.1 StringTie exon 122481 125167 1000 . . gene_id "SS.2958"; transcript_id "SS.2958.1"; exon_number "1"; cov "194.630066"; +CM143131.1 StringTie transcript 125487 126647 1000 . . gene_id "SS.2959"; transcript_id "SS.2959.1"; cov "868.472007"; FPKM "42.472189"; TPM "90.820266"; +CM143131.1 StringTie exon 125487 126647 1000 . . gene_id "SS.2959"; transcript_id "SS.2959.1"; exon_number "1"; cov "868.471985"; +CM143131.1 StringTie transcript 126880 129900 1000 . . gene_id "SS.2960"; transcript_id "SS.2960.1"; cov "372.756041"; FPKM "18.229448"; TPM "38.980880"; +CM143131.1 StringTie exon 126880 129900 1000 . . gene_id "SS.2960"; transcript_id "SS.2960.1"; exon_number "1"; cov "372.756042"; +CM143131.1 StringTie transcript 130263 130808 1000 . . gene_id "SS.2961"; transcript_id "SS.2961.1"; cov "762.000000"; FPKM "37.265229"; TPM "79.685980"; +CM143131.1 StringTie exon 130263 130808 1000 . . gene_id "SS.2961"; transcript_id "SS.2961.1"; exon_number "1"; cov "762.000000"; +CM143131.1 StringTie transcript 132980 136792 1000 . . gene_id "SS.2962"; transcript_id "SS.2962.1"; cov "819.659061"; FPKM "40.085016"; TPM "85.715663"; +CM143131.1 StringTie exon 132980 136792 1000 . . gene_id "SS.2962"; transcript_id "SS.2962.1"; exon_number "1"; cov "819.659058"; +CM143131.1 StringTie transcript 137670 139336 1000 . . gene_id "SS.2963"; transcript_id "SS.2963.1"; cov "3127.505099"; FPKM "152.949071"; TPM "327.058148"; +CM143131.1 StringTie exon 137670 139336 1000 . . gene_id "SS.2963"; transcript_id "SS.2963.1"; exon_number "1"; cov "3127.505127"; +CM143131.1 StringTie transcript 143055 144908 1000 . . gene_id "SS.2964"; transcript_id "SS.2964.1"; cov "704.254045"; FPKM "34.441192"; TPM "73.647210"; +CM143131.1 StringTie exon 143055 144908 1000 . . gene_id "SS.2964"; transcript_id "SS.2964.1"; exon_number "1"; cov "704.254028"; +CM143131.1 StringTie transcript 147598 149699 1000 . . gene_id "SS.2965"; transcript_id "SS.2965.1"; cov "305.072788"; FPKM "14.919432"; TPM "31.902919"; +CM143131.1 StringTie exon 147598 149699 1000 . . gene_id "SS.2965"; transcript_id "SS.2965.1"; exon_number "1"; cov "305.072784"; +CM143131.1 StringTie transcript 149988 154684 1000 . . gene_id "SS.2966"; transcript_id "SS.2966.1"; cov "192.265702"; FPKM "9.402658"; TPM "20.106143"; +CM143131.1 StringTie exon 149988 154684 1000 . . gene_id "SS.2966"; transcript_id "SS.2966.1"; exon_number "1"; cov "192.265701"; +CM143131.1 StringTie transcript 154932 158900 1000 . . gene_id "SS.2967"; transcript_id "SS.2967.1"; cov "284.536155"; FPKM "13.915098"; TPM "29.755305"; +CM143131.1 StringTie exon 154932 158900 1000 . . gene_id "SS.2967"; transcript_id "SS.2967.1"; exon_number "1"; cov "284.536163"; +CM143131.1 StringTie transcript 159164 163570 1000 . . gene_id "SS.2968"; transcript_id "SS.2968.1"; cov "609.535058"; FPKM "29.809007"; TPM "63.741993"; +CM143131.1 StringTie exon 159164 163570 1000 . . gene_id "SS.2968"; transcript_id "SS.2968.1"; exon_number "1"; cov "609.535034"; +CM143131.1 StringTie transcript 164572 166196 1000 . . gene_id "SS.2969"; transcript_id "SS.2969.1"; cov "222.533577"; FPKM "10.882893"; TPM "23.271399"; +CM143131.1 StringTie exon 164572 166196 1000 . . gene_id "SS.2969"; transcript_id "SS.2969.1"; exon_number "1"; cov "222.533569"; +CM143131.1 StringTie transcript 164572 166196 1000 - . gene_id "SS.2970"; transcript_id "SS.2970.1"; cov "129.964025"; FPKM "6.355826"; TPM "13.590959"; +CM143131.1 StringTie exon 164572 165981 1000 - . gene_id "SS.2970"; transcript_id "SS.2970.1"; exon_number "1"; cov "135.221237"; +CM143131.1 StringTie exon 166134 166196 1000 - . gene_id "SS.2970"; transcript_id "SS.2970.1"; exon_number "2"; cov "12.302720"; +CM143131.1 StringTie transcript 164572 170804 1000 - . gene_id "SS.2970"; transcript_id "SS.2970.2"; cov "104.495412"; FPKM "5.110296"; TPM "10.927584"; +CM143131.1 StringTie exon 164572 166162 1000 - . gene_id "SS.2970"; transcript_id "SS.2970.2"; exon_number "1"; cov "207.981079"; +CM143131.1 StringTie exon 166382 170804 1000 - . gene_id "SS.2970"; transcript_id "SS.2970.2"; exon_number "2"; cov "67.270515"; +CM143131.1 StringTie transcript 166512 170804 1000 . . gene_id "SS.2971"; transcript_id "SS.2971.1"; cov "239.056254"; FPKM "11.690926"; TPM "24.999254"; +CM143131.1 StringTie exon 166512 170804 1000 . . gene_id "SS.2971"; transcript_id "SS.2971.1"; exon_number "1"; cov "239.056259"; +CM143131.1 StringTie transcript 184146 187165 1000 . . gene_id "SS.2972"; transcript_id "SS.2972.1"; cov "933.193957"; FPKM "45.637383"; TPM "97.588550"; +CM143131.1 StringTie exon 184146 187165 1000 . . gene_id "SS.2972"; transcript_id "SS.2972.1"; exon_number "1"; cov "933.193970"; +CM143131.1 StringTie transcript 187752 188478 1000 - . gene_id "SS.2973"; transcript_id "SS.2973.1"; cov "2319.301092"; FPKM "113.424259"; TPM "242.540394"; +CM143131.1 StringTie exon 187752 188278 1000 - . gene_id "SS.2973"; transcript_id "SS.2973.1"; exon_number "1"; cov "2670.390869"; +CM143131.1 StringTie exon 188365 188478 1000 - . gene_id "SS.2973"; transcript_id "SS.2973.1"; exon_number "2"; cov "696.280701"; +CM143131.1 StringTie transcript 191828 193998 1000 . . gene_id "SS.2974"; transcript_id "SS.2974.1"; cov "105.554123"; FPKM "5.162072"; TPM "11.038299"; +CM143131.1 StringTie exon 191828 193998 1000 . . gene_id "SS.2974"; transcript_id "SS.2974.1"; exon_number "1"; cov "105.554123"; +CM143131.1 StringTie transcript 194411 195318 1000 . . gene_id "SS.2975"; transcript_id "SS.2975.1"; cov "2615.143172"; FPKM "127.892268"; TPM "273.478014"; +CM143131.1 StringTie exon 194411 195318 1000 . . gene_id "SS.2975"; transcript_id "SS.2975.1"; exon_number "1"; cov "2615.143066"; +CM143131.1 StringTie transcript 195838 222659 1000 . . gene_id "SS.2976"; transcript_id "SS.2976.1"; cov "520.956379"; FPKM "25.477111"; TPM "54.478897"; +CM143131.1 StringTie exon 195838 222659 1000 . . gene_id "SS.2976"; transcript_id "SS.2976.1"; exon_number "1"; cov "520.956360"; +CM143131.1 StringTie transcript 222918 229102 1000 . . gene_id "SS.2977"; transcript_id "SS.2977.1"; cov "441.722231"; FPKM "21.602205"; TPM "46.193004"; +CM143131.1 StringTie exon 222918 229102 1000 . . gene_id "SS.2977"; transcript_id "SS.2977.1"; exon_number "1"; cov "441.722229"; +CM143131.1 StringTie transcript 229573 242338 1000 . . gene_id "SS.2978"; transcript_id "SS.2978.1"; cov "335.559690"; FPKM "16.410379"; TPM "35.091080"; +CM143131.1 StringTie exon 229573 242338 1000 . . gene_id "SS.2978"; transcript_id "SS.2978.1"; exon_number "1"; cov "335.559692"; +CM143131.1 StringTie transcript 242673 254339 1000 . . gene_id "SS.2979"; transcript_id "SS.2979.1"; cov "743.482815"; FPKM "36.359655"; TPM "77.749549"; +CM143131.1 StringTie exon 242673 254339 1000 . . gene_id "SS.2979"; transcript_id "SS.2979.1"; exon_number "1"; cov "743.482788"; +CM143131.1 StringTie transcript 254834 267709 1000 . . gene_id "SS.2980"; transcript_id "SS.2980.1"; cov "335.242467"; FPKM "16.394865"; TPM "35.057906"; +CM143131.1 StringTie exon 254834 267709 1000 . . gene_id "SS.2980"; transcript_id "SS.2980.1"; exon_number "1"; cov "335.242462"; +CM143131.1 StringTie transcript 283902 284193 1000 . . gene_id "SS.2981"; transcript_id "SS.2981.1"; cov "5.000000"; FPKM "0.244522"; TPM "0.522874"; +CM143131.1 StringTie exon 283902 284193 1000 . . gene_id "SS.2981"; transcript_id "SS.2981.1"; exon_number "1"; cov "5.000000"; +CM143131.1 StringTie transcript 285511 285758 1000 . . gene_id "SS.2982"; transcript_id "SS.2982.1"; cov "6.000000"; FPKM "0.293427"; TPM "0.627449"; +CM143131.1 StringTie exon 285511 285758 1000 . . gene_id "SS.2982"; transcript_id "SS.2982.1"; exon_number "1"; cov "6.000000"; +CM143131.1 StringTie transcript 268589 271266 1000 . . gene_id "SS.2983"; transcript_id "SS.2983.1"; cov "1945.199029"; FPKM "95.128985"; TPM "203.418754"; +CM143131.1 StringTie exon 268589 271266 1000 . . gene_id "SS.2983"; transcript_id "SS.2983.1"; exon_number "1"; cov "1945.198975"; +CM143131.1 StringTie transcript 273761 274207 1000 . . gene_id "SS.2984"; transcript_id "SS.2984.1"; cov "2916.760626"; FPKM "142.642718"; TPM "305.019592"; +CM143131.1 StringTie exon 273761 274207 1000 . . gene_id "SS.2984"; transcript_id "SS.2984.1"; exon_number "1"; cov "2916.760742"; +CM143131.1 StringTie transcript 274446 280106 1000 . . gene_id "SS.2985"; transcript_id "SS.2985.1"; cov "254.487900"; FPKM "12.445603"; TPM "26.613015"; +CM143131.1 StringTie exon 274446 280106 1000 . . gene_id "SS.2985"; transcript_id "SS.2985.1"; exon_number "1"; cov "254.487900"; +CM143131.1 StringTie transcript 297875 299595 1000 + . gene_id "SS.2986"; transcript_id "SS.2986.1"; cov "66.029514"; FPKM "3.229140"; TPM "6.905022"; +CM143131.1 StringTie exon 297875 298215 1000 + . gene_id "SS.2986"; transcript_id "SS.2986.1"; exon_number "1"; cov "19.111322"; +CM143131.1 StringTie exon 298303 299595 1000 + . gene_id "SS.2986"; transcript_id "SS.2986.1"; exon_number "2"; cov "78.403145"; +CM143131.1 StringTie transcript 303782 305060 1000 . . gene_id "SS.2987"; transcript_id "SS.2987.1"; cov "7.416462"; FPKM "0.362698"; TPM "0.775575"; +CM143131.1 StringTie exon 303782 305060 1000 . . gene_id "SS.2987"; transcript_id "SS.2987.1"; exon_number "1"; cov "7.416462"; +CM143131.1 StringTie transcript 308162 308774 1000 . . gene_id "SS.2988"; transcript_id "SS.2988.1"; cov "15.714519"; FPKM "0.768511"; TPM "1.643342"; +CM143131.1 StringTie exon 308162 308774 1000 . . gene_id "SS.2988"; transcript_id "SS.2988.1"; exon_number "1"; cov "15.714519"; +CM143131.1 StringTie transcript 309309 313888 1000 . . gene_id "SS.2989"; transcript_id "SS.2989.1"; cov "397.171397"; FPKM "19.423468"; TPM "41.534110"; +CM143131.1 StringTie exon 309309 313888 1000 . . gene_id "SS.2989"; transcript_id "SS.2989.1"; exon_number "1"; cov "397.171387"; +CM143131.1 StringTie transcript 314102 315902 1000 . . gene_id "SS.2990"; transcript_id "SS.2990.1"; cov "1946.001110"; FPKM "95.168210"; TPM "203.502632"; +CM143131.1 StringTie exon 314102 315902 1000 . . gene_id "SS.2990"; transcript_id "SS.2990.1"; exon_number "1"; cov "1946.001099"; +CM143131.1 StringTie transcript 316673 318173 1000 . . gene_id "SS.2991"; transcript_id "SS.2991.1"; cov "734.870087"; FPKM "35.938454"; TPM "76.848875"; +CM143131.1 StringTie exon 316673 318173 1000 . . gene_id "SS.2991"; transcript_id "SS.2991.1"; exon_number "1"; cov "734.870056"; +CM143131.1 StringTie transcript 321082 322123 1000 . . gene_id "SS.2992"; transcript_id "SS.2992.1"; cov "4232.164107"; FPKM "206.971867"; TPM "442.577617"; +CM143131.1 StringTie exon 321082 322123 1000 . . gene_id "SS.2992"; transcript_id "SS.2992.1"; exon_number "1"; cov "4232.164062"; +CM143131.1 StringTie transcript 322875 323737 1000 . . gene_id "SS.2993"; transcript_id "SS.2993.1"; cov "2410.477404"; FPKM "117.883191"; TPM "252.075137"; +CM143131.1 StringTie exon 322875 323737 1000 . . gene_id "SS.2993"; transcript_id "SS.2993.1"; exon_number "1"; cov "2410.477295"; +CM143131.1 StringTie transcript 328690 330493 1000 . . gene_id "SS.2994"; transcript_id "SS.2994.1"; cov "2111.819845"; FPKM "103.277492"; TPM "220.843089"; +CM143131.1 StringTie exon 328690 330493 1000 . . gene_id "SS.2994"; transcript_id "SS.2994.1"; exon_number "1"; cov "2111.819824"; +CM143131.1 StringTie transcript 333777 336333 1000 . . gene_id "SS.2995"; transcript_id "SS.2995.1"; cov "1359.129840"; FPKM "66.467564"; TPM "142.130700"; +CM143131.1 StringTie exon 333777 336333 1000 . . gene_id "SS.2995"; transcript_id "SS.2995.1"; exon_number "1"; cov "1359.129883"; +CM143131.1 StringTie transcript 336563 351880 1000 . . gene_id "SS.2996"; transcript_id "SS.2996.1"; cov "307.050920"; FPKM "15.016172"; TPM "32.109781"; +CM143131.1 StringTie exon 336563 351880 1000 . . gene_id "SS.2996"; transcript_id "SS.2996.1"; exon_number "1"; cov "307.050934"; +CM143131.1 StringTie transcript 352177 355247 1000 . . gene_id "SS.2997"; transcript_id "SS.2997.1"; cov "3378.860957"; FPKM "165.241504"; TPM "353.343631"; +CM143131.1 StringTie exon 352177 355247 1000 . . gene_id "SS.2997"; transcript_id "SS.2997.1"; exon_number "1"; cov "3378.860840"; +CM143131.1 StringTie transcript 365937 370960 1000 . . gene_id "SS.2998"; transcript_id "SS.2998.1"; cov "1483.676951"; FPKM "72.558479"; TPM "155.155186"; +CM143131.1 StringTie exon 365937 370960 1000 . . gene_id "SS.2998"; transcript_id "SS.2998.1"; exon_number "1"; cov "1483.677002"; +CM143131.1 StringTie transcript 371245 381050 1000 + . gene_id "SS.2999"; transcript_id "SS.2999.1"; cov "279.227604"; FPKM "13.655486"; TPM "29.200164"; +CM143131.1 StringTie exon 371245 372855 1000 + . gene_id "SS.2999"; transcript_id "SS.2999.1"; exon_number "1"; cov "767.281799"; +CM143131.1 StringTie exon 372917 381050 1000 + . gene_id "SS.2999"; transcript_id "SS.2999.1"; exon_number "2"; cov "182.564789"; +CM143131.1 StringTie transcript 381331 384429 1000 . . gene_id "SS.3000"; transcript_id "SS.3000.1"; cov "1353.494998"; FPKM "66.191995"; TPM "141.541437"; +CM143131.1 StringTie exon 381331 384429 1000 . . gene_id "SS.3000"; transcript_id "SS.3000.1"; exon_number "1"; cov "1353.494995"; +CM143131.1 StringTie transcript 386811 389367 1000 . . gene_id "SS.3001"; transcript_id "SS.3001.1"; cov "187.494329"; FPKM "9.169316"; TPM "19.607178"; +CM143131.1 StringTie exon 386811 389367 1000 . . gene_id "SS.3001"; transcript_id "SS.3001.1"; exon_number "1"; cov "187.494324"; +CM143131.1 StringTie transcript 389698 390503 1000 + . gene_id "SS.3002"; transcript_id "SS.3002.1"; cov "2419.722535"; FPKM "118.335319"; TPM "253.041944"; +CM143131.1 StringTie exon 389698 389801 1000 + . gene_id "SS.3002"; transcript_id "SS.3002.1"; exon_number "1"; cov "730.471130"; +CM143131.1 StringTie exon 389898 390503 1000 + . gene_id "SS.3002"; transcript_id "SS.3002.1"; exon_number "2"; cov "2709.626953"; +CM143131.1 StringTie transcript 391062 392821 1000 . . gene_id "SS.3003"; transcript_id "SS.3003.1"; cov "373.199432"; FPKM "18.251131"; TPM "39.027247"; +CM143131.1 StringTie exon 391062 392821 1000 . . gene_id "SS.3003"; transcript_id "SS.3003.1"; exon_number "1"; cov "373.199432"; +CM143131.1 StringTie transcript 393083 408684 1000 . . gene_id "SS.3004"; transcript_id "SS.3004.1"; cov "307.923439"; FPKM "15.058842"; TPM "32.201025"; +CM143131.1 StringTie exon 393083 408684 1000 . . gene_id "SS.3004"; transcript_id "SS.3004.1"; exon_number "1"; cov "307.923431"; +CM143131.1 StringTie transcript 400914 404747 1000 + . gene_id "SS.3005"; transcript_id "SS.3005.1"; cov "85.866358"; FPKM "4.199251"; TPM "8.979455"; +CM143131.1 StringTie exon 400914 403090 1000 + . gene_id "SS.3005"; transcript_id "SS.3005.1"; exon_number "1"; cov "59.909874"; +CM143131.1 StringTie exon 403338 404747 1000 + . gene_id "SS.3005"; transcript_id "SS.3005.1"; exon_number "2"; cov "125.942429"; +CM143131.1 StringTie transcript 408983 411324 1000 . . gene_id "SS.3006"; transcript_id "SS.3006.1"; cov "10.831928"; FPKM "0.529730"; TPM "1.132746"; +CM143131.1 StringTie exon 408983 411324 1000 . . gene_id "SS.3006"; transcript_id "SS.3006.1"; exon_number "1"; cov "10.831928"; +CM143131.1 StringTie transcript 411569 412768 1000 . . gene_id "SS.3007"; transcript_id "SS.3007.1"; cov "43.179583"; FPKM "2.111676"; TPM "4.515495"; +CM143131.1 StringTie exon 411569 412768 1000 . . gene_id "SS.3007"; transcript_id "SS.3007.1"; exon_number "1"; cov "43.179585"; +CM143131.1 StringTie transcript 413161 416634 1000 . . gene_id "SS.3008"; transcript_id "SS.3008.1"; cov "413.966321"; FPKM "20.244816"; TPM "43.290436"; +CM143131.1 StringTie exon 413161 416634 1000 . . gene_id "SS.3008"; transcript_id "SS.3008.1"; exon_number "1"; cov "413.966309"; +CM143131.1 StringTie transcript 416885 421815 1000 . . gene_id "SS.3009"; transcript_id "SS.3009.1"; cov "440.722774"; FPKM "21.553327"; TPM "46.088486"; +CM143131.1 StringTie exon 416885 421815 1000 . . gene_id "SS.3009"; transcript_id "SS.3009.1"; exon_number "1"; cov "440.722778"; +CM143131.1 StringTie transcript 422304 425269 1000 . . gene_id "SS.3010"; transcript_id "SS.3010.1"; cov "2475.802765"; FPKM "121.077895"; TPM "258.906522"; +CM143131.1 StringTie exon 422304 425269 1000 . . gene_id "SS.3010"; transcript_id "SS.3010.1"; exon_number "1"; cov "2475.802734"; +CM143131.1 StringTie transcript 472621 473771 1000 . . gene_id "SS.3011"; transcript_id "SS.3011.1"; cov "25.179844"; FPKM "1.231408"; TPM "2.633177"; +CM143131.1 StringTie exon 472621 473771 1000 . . gene_id "SS.3011"; transcript_id "SS.3011.1"; exon_number "1"; cov "25.179844"; +CM143131.1 StringTie transcript 436196 440412 1000 - . gene_id "SS.3012"; transcript_id "SS.3012.1"; cov "2052.777335"; FPKM "100.390048"; TPM "214.668732"; +CM143131.1 StringTie exon 436196 440060 1000 - . gene_id "SS.3012"; transcript_id "SS.3012.1"; exon_number "1"; cov "2109.921631"; +CM143131.1 StringTie exon 440263 440412 1000 - . gene_id "SS.3012"; transcript_id "SS.3012.1"; exon_number "2"; cov "580.359985"; +CM143131.1 StringTie transcript 441740 442869 1000 . . gene_id "SS.3013"; transcript_id "SS.3013.1"; cov "2214.939823"; FPKM "108.320523"; TPM "231.626838"; +CM143131.1 StringTie exon 441740 442869 1000 . . gene_id "SS.3013"; transcript_id "SS.3013.1"; exon_number "1"; cov "2214.939941"; +CM143131.1 StringTie transcript 443119 444494 1000 . . gene_id "SS.3014"; transcript_id "SS.3014.1"; cov "1720.130814"; FPKM "84.122136"; TPM "179.882296"; +CM143131.1 StringTie exon 443119 444494 1000 . . gene_id "SS.3014"; transcript_id "SS.3014.1"; exon_number "1"; cov "1720.130859"; +CM143131.1 StringTie transcript 458809 459972 1000 . . gene_id "SS.3015"; transcript_id "SS.3015.1"; cov "11142.348797"; FPKM "544.910990"; TPM "1165.208639"; +CM143131.1 StringTie exon 458809 459972 1000 . . gene_id "SS.3015"; transcript_id "SS.3015.1"; exon_number "1"; cov "11142.348633"; +CM143131.1 StringTie transcript 468550 469935 1000 . . gene_id "SS.3016"; transcript_id "SS.3016.1"; cov "92365.835498"; FPKM "4517.104947"; TPM "9659.136636"; +CM143131.1 StringTie exon 468550 469935 1000 . . gene_id "SS.3016"; transcript_id "SS.3016.1"; exon_number "1"; cov "92365.835938"; +CM143131.1 StringTie transcript 471599 472106 1000 . . gene_id "SS.3017"; transcript_id "SS.3017.1"; cov "1115.763780"; FPKM "54.565869"; TPM "116.680748"; +CM143131.1 StringTie exon 471599 472106 1000 . . gene_id "SS.3017"; transcript_id "SS.3017.1"; exon_number "1"; cov "1115.763794"; +CM143131.1 StringTie transcript 475000 475621 1000 . . gene_id "SS.3018"; transcript_id "SS.3018.1"; cov "4681.842444"; FPKM "228.963161"; TPM "489.602629"; +CM143131.1 StringTie exon 475000 475621 1000 . . gene_id "SS.3018"; transcript_id "SS.3018.1"; exon_number "1"; cov "4681.842285"; +CM143131.1 StringTie transcript 476033 477290 1000 . . gene_id "SS.3019"; transcript_id "SS.3019.1"; cov "1311.510334"; FPKM "64.138756"; TPM "137.150901"; +CM143131.1 StringTie exon 476033 477290 1000 . . gene_id "SS.3019"; transcript_id "SS.3019.1"; exon_number "1"; cov "1311.510376"; +CM143131.1 StringTie transcript 477560 482241 1000 . . gene_id "SS.3020"; transcript_id "SS.3020.1"; cov "230.471166"; FPKM "11.271077"; TPM "24.101471"; +CM143131.1 StringTie exon 477560 482241 1000 . . gene_id "SS.3020"; transcript_id "SS.3020.1"; exon_number "1"; cov "230.471161"; +CM143131.1 StringTie transcript 482462 494253 1000 . . gene_id "SS.3021"; transcript_id "SS.3021.1"; cov "239.577680"; FPKM "11.716427"; TPM "25.053782"; +CM143131.1 StringTie exon 482462 494253 1000 . . gene_id "SS.3021"; transcript_id "SS.3021.1"; exon_number "1"; cov "239.577682"; +CM143131.1 StringTie transcript 495596 497776 1000 . . gene_id "SS.3022"; transcript_id "SS.3022.1"; cov "350.684548"; FPKM "17.150052"; TPM "36.672758"; +CM143131.1 StringTie exon 495596 497776 1000 . . gene_id "SS.3022"; transcript_id "SS.3022.1"; exon_number "1"; cov "350.684540"; +CM143131.1 StringTie transcript 499724 503270 1000 . . gene_id "SS.3023"; transcript_id "SS.3023.1"; cov "2822.506907"; FPKM "138.033287"; TPM "295.163030"; +CM143131.1 StringTie exon 499724 503270 1000 . . gene_id "SS.3023"; transcript_id "SS.3023.1"; exon_number "1"; cov "2822.506836"; +CM143131.1 StringTie transcript 506023 507080 1000 . . gene_id "SS.3024"; transcript_id "SS.3024.1"; cov "8470.160681"; FPKM "414.228968"; TPM "885.765163"; +CM143131.1 StringTie exon 506023 507080 1000 . . gene_id "SS.3024"; transcript_id "SS.3024.1"; exon_number "1"; cov "8470.161133"; +CM143131.1 StringTie transcript 510328 511586 1000 . . gene_id "SS.3025"; transcript_id "SS.3025.1"; cov "1045.980937"; FPKM "51.153174"; TPM "109.383223"; +CM143131.1 StringTie exon 510328 511586 1000 . . gene_id "SS.3025"; transcript_id "SS.3025.1"; exon_number "1"; cov "1045.980957"; +CM143131.1 StringTie transcript 513674 516221 1000 . . gene_id "SS.3026"; transcript_id "SS.3026.1"; cov "660.030220"; FPKM "32.278447"; TPM "69.022513"; +CM143131.1 StringTie exon 513674 516221 1000 . . gene_id "SS.3026"; transcript_id "SS.3026.1"; exon_number "1"; cov "660.030212"; +CM143131.1 StringTie transcript 517191 519579 1000 . . gene_id "SS.3027"; transcript_id "SS.3027.1"; cov "1072.473420"; FPKM "52.448776"; TPM "112.153669"; +CM143131.1 StringTie exon 517191 519579 1000 . . gene_id "SS.3027"; transcript_id "SS.3027.1"; exon_number "1"; cov "1072.473389"; +CM143131.1 StringTie transcript 520542 530704 1000 . . gene_id "SS.3028"; transcript_id "SS.3028.1"; cov "642.445439"; FPKM "31.418473"; TPM "67.183588"; +CM143131.1 StringTie exon 520542 530704 1000 . . gene_id "SS.3028"; transcript_id "SS.3028.1"; exon_number "1"; cov "642.445435"; +CM143131.1 StringTie transcript 531142 533538 1000 . . gene_id "SS.3029"; transcript_id "SS.3029.1"; cov "28793.558615"; FPKM "1408.134570"; TPM "3011.079967"; +CM143131.1 StringTie exon 531142 533538 1000 . . gene_id "SS.3029"; transcript_id "SS.3029.1"; exon_number "1"; cov "28793.558594"; +CM143131.1 StringTie transcript 535620 536309 1000 . . gene_id "SS.3030"; transcript_id "SS.3030.1"; cov "111352.915942"; FPKM "5445.658611"; TPM "11644.706337"; +CM143131.1 StringTie exon 535620 536309 1000 . . gene_id "SS.3030"; transcript_id "SS.3030.1"; exon_number "1"; cov "111352.914062"; +CM143131.1 StringTie transcript 536871 546241 1000 + . gene_id "SS.3031"; transcript_id "SS.3031.1"; cov "2749.991387"; FPKM "134.486952"; TPM "287.579736"; +CM143131.1 StringTie exon 536871 544944 1000 + . gene_id "SS.3031"; transcript_id "SS.3031.1"; exon_number "1"; cov "2614.529541"; +CM143131.1 StringTie exon 545028 546241 1000 + . gene_id "SS.3031"; transcript_id "SS.3031.1"; exon_number "2"; cov "3650.912598"; +CM143131.1 StringTie transcript 546518 548841 1000 . . gene_id "SS.3032"; transcript_id "SS.3032.1"; cov "2706.648021"; FPKM "132.367267"; TPM "283.047113"; +CM143131.1 StringTie exon 546518 548841 1000 . . gene_id "SS.3032"; transcript_id "SS.3032.1"; exon_number "1"; cov "2706.647949"; +CM143131.1 StringTie transcript 549170 554631 1000 . . gene_id "SS.3033"; transcript_id "SS.3033.1"; cov "461.131820"; FPKM "22.551421"; TPM "48.222757"; +CM143131.1 StringTie exon 549170 554631 1000 . . gene_id "SS.3033"; transcript_id "SS.3033.1"; exon_number "1"; cov "461.131805"; +CM143131.1 StringTie transcript 554899 556986 1000 . . gene_id "SS.3034"; transcript_id "SS.3034.1"; cov "1287.907567"; FPKM "62.984475"; TPM "134.682646"; +CM143131.1 StringTie exon 554899 556986 1000 . . gene_id "SS.3034"; transcript_id "SS.3034.1"; exon_number "1"; cov "1287.907593"; +CM143131.1 StringTie transcript 557281 558810 1000 . . gene_id "SS.3035"; transcript_id "SS.3035.1"; cov "1354.423529"; FPKM "66.237405"; TPM "141.638538"; +CM143131.1 StringTie exon 557281 558810 1000 . . gene_id "SS.3035"; transcript_id "SS.3035.1"; exon_number "1"; cov "1354.423584"; +CM143131.1 StringTie transcript 559553 562402 1000 . . gene_id "SS.3036"; transcript_id "SS.3036.1"; cov "839.737193"; FPKM "41.066927"; TPM "87.815330"; +CM143131.1 StringTie exon 559553 562402 1000 . . gene_id "SS.3036"; transcript_id "SS.3036.1"; exon_number "1"; cov "839.737183"; +CM143131.1 StringTie transcript 562683 565024 1000 + . gene_id "SS.3037"; transcript_id "SS.3037.1"; cov "193.795718"; FPKM "9.477483"; TPM "20.266144"; +CM143131.1 StringTie exon 562683 562744 1000 + . gene_id "SS.3037"; transcript_id "SS.3037.1"; exon_number "1"; cov "17.258064"; +CM143131.1 StringTie exon 562845 565024 1000 + . gene_id "SS.3037"; transcript_id "SS.3037.1"; exon_number "2"; cov "198.816513"; +CM143131.1 StringTie transcript 570274 572002 1000 + . gene_id "SS.3038"; transcript_id "SS.3038.1"; cov "3788.023743"; FPKM "185.251405"; TPM "396.131738"; +CM143131.1 StringTie exon 570274 570564 1000 + . gene_id "SS.3038"; transcript_id "SS.3038.1"; exon_number "1"; cov "2913.979492"; +CM143131.1 StringTie exon 570862 572002 1000 + . gene_id "SS.3038"; transcript_id "SS.3038.1"; exon_number "2"; cov "4010.939453"; +CM143131.1 StringTie transcript 584657 586227 1000 . . gene_id "SS.3039"; transcript_id "SS.3039.1"; cov "5127.241566"; FPKM "250.745182"; TPM "536.180143"; +CM143131.1 StringTie exon 584657 586227 1000 . . gene_id "SS.3039"; transcript_id "SS.3039.1"; exon_number "1"; cov "5127.241699"; +CM143131.1 StringTie transcript 586861 590881 1000 . . gene_id "SS.3040"; transcript_id "SS.3040.1"; cov "360.865954"; FPKM "17.647969"; TPM "37.737477"; +CM143131.1 StringTie exon 586861 590881 1000 . . gene_id "SS.3040"; transcript_id "SS.3040.1"; exon_number "1"; cov "360.865967"; +CM143131.1 StringTie transcript 591086 592501 1000 . . gene_id "SS.3041"; transcript_id "SS.3041.1"; cov "1436.068503"; FPKM "70.230211"; TPM "150.176543"; +CM143131.1 StringTie exon 591086 592501 1000 . . gene_id "SS.3041"; transcript_id "SS.3041.1"; exon_number "1"; cov "1436.068481"; +CM143131.1 StringTie transcript 592908 594828 1000 . . gene_id "SS.3042"; transcript_id "SS.3042.1"; cov "825.661635"; FPKM "40.378569"; TPM "86.343381"; +CM143131.1 StringTie exon 592908 594828 1000 . . gene_id "SS.3042"; transcript_id "SS.3042.1"; exon_number "1"; cov "825.661621"; +CM143131.1 StringTie transcript 602029 608187 1000 . . gene_id "SS.3043"; transcript_id "SS.3043.1"; cov "2993.839260"; FPKM "146.412210"; TPM "313.080073"; +CM143131.1 StringTie exon 602029 608187 1000 . . gene_id "SS.3043"; transcript_id "SS.3043.1"; exon_number "1"; cov "2993.839355"; +CM143131.1 StringTie transcript 608539 609823 1000 . . gene_id "SS.3044"; transcript_id "SS.3044.1"; cov "1209.717510"; FPKM "59.160629"; TPM "126.505939"; +CM143131.1 StringTie exon 608539 609823 1000 . . gene_id "SS.3044"; transcript_id "SS.3044.1"; exon_number "1"; cov "1209.717529"; +CM143131.1 StringTie transcript 610395 612368 1000 . . gene_id "SS.3045"; transcript_id "SS.3045.1"; cov "2228.018237"; FPKM "108.960117"; TPM "232.994510"; +CM143131.1 StringTie exon 610395 612368 1000 . . gene_id "SS.3045"; transcript_id "SS.3045.1"; exon_number "1"; cov "2228.018311"; +CM143131.1 StringTie transcript 614032 614534 1000 . . gene_id "SS.3046"; transcript_id "SS.3046.1"; cov "238.001988"; FPKM "11.639368"; TPM "24.889005"; +CM143131.1 StringTie exon 614032 614534 1000 . . gene_id "SS.3046"; transcript_id "SS.3046.1"; exon_number "1"; cov "238.001984"; +CM143131.1 StringTie transcript 615087 625761 1000 . . gene_id "SS.3047"; transcript_id "SS.3047.1"; cov "288.031850"; FPKM "14.086053"; TPM "30.120866"; +CM143131.1 StringTie exon 615087 625761 1000 . . gene_id "SS.3047"; transcript_id "SS.3047.1"; exon_number "1"; cov "288.031860"; +CM143131.1 StringTie transcript 626075 631786 1000 . . gene_id "SS.3048"; transcript_id "SS.3048.1"; cov "810.994398"; FPKM "39.661275"; TPM "84.809558"; +CM143131.1 StringTie exon 626075 631786 1000 . . gene_id "SS.3048"; transcript_id "SS.3048.1"; exon_number "1"; cov "810.994385"; +CM143131.1 StringTie transcript 632154 636261 1000 . . gene_id "SS.3049"; transcript_id "SS.3049.1"; cov "1283.297712"; FPKM "62.759032"; TPM "134.200572"; +CM143131.1 StringTie exon 632154 636261 1000 . . gene_id "SS.3049"; transcript_id "SS.3049.1"; exon_number "1"; cov "1283.297729"; +CM143131.1 StringTie transcript 636584 639605 1000 . . gene_id "SS.3050"; transcript_id "SS.3050.1"; cov "354.547651"; FPKM "17.338975"; TPM "37.076741"; +CM143131.1 StringTie exon 636584 639605 1000 . . gene_id "SS.3050"; transcript_id "SS.3050.1"; exon_number "1"; cov "354.547638"; +CM143131.1 StringTie transcript 641059 644363 1000 + . gene_id "SS.3051"; transcript_id "SS.3051.1"; cov "1155.705295"; FPKM "56.519189"; TPM "120.857623"; +CM143131.1 StringTie exon 641059 644363 1000 + . gene_id "SS.3051"; transcript_id "SS.3051.1"; exon_number "1"; cov "1155.705322"; +CM143131.1 StringTie transcript 641173 642716 1000 + . gene_id "SS.3051"; transcript_id "SS.3051.2"; cov "1042.918125"; FPKM "51.003389"; TPM "109.062930"; +CM143131.1 StringTie exon 641173 641430 1000 + . gene_id "SS.3051"; transcript_id "SS.3051.2"; exon_number "1"; cov "613.364319"; +CM143131.1 StringTie exon 641546 642716 1000 + . gene_id "SS.3051"; transcript_id "SS.3051.2"; exon_number "2"; cov "1137.559326"; +CM143131.1 StringTie transcript 659813 660604 1000 . . gene_id "SS.3052"; transcript_id "SS.3052.1"; cov "7.493687"; FPKM "0.366475"; TPM "0.783651"; +CM143131.1 StringTie exon 659813 660604 1000 . . gene_id "SS.3052"; transcript_id "SS.3052.1"; exon_number "1"; cov "7.493687"; +CM143131.1 StringTie transcript 644647 646800 1000 . . gene_id "SS.3053"; transcript_id "SS.3053.1"; cov "1144.033890"; FPKM "55.948405"; TPM "119.637089"; +CM143131.1 StringTie exon 644647 646800 1000 . . gene_id "SS.3053"; transcript_id "SS.3053.1"; exon_number "1"; cov "1144.033936"; +CM143131.1 StringTie transcript 647075 651248 1000 . . gene_id "SS.3054"; transcript_id "SS.3054.1"; cov "910.640393"; FPKM "44.534413"; TPM "95.230016"; +CM143131.1 StringTie exon 647075 651248 1000 . . gene_id "SS.3054"; transcript_id "SS.3054.1"; exon_number "1"; cov "910.640381"; +CM143131.1 StringTie transcript 651522 652768 1000 . . gene_id "SS.3055"; transcript_id "SS.3055.1"; cov "1156.062550"; FPKM "56.536660"; TPM "120.894983"; +CM143131.1 StringTie exon 651522 652768 1000 . . gene_id "SS.3055"; transcript_id "SS.3055.1"; exon_number "1"; cov "1156.062500"; +CM143131.1 StringTie transcript 702341 707862 1000 . . gene_id "SS.3056"; transcript_id "SS.3056.1"; cov "233.802427"; FPKM "11.433991"; TPM "24.449837"; +CM143131.1 StringTie exon 702341 707862 1000 . . gene_id "SS.3056"; transcript_id "SS.3056.1"; exon_number "1"; cov "233.802429"; +CM143131.1 StringTie transcript 660858 665944 1000 . . gene_id "SS.3057"; transcript_id "SS.3057.1"; cov "95.559269"; FPKM "4.673278"; TPM "9.993089"; +CM143131.1 StringTie exon 660858 665944 1000 . . gene_id "SS.3057"; transcript_id "SS.3057.1"; exon_number "1"; cov "95.559265"; +CM143131.1 StringTie transcript 666151 671564 1000 . . gene_id "SS.3058"; transcript_id "SS.3058.1"; cov "172.910602"; FPKM "8.456106"; TPM "18.082088"; +CM143131.1 StringTie exon 666151 671564 1000 . . gene_id "SS.3058"; transcript_id "SS.3058.1"; exon_number "1"; cov "172.910599"; +CM143131.1 StringTie transcript 672136 674487 1000 . . gene_id "SS.3059"; transcript_id "SS.3059.1"; cov "4654.086310"; FPKM "227.605761"; TPM "486.700037"; +CM143131.1 StringTie exon 672136 674487 1000 . . gene_id "SS.3059"; transcript_id "SS.3059.1"; exon_number "1"; cov "4654.086426"; +CM143131.1 StringTie transcript 676248 677775 1000 . . gene_id "SS.3060"; transcript_id "SS.3060.1"; cov "8014.163613"; FPKM "391.928660"; TPM "838.079372"; +CM143131.1 StringTie exon 676248 677775 1000 . . gene_id "SS.3060"; transcript_id "SS.3060.1"; exon_number "1"; cov "8014.163574"; +CM143131.1 StringTie transcript 680223 684488 1000 - . gene_id "SS.3061"; transcript_id "SS.3061.1"; cov "393.530944"; FPKM "19.245434"; TPM "41.153411"; +CM143131.1 StringTie exon 680223 684346 1000 - . gene_id "SS.3061"; transcript_id "SS.3061.1"; exon_number "1"; cov "399.043152"; +CM143131.1 StringTie exon 684428 684488 1000 - . gene_id "SS.3061"; transcript_id "SS.3061.1"; exon_number "2"; cov "20.868853"; +CM143131.1 StringTie transcript 684796 691169 1000 . . gene_id "SS.3062"; transcript_id "SS.3062.1"; cov "298.791654"; FPKM "14.612256"; TPM "31.246071"; +CM143131.1 StringTie exon 684796 691169 1000 . . gene_id "SS.3062"; transcript_id "SS.3062.1"; exon_number "1"; cov "298.791656"; +CM143131.1 StringTie transcript 691437 696546 1000 . . gene_id "SS.3063"; transcript_id "SS.3063.1"; cov "1921.436791"; FPKM "93.966904"; TPM "200.933824"; +CM143131.1 StringTie exon 691437 696546 1000 . . gene_id "SS.3063"; transcript_id "SS.3063.1"; exon_number "1"; cov "1921.436768"; +CM143131.1 StringTie transcript 698028 701408 1000 . . gene_id "SS.3064"; transcript_id "SS.3064.1"; cov "1094.648920"; FPKM "53.533257"; TPM "114.472667"; +CM143131.1 StringTie exon 698028 701408 1000 . . gene_id "SS.3064"; transcript_id "SS.3064.1"; exon_number "1"; cov "1094.648926"; +CM143131.1 StringTie transcript 708415 709234 1000 . . gene_id "SS.3065"; transcript_id "SS.3065.1"; cov "15043.142683"; FPKM "735.677362"; TPM "1573.133289"; +CM143131.1 StringTie exon 708415 709234 1000 . . gene_id "SS.3065"; transcript_id "SS.3065.1"; exon_number "1"; cov "15043.142578"; +CM143131.1 StringTie transcript 712540 714794 1000 . . gene_id "SS.3066"; transcript_id "SS.3066.1"; cov "797.431486"; FPKM "38.997988"; TPM "83.391220"; +CM143131.1 StringTie exon 712540 714794 1000 . . gene_id "SS.3066"; transcript_id "SS.3066.1"; exon_number "1"; cov "797.431458"; +CM143131.1 StringTie transcript 715121 717190 1000 . . gene_id "SS.3067"; transcript_id "SS.3067.1"; cov "1072.049758"; FPKM "52.428057"; TPM "112.109364"; +CM143131.1 StringTie exon 715121 717190 1000 . . gene_id "SS.3067"; transcript_id "SS.3067.1"; exon_number "1"; cov "1072.049805"; +CM143131.1 StringTie transcript 717582 726624 1000 + . gene_id "SS.3068"; transcript_id "SS.3068.1"; cov "290.563406"; FPKM "14.209858"; TPM "30.385603"; +CM143131.1 StringTie exon 717582 718688 1000 + . gene_id "SS.3068"; transcript_id "SS.3068.1"; exon_number "1"; cov "184.267395"; +CM143131.1 StringTie exon 718760 723922 1000 + . gene_id "SS.3068"; transcript_id "SS.3068.1"; exon_number "2"; cov "380.692230"; +CM143131.1 StringTie exon 723984 724010 1000 + . gene_id "SS.3068"; transcript_id "SS.3068.1"; exon_number "3"; cov "38.185184"; +CM143131.1 StringTie exon 724078 724125 1000 + . gene_id "SS.3068"; transcript_id "SS.3068.1"; exon_number "4"; cov "32.729168"; +CM143131.1 StringTie exon 724205 726624 1000 + . gene_id "SS.3068"; transcript_id "SS.3068.1"; exon_number "5"; cov "154.829849"; +CM143131.1 StringTie transcript 724911 726624 1000 . . gene_id "SS.3069"; transcript_id "SS.3069.1"; cov "851.156214"; FPKM "41.625369"; TPM "89.009471"; +CM143131.1 StringTie exon 724911 726624 1000 . . gene_id "SS.3069"; transcript_id "SS.3069.1"; exon_number "1"; cov "851.156189"; +CM143131.1 StringTie transcript 727122 727886 1000 . . gene_id "SS.3070"; transcript_id "SS.3070.1"; cov "14464.818301"; FPKM "707.394698"; TPM "1512.655146"; +CM143131.1 StringTie exon 727122 727886 1000 . . gene_id "SS.3070"; transcript_id "SS.3070.1"; exon_number "1"; cov "14464.818359"; +CM143131.1 StringTie transcript 731264 732844 1000 . . gene_id "SS.3071"; transcript_id "SS.3071.1"; cov "4597.492094"; FPKM "224.838049"; TPM "480.781710"; +CM143131.1 StringTie exon 731264 732844 1000 . . gene_id "SS.3071"; transcript_id "SS.3071.1"; exon_number "1"; cov "4597.492188"; +CM143131.1 StringTie transcript 733165 739278 1000 . . gene_id "SS.3072"; transcript_id "SS.3072.1"; cov "236.711155"; FPKM "11.576241"; TPM "24.754016"; +CM143131.1 StringTie exon 733165 739278 1000 . . gene_id "SS.3072"; transcript_id "SS.3072.1"; exon_number "1"; cov "236.711151"; +CM143131.1 StringTie transcript 739618 745062 1000 . . gene_id "SS.3073"; transcript_id "SS.3073.1"; cov "154.802020"; FPKM "7.570515"; TPM "16.188387"; +CM143131.1 StringTie exon 739618 745062 1000 . . gene_id "SS.3073"; transcript_id "SS.3073.1"; exon_number "1"; cov "154.802017"; +CM143131.1 StringTie transcript 739618 745062 1000 + . gene_id "SS.3074"; transcript_id "SS.3074.1"; cov "120.163161"; FPKM "5.876519"; TPM "12.566036"; +CM143131.1 StringTie exon 739618 739811 1000 + . gene_id "SS.3074"; transcript_id "SS.3074.1"; exon_number "1"; cov "94.602417"; +CM143131.1 StringTie exon 739931 745062 1000 + . gene_id "SS.3074"; transcript_id "SS.3074.1"; exon_number "2"; cov "121.129410"; +CM143131.1 StringTie transcript 745403 747580 1000 . . gene_id "SS.3075"; transcript_id "SS.3075.1"; cov "114.879247"; FPKM "5.618112"; TPM "12.013472"; +CM143131.1 StringTie exon 745403 747580 1000 . . gene_id "SS.3075"; transcript_id "SS.3075.1"; exon_number "1"; cov "114.879250"; +CM143131.1 StringTie transcript 747782 751026 1000 . . gene_id "SS.3076"; transcript_id "SS.3076.1"; cov "215.706317"; FPKM "10.549009"; TPM "22.557440"; +CM143131.1 StringTie exon 747782 751026 1000 . . gene_id "SS.3076"; transcript_id "SS.3076.1"; exon_number "1"; cov "215.706314"; +CM143131.1 StringTie transcript 754018 755210 1000 . . gene_id "SS.3077"; transcript_id "SS.3077.1"; cov "453.039711"; FPKM "22.155680"; TPM "47.376527"; +CM143131.1 StringTie exon 754018 755210 1000 . . gene_id "SS.3077"; transcript_id "SS.3077.1"; exon_number "1"; cov "453.039703"; +CM143131.1 StringTie transcript 757054 760423 1000 . . gene_id "SS.3078"; transcript_id "SS.3078.1"; cov "170.152485"; FPKM "8.321222"; TPM "17.793658"; +CM143131.1 StringTie exon 757054 760423 1000 . . gene_id "SS.3078"; transcript_id "SS.3078.1"; exon_number "1"; cov "170.152481"; +CM143131.1 StringTie transcript 761158 762500 1000 + . gene_id "SS.3079"; transcript_id "SS.3079.1"; cov "14465.723853"; FPKM "707.438983"; TPM "1512.749844"; +CM143131.1 StringTie exon 761158 761292 1000 + . gene_id "SS.3079"; transcript_id "SS.3079.1"; exon_number "1"; cov "5242.429688"; +CM143131.1 StringTie exon 762091 762500 1000 + . gene_id "SS.3079"; transcript_id "SS.3079.1"; exon_number "2"; cov "17502.662109"; +CM143131.1 StringTie transcript 765712 772156 1000 . . gene_id "SS.3080"; transcript_id "SS.3080.1"; cov "782.226843"; FPKM "38.254412"; TPM "81.801198"; +CM143131.1 StringTie exon 765712 772156 1000 . . gene_id "SS.3080"; transcript_id "SS.3080.1"; exon_number "1"; cov "782.226868"; +CM143131.1 StringTie transcript 778186 779949 1000 . . gene_id "SS.3081"; transcript_id "SS.3081.1"; cov "10928.875283"; FPKM "534.471175"; TPM "1142.884694"; +CM143131.1 StringTie exon 778186 779949 1000 . . gene_id "SS.3081"; transcript_id "SS.3081.1"; exon_number "1"; cov "10928.875000"; +CM143131.1 StringTie transcript 782425 783740 1000 . . gene_id "SS.3082"; transcript_id "SS.3082.1"; cov "2859.287234"; FPKM "139.832011"; TPM "299.009324"; +CM143131.1 StringTie exon 782425 783740 1000 . . gene_id "SS.3082"; transcript_id "SS.3082.1"; exon_number "1"; cov "2859.287354"; +CM143131.1 StringTie transcript 791463 792513 1000 . . gene_id "SS.3083"; transcript_id "SS.3083.1"; cov "5722.126546"; FPKM "279.837734"; TPM "598.390107"; +CM143131.1 StringTie exon 791463 792513 1000 . . gene_id "SS.3083"; transcript_id "SS.3083.1"; exon_number "1"; cov "5722.126465"; +CM143131.1 StringTie transcript 793048 806435 1000 . . gene_id "SS.3084"; transcript_id "SS.3084.1"; cov "588.984389"; FPKM "28.803987"; TPM "61.592911"; +CM143131.1 StringTie exon 793048 806435 1000 . . gene_id "SS.3084"; transcript_id "SS.3084.1"; exon_number "1"; cov "588.984375"; +CM143131.1 StringTie transcript 807069 808107 1000 . . gene_id "SS.3085"; transcript_id "SS.3085.1"; cov "2044.839269"; FPKM "100.001841"; TPM "213.838610"; +CM143131.1 StringTie exon 807069 808107 1000 . . gene_id "SS.3085"; transcript_id "SS.3085.1"; exon_number "1"; cov "2044.839233"; +CM143131.1 StringTie transcript 813497 819322 1000 + . gene_id "SS.3086"; transcript_id "SS.3086.1"; cov "193.978076"; FPKM "9.486401"; TPM "20.285214"; +CM143131.1 StringTie exon 813497 814001 1000 + . gene_id "SS.3086"; transcript_id "SS.3086.1"; exon_number "1"; cov "51.348515"; +CM143131.1 StringTie exon 814081 819322 1000 + . gene_id "SS.3086"; transcript_id "SS.3086.1"; exon_number "2"; cov "207.718613"; +CM143131.1 StringTie transcript 819545 820676 1000 . . gene_id "SS.3087"; transcript_id "SS.3087.1"; cov "1595.829505"; FPKM "78.043243"; TPM "166.883514"; +CM143131.1 StringTie exon 819545 820676 1000 . . gene_id "SS.3087"; transcript_id "SS.3087.1"; exon_number "1"; cov "1595.829468"; +CM143131.1 StringTie transcript 820936 823634 1000 . . gene_id "SS.3088"; transcript_id "SS.3088.1"; cov "664.266765"; FPKM "32.485634"; TPM "69.465549"; +CM143131.1 StringTie exon 820936 823634 1000 . . gene_id "SS.3088"; transcript_id "SS.3088.1"; exon_number "1"; cov "664.266785"; +CM143131.1 StringTie transcript 823912 826382 1000 . . gene_id "SS.3089"; transcript_id "SS.3089.1"; cov "523.867260"; FPKM "25.619466"; TPM "54.783302"; +CM143131.1 StringTie exon 823912 826382 1000 . . gene_id "SS.3089"; transcript_id "SS.3089.1"; exon_number "1"; cov "523.867249"; +CM143131.1 StringTie transcript 848497 851408 1000 . . gene_id "SS.3090"; transcript_id "SS.3090.1"; cov "100.386676"; FPKM "4.909360"; TPM "10.497914"; +CM143131.1 StringTie exon 848497 851408 1000 . . gene_id "SS.3090"; transcript_id "SS.3090.1"; exon_number "1"; cov "100.386673"; +CM143131.1 StringTie transcript 826635 830015 1000 - . gene_id "SS.3091"; transcript_id "SS.3091.1"; cov "334.241055"; FPKM "16.345891"; TPM "34.953184"; +CM143131.1 StringTie exon 826635 829842 1000 - . gene_id "SS.3091"; transcript_id "SS.3091.1"; exon_number "1"; cov "334.063293"; +CM143131.1 StringTie exon 829926 830015 1000 - . gene_id "SS.3091"; transcript_id "SS.3091.1"; exon_number "2"; cov "340.577789"; +CM143131.1 StringTie transcript 830297 831505 1000 . . gene_id "SS.3092"; transcript_id "SS.3092.1"; cov "453.531844"; FPKM "22.179748"; TPM "47.427991"; +CM143131.1 StringTie exon 830297 831505 1000 . . gene_id "SS.3092"; transcript_id "SS.3092.1"; exon_number "1"; cov "453.531830"; +CM143131.1 StringTie transcript 838554 842169 1000 - . gene_id "SS.3093"; transcript_id "SS.3093.1"; cov "210.729797"; FPKM "10.305635"; TPM "22.037021"; +CM143131.1 StringTie exon 838554 838971 1000 - . gene_id "SS.3093"; transcript_id "SS.3093.1"; exon_number "1"; cov "84.225761"; +CM143131.1 StringTie exon 839033 839164 1000 - . gene_id "SS.3093"; transcript_id "SS.3093.1"; exon_number "2"; cov "55.112225"; +CM143131.1 StringTie exon 839230 842169 1000 - . gene_id "SS.3093"; transcript_id "SS.3093.1"; exon_number "3"; cov "235.702652"; +CM143131.1 StringTie transcript 838554 842169 1000 - . gene_id "SS.3093"; transcript_id "SS.3093.2"; cov "39.947618"; FPKM "1.953618"; TPM "4.177513"; +CM143131.1 StringTie exon 838554 839164 1000 - . gene_id "SS.3093"; transcript_id "SS.3093.2"; exon_number "1"; cov "15.279572"; +CM143131.1 StringTie exon 839230 842169 1000 - . gene_id "SS.3093"; transcript_id "SS.3093.2"; exon_number "2"; cov "45.074207"; +CM143131.1 StringTie transcript 842483 845153 1000 . . gene_id "SS.3094"; transcript_id "SS.3094.1"; cov "790.294646"; FPKM "38.648964"; TPM "82.644886"; +CM143131.1 StringTie exon 842483 845153 1000 . . gene_id "SS.3094"; transcript_id "SS.3094.1"; exon_number "1"; cov "790.294617"; +CM143131.1 StringTie transcript 845586 846744 1000 . . gene_id "SS.3095"; transcript_id "SS.3095.1"; cov "1699.668680"; FPKM "83.121446"; TPM "177.742473"; +CM143131.1 StringTie exon 845586 846744 1000 . . gene_id "SS.3095"; transcript_id "SS.3095.1"; exon_number "1"; cov "1699.668701"; +CM143131.1 StringTie transcript 852853 854497 1000 . . gene_id "SS.3096"; transcript_id "SS.3096.1"; cov "1859.362918"; FPKM "90.931213"; TPM "194.442462"; +CM143131.1 StringTie exon 852853 854497 1000 . . gene_id "SS.3096"; transcript_id "SS.3096.1"; exon_number "1"; cov "1859.362915"; +CM143131.1 StringTie transcript 863871 866386 1000 . . gene_id "SS.3097"; transcript_id "SS.3097.1"; cov "1143.082273"; FPKM "55.901866"; TPM "119.537574"; +CM143131.1 StringTie exon 863871 866386 1000 . . gene_id "SS.3097"; transcript_id "SS.3097.1"; exon_number "1"; cov "1143.082275"; +CM143131.1 StringTie transcript 869194 873612 1000 . . gene_id "SS.3098"; transcript_id "SS.3098.1"; cov "3586.459154"; FPKM "175.393990"; TPM "375.053166"; +CM143131.1 StringTie exon 869194 873612 1000 . . gene_id "SS.3098"; transcript_id "SS.3098.1"; exon_number "1"; cov "3586.459229"; +CM143131.1 StringTie transcript 874442 878354 1000 . . gene_id "SS.3099"; transcript_id "SS.3099.1"; cov "1026.499872"; FPKM "50.200462"; TPM "107.345995"; +CM143131.1 StringTie exon 874442 878354 1000 . . gene_id "SS.3099"; transcript_id "SS.3099.1"; exon_number "1"; cov "1026.499878"; +CM143131.1 StringTie transcript 878592 879668 1000 . . gene_id "SS.3100"; transcript_id "SS.3100.1"; cov "20476.882080"; FPKM "1001.411667"; TPM "2141.365374"; +CM143131.1 StringTie exon 878592 879668 1000 . . gene_id "SS.3100"; transcript_id "SS.3100.1"; exon_number "1"; cov "20476.882812"; +CM143131.1 StringTie transcript 881735 882440 1000 . . gene_id "SS.3101"; transcript_id "SS.3101.1"; cov "4147.373938"; FPKM "202.825246"; TPM "433.710704"; +CM143131.1 StringTie exon 881735 882440 1000 . . gene_id "SS.3101"; transcript_id "SS.3101.1"; exon_number "1"; cov "4147.374023"; +CM143131.1 StringTie transcript 882734 885428 1000 . . gene_id "SS.3102"; transcript_id "SS.3102.1"; cov "356.675325"; FPKM "17.443028"; TPM "37.299243"; +CM143131.1 StringTie exon 882734 885428 1000 . . gene_id "SS.3102"; transcript_id "SS.3102.1"; exon_number "1"; cov "356.675323"; +CM143131.1 StringTie transcript 885740 887035 1000 . . gene_id "SS.3103"; transcript_id "SS.3103.1"; cov "1922.800154"; FPKM "94.033579"; TPM "201.076397"; +CM143131.1 StringTie exon 885740 887035 1000 . . gene_id "SS.3103"; transcript_id "SS.3103.1"; exon_number "1"; cov "1922.800171"; +CM143131.1 StringTie transcript 888040 888751 1000 . . gene_id "SS.3104"; transcript_id "SS.3104.1"; cov "1426.724719"; FPKM "69.773258"; TPM "149.199419"; +CM143131.1 StringTie exon 888040 888751 1000 . . gene_id "SS.3104"; transcript_id "SS.3104.1"; exon_number "1"; cov "1426.724731"; +CM143131.1 StringTie transcript 889223 890273 1000 . . gene_id "SS.3105"; transcript_id "SS.3105.1"; cov "736.773549"; FPKM "36.031542"; TPM "77.047929"; +CM143131.1 StringTie exon 889223 890273 1000 . . gene_id "SS.3105"; transcript_id "SS.3105.1"; exon_number "1"; cov "736.773560"; +CM143131.1 StringTie transcript 890642 892430 1000 . . gene_id "SS.3106"; transcript_id "SS.3106.1"; cov "194.366685"; FPKM "9.505405"; TPM "20.325853"; +CM143131.1 StringTie exon 890642 892430 1000 . . gene_id "SS.3106"; transcript_id "SS.3106.1"; exon_number "1"; cov "194.366684"; +CM143131.1 StringTie transcript 908809 910363 1000 . . gene_id "SS.3107"; transcript_id "SS.3107.1"; cov "217.688746"; FPKM "10.645959"; TPM "22.764752"; +CM143131.1 StringTie exon 908809 910363 1000 . . gene_id "SS.3107"; transcript_id "SS.3107.1"; exon_number "1"; cov "217.688751"; +CM143131.1 StringTie transcript 892774 905240 1000 . . gene_id "SS.3108"; transcript_id "SS.3108.1"; cov "2107.847758"; FPKM "103.083239"; TPM "220.427709"; +CM143131.1 StringTie exon 892774 905240 1000 . . gene_id "SS.3108"; transcript_id "SS.3108.1"; exon_number "1"; cov "2107.847656"; +CM143131.1 StringTie transcript 904767 905240 1000 . . gene_id "SS.3109"; transcript_id "SS.3109.1"; cov "789.757714"; FPKM "38.622706"; TPM "82.588737"; +CM143131.1 StringTie exon 904767 905240 1000 . . gene_id "SS.3109"; transcript_id "SS.3109.1"; exon_number "1"; cov "789.757690"; +CM143131.1 StringTie transcript 911232 914400 1000 . . gene_id "SS.3110"; transcript_id "SS.3110.1"; cov "217.120227"; FPKM "10.618156"; TPM "22.705299"; +CM143131.1 StringTie exon 911232 914400 1000 . . gene_id "SS.3110"; transcript_id "SS.3110.1"; exon_number "1"; cov "217.120224"; +CM143131.1 StringTie transcript 918622 919244 1000 . . gene_id "SS.3111"; transcript_id "SS.3111.1"; cov "13963.359551"; FPKM "682.871109"; TPM "1460.215209"; +CM143131.1 StringTie exon 918622 919244 1000 . . gene_id "SS.3111"; transcript_id "SS.3111.1"; exon_number "1"; cov "13963.359375"; +CM143131.1 StringTie transcript 920724 922628 1000 - . gene_id "SS.3112"; transcript_id "SS.3112.1"; cov "1622.789569"; FPKM "79.361712"; TPM "169.702857"; +CM143131.1 StringTie exon 920724 922203 1000 - . gene_id "SS.3112"; transcript_id "SS.3112.1"; exon_number "1"; cov "1746.350708"; +CM143131.1 StringTie exon 922460 922628 1000 - . gene_id "SS.3112"; transcript_id "SS.3112.1"; exon_number "2"; cov "540.716003"; +CM143131.1 StringTie transcript 923369 925142 1000 . . gene_id "SS.3113"; transcript_id "SS.3113.1"; cov "2593.932920"; FPKM "126.854991"; TPM "271.259956"; +CM143131.1 StringTie exon 923369 925142 1000 . . gene_id "SS.3113"; transcript_id "SS.3113.1"; exon_number "1"; cov "2593.932861"; +CM143131.1 StringTie transcript 925412 933354 1000 . . gene_id "SS.3114"; transcript_id "SS.3114.1"; cov "204.648496"; FPKM "10.008232"; TPM "21.401071"; +CM143131.1 StringTie exon 925412 933354 1000 . . gene_id "SS.3114"; transcript_id "SS.3114.1"; exon_number "1"; cov "204.648499"; +CM143131.1 StringTie transcript 933617 943551 1000 . . gene_id "SS.3115"; transcript_id "SS.3115.1"; cov "366.455762"; FPKM "17.921336"; TPM "38.322030"; +CM143131.1 StringTie exon 933617 943551 1000 . . gene_id "SS.3115"; transcript_id "SS.3115.1"; exon_number "1"; cov "366.455750"; +CM143131.1 StringTie transcript 944000 947518 1000 . . gene_id "SS.3116"; transcript_id "SS.3116.1"; cov "218.244103"; FPKM "10.673119"; TPM "22.822828"; +CM143131.1 StringTie exon 944000 947518 1000 . . gene_id "SS.3116"; transcript_id "SS.3116.1"; exon_number "1"; cov "218.244110"; +CM143131.1 StringTie transcript 948070 950013 1000 . . gene_id "SS.3117"; transcript_id "SS.3117.1"; cov "1108.555041"; FPKM "54.213329"; TPM "115.926896"; +CM143131.1 StringTie exon 948070 950013 1000 . . gene_id "SS.3117"; transcript_id "SS.3117.1"; exon_number "1"; cov "1108.555054"; +CM143131.1 StringTie transcript 950342 958037 1000 + . gene_id "SS.3118"; transcript_id "SS.3118.1"; cov "269.987713"; FPKM "13.203614"; TPM "28.233905"; +CM143131.1 StringTie exon 950342 952108 1000 + . gene_id "SS.3118"; transcript_id "SS.3118.1"; exon_number "1"; cov "207.815628"; +CM143131.1 StringTie exon 952188 957728 1000 + . gene_id "SS.3118"; transcript_id "SS.3118.1"; exon_number "2"; cov "286.032318"; +CM143131.1 StringTie exon 957795 958037 1000 + . gene_id "SS.3118"; transcript_id "SS.3118.1"; exon_number "3"; cov "356.222229"; +CM143131.1 StringTie transcript 950646 951680 1000 . . gene_id "SS.3119"; transcript_id "SS.3119.1"; cov "2206.305072"; FPKM "107.898245"; TPM "230.723861"; +CM143131.1 StringTie exon 950646 951680 1000 . . gene_id "SS.3119"; transcript_id "SS.3119.1"; exon_number "1"; cov "2206.305176"; +CM143131.1 StringTie transcript 958707 959070 1000 - . gene_id "SS.3120"; transcript_id "SS.3120.1"; cov "360.807560"; FPKM "17.645113"; TPM "37.731370"; +CM143131.1 StringTie exon 958707 958949 1000 - . gene_id "SS.3120"; transcript_id "SS.3120.1"; exon_number "1"; cov "425.320984"; +CM143131.1 StringTie exon 959023 959070 1000 - . gene_id "SS.3120"; transcript_id "SS.3120.1"; exon_number "2"; cov "34.208332"; +CM143131.1 StringTie transcript 987529 989214 1000 . . gene_id "SS.3121"; transcript_id "SS.3121.1"; cov "36.753855"; FPKM "1.797429"; TPM "3.843526"; +CM143131.1 StringTie exon 987529 989214 1000 . . gene_id "SS.3121"; transcript_id "SS.3121.1"; exon_number "1"; cov "36.753857"; +CM143131.1 StringTie transcript 989526 992202 1000 . . gene_id "SS.3122"; transcript_id "SS.3122.1"; cov "1337.069481"; FPKM "65.388714"; TPM "139.823743"; +CM143131.1 StringTie exon 989526 992202 1000 . . gene_id "SS.3122"; transcript_id "SS.3122.1"; exon_number "1"; cov "1337.069458"; +CM143131.1 StringTie transcript 959345 962365 1000 . . gene_id "SS.3123"; transcript_id "SS.3123.1"; cov "416.626945"; FPKM "20.374932"; TPM "43.568670"; +CM143131.1 StringTie exon 959345 962365 1000 . . gene_id "SS.3123"; transcript_id "SS.3123.1"; exon_number "1"; cov "416.626953"; +CM143131.1 StringTie transcript 962677 965745 1000 . . gene_id "SS.3124"; transcript_id "SS.3124.1"; cov "299.258065"; FPKM "14.635066"; TPM "31.294845"; +CM143131.1 StringTie exon 962677 965745 1000 . . gene_id "SS.3124"; transcript_id "SS.3124.1"; exon_number "1"; cov "299.258057"; +CM143131.1 StringTie transcript 966001 971968 1000 . . gene_id "SS.3125"; transcript_id "SS.3125.1"; cov "466.101709"; FPKM "22.794471"; TPM "48.742482"; +CM143131.1 StringTie exon 966001 971968 1000 . . gene_id "SS.3125"; transcript_id "SS.3125.1"; exon_number "1"; cov "466.101715"; +CM143131.1 StringTie transcript 977797 978274 1000 . . gene_id "SS.3126"; transcript_id "SS.3126.1"; cov "312831.933054"; FPKM "15298.889082"; TPM "32714.329593"; +CM143131.1 StringTie exon 977797 978274 1000 . . gene_id "SS.3126"; transcript_id "SS.3126.1"; exon_number "1"; cov "312831.937500"; +CM143131.1 StringTie transcript 979487 982199 1000 . . gene_id "SS.3127"; transcript_id "SS.3127.1"; cov "438.252119"; FPKM "21.432500"; TPM "45.830118"; +CM143131.1 StringTie exon 979487 982199 1000 . . gene_id "SS.3127"; transcript_id "SS.3127.1"; exon_number "1"; cov "438.252106"; +CM143131.1 StringTie transcript 983475 986245 1000 . . gene_id "SS.3128"; transcript_id "SS.3128.1"; cov "905.518224"; FPKM "44.283915"; TPM "94.694366"; +CM143131.1 StringTie exon 983475 986245 1000 . . gene_id "SS.3128"; transcript_id "SS.3128.1"; exon_number "1"; cov "905.518250"; +CM143131.1 StringTie transcript 994335 995110 1000 . . gene_id "SS.3129"; transcript_id "SS.3129.1"; cov "3533.373711"; FPKM "172.797873"; TPM "369.501767"; +CM143131.1 StringTie exon 994335 995110 1000 . . gene_id "SS.3129"; transcript_id "SS.3129.1"; exon_number "1"; cov "3533.373779"; +CM143131.1 StringTie transcript 995371 996360 1000 . . gene_id "SS.3130"; transcript_id "SS.3130.1"; cov "2181.606061"; FPKM "106.690352"; TPM "228.140967"; +CM143131.1 StringTie exon 995371 996360 1000 . . gene_id "SS.3130"; transcript_id "SS.3130.1"; exon_number "1"; cov "2181.605957"; +CM143131.1 StringTie transcript 996691 1011587 1000 . . gene_id "SS.3131"; transcript_id "SS.3131.1"; cov "664.077935"; FPKM "32.476399"; TPM "69.445802"; +CM143131.1 StringTie exon 996691 1011587 1000 . . gene_id "SS.3131"; transcript_id "SS.3131.1"; exon_number "1"; cov "664.077942"; +CM143131.1 StringTie transcript 1012070 1017021 1000 . . gene_id "SS.3132"; transcript_id "SS.3132.1"; cov "493.316943"; FPKM "24.125418"; TPM "51.588509"; +CM143131.1 StringTie exon 1012070 1017021 1000 . . gene_id "SS.3132"; transcript_id "SS.3132.1"; exon_number "1"; cov "493.316956"; +CM143131.1 StringTie transcript 1017319 1021662 1000 . . gene_id "SS.3133"; transcript_id "SS.3133.1"; cov "561.726750"; FPKM "27.470966"; TPM "58.742450"; +CM143131.1 StringTie exon 1017319 1021662 1000 . . gene_id "SS.3133"; transcript_id "SS.3133.1"; exon_number "1"; cov "561.726746"; +CM143131.1 StringTie transcript 1022444 1023037 1000 . . gene_id "SS.3134"; transcript_id "SS.3134.1"; cov "4878.819865"; FPKM "238.596243"; TPM "510.201499"; +CM143131.1 StringTie exon 1022444 1023037 1000 . . gene_id "SS.3134"; transcript_id "SS.3134.1"; exon_number "1"; cov "4878.819824"; +CM143131.1 StringTie transcript 1023456 1025133 1000 + . gene_id "SS.3135"; transcript_id "SS.3135.1"; cov "10868.530966"; FPKM "531.520066"; TPM "1136.574201"; +CM143131.1 StringTie exon 1023456 1023616 1000 + . gene_id "SS.3135"; transcript_id "SS.3135.1"; exon_number "1"; cov "3208.273193"; +CM143131.1 StringTie exon 1024084 1025133 1000 + . gene_id "SS.3135"; transcript_id "SS.3135.1"; exon_number "2"; cov "12043.103516"; +CM143131.1 StringTie transcript 1025514 1026698 1000 - . gene_id "SS.3136"; transcript_id "SS.3136.1"; cov "14941.221675"; FPKM "730.692966"; TPM "1562.474923"; +CM143131.1 StringTie exon 1025514 1026253 1000 - . gene_id "SS.3136"; transcript_id "SS.3136.1"; exon_number "1"; cov "16221.059570"; +CM143131.1 StringTie exon 1026627 1026698 1000 - . gene_id "SS.3136"; transcript_id "SS.3136.1"; exon_number "2"; cov "1787.333374"; +CM143131.1 StringTie transcript 1028298 1029197 1000 . . gene_id "SS.3137"; transcript_id "SS.3137.1"; cov "10119.471111"; FPKM "494.887669"; TPM "1058.241433"; +CM143131.1 StringTie exon 1028298 1029197 1000 . . gene_id "SS.3137"; transcript_id "SS.3137.1"; exon_number "1"; cov "10119.470703"; +CM143131.1 StringTie transcript 1030155 1035438 1000 . . gene_id "SS.3138"; transcript_id "SS.3138.1"; cov "233.743376"; FPKM "11.431103"; TPM "24.443661"; +CM143131.1 StringTie exon 1030155 1035438 1000 . . gene_id "SS.3138"; transcript_id "SS.3138.1"; exon_number "1"; cov "233.743378"; +CM143131.1 StringTie transcript 1035993 1037187 1000 . . gene_id "SS.3139"; transcript_id "SS.3139.1"; cov "12207.677824"; FPKM "597.010373"; TPM "1276.615184"; +CM143131.1 StringTie exon 1035993 1037187 1000 . . gene_id "SS.3139"; transcript_id "SS.3139.1"; exon_number "1"; cov "12207.677734"; +CM143131.1 StringTie transcript 1039961 1042985 1000 + . gene_id "SS.3140"; transcript_id "SS.3140.1"; cov "3614.927416"; FPKM "176.786216"; TPM "378.030228"; +CM143131.1 StringTie exon 1039961 1040110 1000 + . gene_id "SS.3140"; transcript_id "SS.3140.1"; exon_number "1"; cov "2964.580078"; +CM143131.1 StringTie exon 1040725 1042985 1000 + . gene_id "SS.3140"; transcript_id "SS.3140.1"; exon_number "2"; cov "3658.072998"; +CM143131.1 StringTie transcript 1043280 1044711 1000 + . gene_id "SS.3141"; transcript_id "SS.3141.1"; cov "2214.454710"; FPKM "108.296799"; TPM "231.576107"; +CM143131.1 StringTie exon 1043280 1043347 1000 + . gene_id "SS.3141"; transcript_id "SS.3141.1"; exon_number "1"; cov "426.264709"; +CM143131.1 StringTie exon 1043480 1043512 1000 + . gene_id "SS.3141"; transcript_id "SS.3141.1"; exon_number "2"; cov "1274.545410"; +CM143131.1 StringTie exon 1043709 1044711 1000 + . gene_id "SS.3141"; transcript_id "SS.3141.1"; exon_number "3"; cov "2366.612061"; +CM143131.1 StringTie transcript 1054180 1056293 1000 . . gene_id "SS.3142"; transcript_id "SS.3142.1"; cov "303.718543"; FPKM "14.853203"; TPM "31.761299"; +CM143131.1 StringTie exon 1054180 1056293 1000 . . gene_id "SS.3142"; transcript_id "SS.3142.1"; exon_number "1"; cov "303.718536"; +CM143131.1 StringTie transcript 1062431 1063522 1000 . . gene_id "SS.3143"; transcript_id "SS.3143.1"; cov "5820.530220"; FPKM "284.650117"; TPM "608.680649"; +CM143131.1 StringTie exon 1062431 1063522 1000 . . gene_id "SS.3143"; transcript_id "SS.3143.1"; exon_number "1"; cov "5820.530273"; +CM143131.1 StringTie transcript 1064388 1065563 1000 . . gene_id "SS.3144"; transcript_id "SS.3144.1"; cov "632.812925"; FPKM "30.947399"; TPM "66.176270"; +CM143131.1 StringTie exon 1064388 1065563 1000 . . gene_id "SS.3144"; transcript_id "SS.3144.1"; exon_number "1"; cov "632.812927"; +CM143131.1 StringTie transcript 1065841 1072204 1000 . . gene_id "SS.3145"; transcript_id "SS.3145.1"; cov "360.951603"; FPKM "17.652157"; TPM "37.746433"; +CM143131.1 StringTie exon 1065841 1072204 1000 . . gene_id "SS.3145"; transcript_id "SS.3145.1"; exon_number "1"; cov "360.951599"; +CM143131.1 StringTie transcript 1072607 1073911 1000 . . gene_id "SS.3146"; transcript_id "SS.3146.1"; cov "2072.793103"; FPKM "101.368909"; TPM "216.761876"; +CM143131.1 StringTie exon 1072607 1073911 1000 . . gene_id "SS.3146"; transcript_id "SS.3146.1"; exon_number "1"; cov "2072.793213"; +CM143131.1 StringTie transcript 1080571 1092239 1000 . . gene_id "SS.3147"; transcript_id "SS.3147.1"; cov "241.474162"; FPKM "11.809173"; TPM "25.252107"; +CM143131.1 StringTie exon 1080571 1092239 1000 . . gene_id "SS.3147"; transcript_id "SS.3147.1"; exon_number "1"; cov "241.474167"; +CM143131.1 StringTie transcript 1092530 1114806 1000 . . gene_id "SS.3148"; transcript_id "SS.3148.1"; cov "311.974862"; FPKM "15.256974"; TPM "32.624702"; +CM143131.1 StringTie exon 1092530 1114806 1000 . . gene_id "SS.3148"; transcript_id "SS.3148.1"; exon_number "1"; cov "311.974854"; +CM143131.1 StringTie transcript 1116374 1118983 1000 . . gene_id "SS.3149"; transcript_id "SS.3149.1"; cov "20.940613"; FPKM "1.024090"; TPM "2.189860"; +CM143131.1 StringTie exon 1116374 1118983 1000 . . gene_id "SS.3149"; transcript_id "SS.3149.1"; exon_number "1"; cov "20.940613"; +CM143131.1 StringTie transcript 1119367 1121821 1000 . . gene_id "SS.3150"; transcript_id "SS.3150.1"; cov "66.244565"; FPKM "3.239657"; TPM "6.927511"; +CM143131.1 StringTie exon 1119367 1121821 1000 . . gene_id "SS.3150"; transcript_id "SS.3150.1"; exon_number "1"; cov "66.244568"; +CM143131.1 StringTie transcript 1124986 1131203 1000 . . gene_id "SS.3151"; transcript_id "SS.3151.1"; cov "477.394661"; FPKM "23.346747"; TPM "49.923440"; +CM143131.1 StringTie exon 1124986 1131203 1000 . . gene_id "SS.3151"; transcript_id "SS.3151.1"; exon_number "1"; cov "477.394653"; +CM143131.1 StringTie transcript 1132380 1133359 1000 . . gene_id "SS.3152"; transcript_id "SS.3152.1"; cov "28.377551"; FPKM "1.387790"; TPM "2.967576"; +CM143131.1 StringTie exon 1132380 1133359 1000 . . gene_id "SS.3152"; transcript_id "SS.3152.1"; exon_number "1"; cov "28.377550"; +CM143131.1 StringTie transcript 1133636 1145921 1000 . . gene_id "SS.3153"; transcript_id "SS.3153.1"; cov "380.761558"; FPKM "18.620953"; TPM "39.818055"; +CM143131.1 StringTie exon 1133636 1145921 1000 . . gene_id "SS.3153"; transcript_id "SS.3153.1"; exon_number "1"; cov "380.761566"; +CM143131.1 StringTie transcript 1142263 1145338 1000 - . gene_id "SS.3154"; transcript_id "SS.3154.1"; cov "72.880914"; FPKM "3.564205"; TPM "7.621505"; +CM143131.1 StringTie exon 1142263 1143554 1000 - . gene_id "SS.3154"; transcript_id "SS.3154.1"; exon_number "1"; cov "110.395889"; +CM143131.1 StringTie exon 1143777 1145338 1000 - . gene_id "SS.3154"; transcript_id "SS.3154.1"; exon_number "2"; cov "41.850605"; +CM143131.1 StringTie transcript 1142263 1145338 1000 - . gene_id "SS.3154"; transcript_id "SS.3154.2"; cov "56.840019"; FPKM "2.779733"; TPM "5.944032"; +CM143131.1 StringTie exon 1142263 1143554 1000 - . gene_id "SS.3154"; transcript_id "SS.3154.2"; exon_number "1"; cov "84.833260"; +CM143131.1 StringTie exon 1143999 1145338 1000 - . gene_id "SS.3154"; transcript_id "SS.3154.2"; exon_number "2"; cov "29.849522"; +CM143131.1 StringTie transcript 1142263 1145921 1000 - . gene_id "SS.3154"; transcript_id "SS.3154.3"; cov "45.415007"; FPKM "2.220998"; TPM "4.749264"; +CM143131.1 StringTie exon 1142263 1143776 1000 - . gene_id "SS.3154"; transcript_id "SS.3154.3"; exon_number "1"; cov "77.147064"; +CM143131.1 StringTie exon 1143999 1145921 1000 - . gene_id "SS.3154"; transcript_id "SS.3154.3"; exon_number "2"; cov "20.431993"; +CM143131.1 StringTie transcript 1147029 1149805 1000 . . gene_id "SS.3155"; transcript_id "SS.3155.1"; cov "367.130717"; FPKM "17.954344"; TPM "38.392613"; +CM143131.1 StringTie exon 1147029 1149805 1000 . . gene_id "SS.3155"; transcript_id "SS.3155.1"; exon_number "1"; cov "367.130707"; +CM143131.1 StringTie transcript 1150646 1152094 1000 . . gene_id "SS.3156"; transcript_id "SS.3156.1"; cov "191.777088"; FPKM "9.378762"; TPM "20.055046"; +CM143131.1 StringTie exon 1150646 1152094 1000 . . gene_id "SS.3156"; transcript_id "SS.3156.1"; exon_number "1"; cov "191.777084"; +CM143131.1 StringTie transcript 1152794 1155996 1000 . . gene_id "SS.3157"; transcript_id "SS.3157.1"; cov "944.835467"; FPKM "46.206706"; TPM "98.805958"; +CM143131.1 StringTie exon 1152794 1155996 1000 . . gene_id "SS.3157"; transcript_id "SS.3157.1"; exon_number "1"; cov "944.835449"; +CM143131.1 StringTie transcript 1156523 1161455 1000 . . gene_id "SS.3158"; transcript_id "SS.3158.1"; cov "2966.475775"; FPKM "145.074013"; TPM "310.218542"; +CM143131.1 StringTie exon 1156523 1161455 1000 . . gene_id "SS.3158"; transcript_id "SS.3158.1"; exon_number "1"; cov "2966.475830"; +CM143131.1 StringTie transcript 1162678 1163551 1000 . . gene_id "SS.3159"; transcript_id "SS.3159.1"; cov "958.036613"; FPKM "46.852301"; TPM "100.186465"; +CM143131.1 StringTie exon 1162678 1163551 1000 . . gene_id "SS.3159"; transcript_id "SS.3159.1"; exon_number "1"; cov "958.036621"; +CM143131.1 StringTie transcript 1167712 1169965 1000 . . gene_id "SS.3160"; transcript_id "SS.3160.1"; cov "22.605146"; FPKM "1.105493"; TPM "2.363928"; +CM143131.1 StringTie exon 1167712 1169965 1000 . . gene_id "SS.3160"; transcript_id "SS.3160.1"; exon_number "1"; cov "22.605146"; +CM143131.1 StringTie transcript 1170359 1178080 1000 . . gene_id "SS.3161"; transcript_id "SS.3161.1"; cov "691.056074"; FPKM "33.795751"; TPM "72.267035"; +CM143131.1 StringTie exon 1170359 1178080 1000 . . gene_id "SS.3161"; transcript_id "SS.3161.1"; exon_number "1"; cov "691.056091"; +CM143132.1 StringTie transcript 302 1815 1000 . . gene_id "SS.3162"; transcript_id "SS.3162.1"; cov "203304.179657"; FPKM "9942.489132"; TPM "21260.489222"; +CM143132.1 StringTie exon 302 1815 1000 . . gene_id "SS.3162"; transcript_id "SS.3162.1"; exon_number "1"; cov "203304.171875"; +CM143132.1 StringTie transcript 2148 4946 1000 . . gene_id "SS.3163"; transcript_id "SS.3163.1"; cov "543.325473"; FPKM "26.571060"; TPM "56.818140"; +CM143132.1 StringTie exon 2148 4946 1000 . . gene_id "SS.3163"; transcript_id "SS.3163.1"; exon_number "1"; cov "543.325500"; +CM143132.1 StringTie transcript 5262 5823 1000 . . gene_id "SS.3164"; transcript_id "SS.3164.1"; cov "2460.128114"; FPKM "120.311334"; TPM "257.267349"; +CM143132.1 StringTie exon 5262 5823 1000 . . gene_id "SS.3164"; transcript_id "SS.3164.1"; exon_number "1"; cov "2460.128174"; +CM143132.1 StringTie transcript 7133 7472 1000 . . gene_id "SS.3165"; transcript_id "SS.3165.1"; cov "2320.000000"; FPKM "113.458439"; TPM "242.613482"; +CM143132.1 StringTie exon 7133 7472 1000 . . gene_id "SS.3165"; transcript_id "SS.3165.1"; exon_number "1"; cov "2320.000000"; +CM143132.1 StringTie transcript 9127 9492 1000 . . gene_id "SS.3166"; transcript_id "SS.3166.1"; cov "2356.808743"; FPKM "115.258552"; TPM "246.462748"; +CM143132.1 StringTie exon 9127 9492 1000 . . gene_id "SS.3166"; transcript_id "SS.3166.1"; exon_number "1"; cov "2356.808838"; +CM143132.1 StringTie transcript 10662 11148 1000 . . gene_id "SS.3167"; transcript_id "SS.3167.1"; cov "2250.205339"; FPKM "110.045166"; TPM "235.314721"; +CM143132.1 StringTie exon 10662 11148 1000 . . gene_id "SS.3167"; transcript_id "SS.3167.1"; exon_number "1"; cov "2250.205322"; +CM143132.1 StringTie transcript 23611 26374 1000 . . gene_id "SS.3168"; transcript_id "SS.3168.1"; cov "94968.549928"; FPKM "4644.389393"; TPM "9931.314917"; +CM143132.1 StringTie exon 23611 26374 1000 . . gene_id "SS.3168"; transcript_id "SS.3168.1"; exon_number "1"; cov "94968.546875"; +CM143132.1 StringTie transcript 26846 29020 1000 . . gene_id "SS.3169"; transcript_id "SS.3169.1"; cov "268.042299"; FPKM "13.108474"; TPM "28.030464"; +CM143132.1 StringTie exon 26846 29020 1000 . . gene_id "SS.3169"; transcript_id "SS.3169.1"; exon_number "1"; cov "268.042297"; +CM143132.1 StringTie transcript 29296 31737 1000 . . gene_id "SS.3170"; transcript_id "SS.3170.1"; cov "313.900082"; FPKM "15.351126"; TPM "32.826031"; +CM143132.1 StringTie exon 29296 31737 1000 . . gene_id "SS.3170"; transcript_id "SS.3170.1"; exon_number "1"; cov "313.900085"; +CM143132.1 StringTie transcript 32059 37998 1000 . . gene_id "SS.3171"; transcript_id "SS.3171.1"; cov "498.972054"; FPKM "24.401979"; TPM "52.179891"; +CM143132.1 StringTie exon 32059 37998 1000 . . gene_id "SS.3171"; transcript_id "SS.3171.1"; exon_number "1"; cov "498.972046"; diff --git a/results/2026-10-29_ss_records/make_refs.sh b/results/2026-10-29_ss_records/make_refs.sh new file mode 100644 index 00000000..4ea57d6a --- /dev/null +++ b/results/2026-10-29_ss_records/make_refs.sh @@ -0,0 +1,6 @@ +#!/bin/bash +# Reference proteins for the S. schoenii gene models: every curated protein of the Saccharomycotina families. +cd "$(dirname "$0")/../.." +cat results/2026-10-29_yeast_routing/pichia_reference_proteins.faa \ + db/Ascomycota/{Pichiales,Saccharomycetales,Dipodascales}/*/proteins.faa > results/2026-10-29_ss_records/refs.faa +grep -c ">" results/2026-10-29_ss_records/refs.faa diff --git a/results/2026-10-29_ss_records/refs.faa b/results/2026-10-29_ss_records/refs.faa new file mode 100644 index 00000000..902b8463 --- /dev/null +++ b/results/2026-10-29_ss_records/refs.faa @@ -0,0 +1,126 @@ +>MH260578_SUI1 +MSNIENLKSFDPFADTGDDETEVTNYIHIRIQQRNGRKTLTTVQGLPDEYDLKKILKVIKKEFACNGNIVKDDELGEVIQLQGDQRLKIMEFMVQTLGIKKKNIKIHGF +>MH260578_SLA2 +MFSSLVSREGETKRSRKTSSNMFSSSRHVTDISTAIKKACTPEDTASKRKHVRACIVYTWDHKSSKDFWETMKVVPLKNTDTQLFKALILIHKVLQEGHPSALVGGFKNMEWISNLDTLRTLDRRFQVLIPEYVNYILQKLRFHHNHRGFNGTFEYEEYVSLRTVSDPNEGYDAILDLTSLQDSLDSFGRDIFATVRNNNSECIISALVPIVAESYGIYKFLISMLRAMYKMSDSAEILEPLKSKFEDQHERLYDFYANCSNIRYLTTLITIPKLPFEAPNLIIQNDEDENVNLPPLTEQKTAATTLRHSPTPFEQENERQQQQAPIATQPTGMVRNAFVEQQQLYEQQQQQLEQQRQAELQQQQQQQLAQQQYWEQQQRQQAEAQQLAQQQLLLDQAQRHAQGRVAELERDILTLKGQYDNDQLMLQSYDQKVQALENELASTTQTAQEQLASKDEQLNLLQEQVEYWKNKYESLAKLYSQLRTEHLNLLTKSKKIQQKAASAQEAIEKREKLERDMKAKNIELADLIKERDRARLELERFKNGTKTDLQTLQLEKDELEQKLATLDRAQSANLTAIFNQHNKELQELQNKFKDVTLNAPSDEKLKQLEEQLQEKDLEIEMMQQTMDETIKDLVKTQNSREEKSEMQNKLNSTKVLGLIDAILKSGINRIQDAVFELDSPMQAGNLNSSPEYVLTLLEKSSGLVTDFASSFNNMLVDGDNANEALVIDSITNFTTSISDILLNTKGLTRLTKQDDFQDDLIDTAKDIAEISEVYLESLYHSNLVNKSIDDQTDIVINGNIDVQEILQTLLQLVESMKTPSSKIDLSKVDGELSDLVDKEMEHASRVIEEASVHLSSLLNQPFDVSMSSIDIEVNKSILAAASAIITAIKYLIRASIESQEEIVNNGRGSHSKTSFYKKNNKWTEGLISASKSIAYSTNTLIRIADGVLQNKHSNEELVVASREVAASTAQLVSAARVKSQFMSKTQNKLEDASKKVNLACKQLVDQVNKLIIGKHEVEDIDYSKLSIHENKTAEMEQQVEILKLENALSSARKRLGEIRKFSYKDDDSDEE +>MH260578_MATalpha1 +MARMWNKSSTLRVKKQRPSRICKTTTKATIFIAKPTPRYVIPLEVEELLGKYISRNNLDLRTLSNVKKKNKKHKTVVNGFTAFRTYYSKFGKTYEDQENLSKELANLWKQTPSIQSTWRGYSEEYRASETDLPFVEWFDTYKSLIKPEPEKRDYITQTTTMSHLTVEDVYDNLGSNSMN +>MH260578_MATalpha2 +MQHDELLEVYIHLKDVLRQLAETPIDEELSSTDLLKDMLNIKEILESGSPLQKQSCELIRMIRRISTSIYDMISQRSTLKTKYGLDLKSWDLDNSMMNTEDTNLTKNMDIHNSSSIDIDIDDEEISTALRDEGIHSSFCNTDSNSIKTKDGSSRNGKRLPKETIAVLNKWFNDNIENPYVQKEDISYLKAKTNLQASQIKNWVSNKRRKRKGSKVSPSIVEILN +>MH260578_TGL1 +MNLLIIFLNLVSAVVQLPLLIFHKLGVEEYLSYFQTPSNRPDNISAVSQENKTKISPSAKPLHEVATTHCLHQKIIKANDIVDIVHAHGYKVHEHIVQTKDGYLLSIHRILKSSGDKPQNSRVVYLHHGLLTNSELFLLGENKEKCLPFLLVDQGYDVWLGNNRGNKYSRKHLFLSSTDEKFWNYSLDEFAMFDIPNTVNYILRNTQQDSLSYIGFSQGSAQCLAALSLNHDLNKKINKFIGLSPAMIPQGLNNPIASFLVTSAPGLLYRIFGKRAILPSVVFWQKLMGPVLYEKVVDKSLVFLFNWKSGNIKTSQKKVGYPHMFSPSSVKSVAHWFQIIDSKRFQMFDEGGASGSRLVYLSGTSGKTNRVASFPTQTITTPCLFVYGKSDMLIDIERTLDNLSCDIQTIGIDGYEHMDTLWADQVEKKVFPVVLQYLKQ +>MH260578_SEC3 +MSQRSHGETGGGQRLFVPTHKPMNSMDLARQYEMDMHNITKYLFKEVDAQGYKLESFVSYVRIIEDSRSPSSRPPANSPLSNKKNRFLILSAKASGRMRLHKAKESSSGVIQIGRSWDFDELTTLELDDGSPTGFVCEMGKRYYWEVHTPKERRVWCTTLLQNFINYTKGNIPRLVNCSIQYFHLEALYDSYRGQGSSMYTGSGNIPASPLSNQNAMSSPVKTSVKSSLRSPLRSPIKSPIKSPTKSHTNIQRSPIKSSSPEVSSLKQRLATPPLSNSPYSPLGNTRTNLGTAVAGNANNAFGLGVGISPVSKSSEVSSDHQDAEREAKKIAEINKRRQQEIEKRKREELERRRREQEEFEKNEREQNELRIAEEIEERKQKEEQKRLQEMEKEREVQRIKQEELEIERQKQERIDEEKRLKEMEIAKKKAQKQHHQQELLRNEIKPPGFAGIAKRGPPSEALSNAPSQMSFEYGDESQYHHQNVSTESANTIGVDSFIEGYGSSGDAEEETAPLNIGIAQVKQNKDNKMVPSNLSKPVITETIEESDSDRSLKIATDSDIEKLIKNVDGSPMDKKKVIDTEQLHENRIRAFSRVKENATNKLDLLEVLEELGYDPLFDDSESLEKKILKKLDEIQYSKIKTLTDVTSATNALKETISTAFKSCDVIDPVLSLFSVELSTFKDDVHYIEEQGQGLQVEATNEKLLMNEVNDLIHSVEISDSKLQKLLTSKIVLSENNSEFEDILLELYNALKKMNDASSDDPMSANYQLSQMKALQEKKNVFEGSKNKFVSNFTRISEKLFKSVSMSLTTRLQQVTPETFETNFLQTSFMEKSSLLITISGFIAFVKSVSNDGYDSIVNSFVVAFEPFFENMATILLQHLTSVASSKLEEPFSFTLNPSQLIDQEYINSRAKKDSAKTLFNRNNKLSTEATTISSNVETFFSQLVNIMSIEQELIRVLFGFSSSSDCLFENLVKVKLSQRCQKFRNTSNFLKAPIESDRRVGDEIYELMKGIFDPVFGAVLKVIFSLSKNHMLEIPAILSILKTYSQSLAPTCHEYAYGNFTKFEARINTIWTKEIDQQIQNIVHTKVHCKVANFVKAYPVFYRRVNNFIDSLNLVNMTSFGPDEGWYGNYYMVWAIIKAALNKGVEQLQIEIPVFEGIENDEIDIETLTQKHLALLLNYKWLVEETRSLNGFPKELNKSIDDLRDKELREFTGSFIRQFRIGGVIRLVEGMESVLSEHSNPANMNSYSIETIKELMSSFKGDNFKQEISSIAEHLKETLKGRCYNESDPTEDSEYSVAIGKQIEKELYNNCMYTISQHFISIFTRLSNIVEKHYINFEVPVDKYIINFNFKKYYSV +>460519_cbs-7435_MATkp_MATa_MATa2 +MTVTTFLSSSFDSVAFAMTCVSDKSYKTTAGKGLSGKKFNLSTHRPRNKFIISKSIFSKVIQRYYPDLSFEENSKIASYLWKHRFGCFDKYYEYLQIEESKFTSLVTSKIDQLAFKAVPTEKTTSQCTFRFSSSPKRRRTVNLNILKPLCKRVYSQQFHSPLTGITTQDIFVAEENNV +>460519_cbs-7435_MATkp_MATa_MATa1 +MSGNTFREITAACLLSMILSTDDYTKPATSCHMHQLTAPDLSDYSLLDALFVTCDRALEYQALTYRLQASMEDAMKIIESARYQTKDLPTLDNIFKTFYKTLLDTIESIEATGTSTLLSDFTHQISFFNIDPSVISLSDETKECAYSFFSDSLHHHPVKRTRKTISKEVKKILEEAFKAKAAPNTKERLLIAQRCALTPLQVRMWFTNKRTRNKIKQRLQAQSHP +>460523_cbs-4732_MATog_MATa-MATalpha_MATalpha2 +MDDMLTKIQERTKCLIYILMERQIRAARLEQLLLDYISCKPHDKLCKSSMEGFTTERSLKYTRDCPQYAAVTTSQPRYRIEKRSKRFPKTAQMELENWYTENEDNPYLSKRDLQQLVHKTGLCAPQVRNWVSNRRRKERTLTISKELSDLLNQDTRCSPNDVV +>460523_cbs-4732_MATog_MATa-MATalpha_MATalpha1 +MMFHVLCFFGNRTSRVANLCLQLKFPPHNDSPKMALDELNLSFLTHLPQIPTTSPLLKRLLTEYGAIDNGKDSLNKVAPKKSSRHRVQKEKKRLNGFMAFRSFYSRNIANYNSQKALSQDLADAWNREKHQQIWSLYAIQYNHSKSKEPFSRWLEMKLSNKLGKFNSDDPTTRREINVMSHIVVEDVFQECSSQY +>460523_cbs-4732_MATog_MATa-MATalpha_MATa1 +MQFTILNEPSLDSQRREGDLASENYVFGDIRKEGVRILEDSLRSERNALLAIGAGGAADRVKQHYRKLLDDWEAAIMEIRSNDKYESLCCGFAIEKAEVETEMRNTEELDVYKECLVSECFDKKKRRHIPESSKELLEKAFKVKRFPNSKERERIARECGISPLQVRVWFTNKRARSKSRA +>5476_sc5314_MTL_A_MTLA2 +MPYTFNFPKSQSSFKYSIKSLTNSRSFPMISIYVTPQSTPKFINNQSIDKMTVLSSFRSRNSFIIARSILSKLLRKNKADFKKVSKSVSLLWGSVDNSFKNYFEYLSILESQWHDKKSSNLNPISSTRTTSELNYIELCSSIYNQSRKHPRSVQGNKAKFRLYKNVSKKSNRKPRRLKNGFKVSRSTINCSYGIYTEDVFQ +>5476_sc5314_MTL_A_MTLA1 +MNSEIESSLTLLKSVEKLVQATSVYKNEDNEEIFLQLKRERQENSNSHEETETFFHESLDRLMKLSSIAGSKVQYELSLNNLYNLLLRTRKQEEEEAFIFPTVSTEEFALEQITFEVSDQMDDDKDSEDDILIKGEEIKKSKKKRQRLDNSTKEFLEKVFEKNKQPNRRERELIAEKHGVSLSQIRVWFTNKRMRKKEPKSKAKSSSNST +>1005962_dl-1_MATog_MATa-MATalpha|gene_index=0|name=sla2|role=flanking_conserved +MLSFGSHSNLDIQASLKKACTADAAAPKRKHVRACIVYTWDHKSSREFWHCLKLLPIQSNDTQIFKTLIVIHKVLQEGHPTCLIGGYKNISWLESLSRFSNNGTAAGYTRLIKEYVFYLEQKLKFHHDHRGFNGMFEYEEYVSLRTVSDPNEGFESIMDLLSLQDSLDNLQRVIFSSIRHTSESECVISSLVPIIAESYGIYKFLISMLKALYKSSESDEVIAPLKDRFDVQHRRLFEFYADCSSIKYLTTLVTIPRLPSSPPILQDEEDPQGFPLVRERSSVSNSEESNIPRSSNIQSQPTGAMVDSFVRQQQELEEQQRQAEERRQAELLEQQMLQRDQARFWEEQQRQQAVSQELAQSQLLADQMQRQAQGKLAQLEQDLLTLGGQHERDQLMLEQYDQRVKVLENELRIVTQTAEEQLAVKTSQCSHLEEQVQYWKNKYESLAKLYSQLRQEHLNLLGKFKIVQQKAASAQESIDKREKLEKDLKAKNIELADLIKERDRARLDLARIKGNDSEQVQMLRTQLRDMETKLKSLEETHSQNLASLFSQHSKEIEEIKASASELKEGGLNEEAQQEVQMLQQAMDDTMQELAEQHQAIEKEAETRVLRLIDTLLKVSSDRLREFVFNLESPVYSNTDIPTAEYLGTMLERVSHLSTQFSTTMTDYIADNMKGESESGLIKAIIELTDSIGNLFSNVKAVLRDRKDDVQEILVEGSKDLAHMVELFFESMLSNHLLKLEIHERTDRVITGNINVQEVIQSLMQVVEVFRDPGRKTPVSSDELGYFLDKELANTQAAVEKAAGLLESMSTRHKLEVQEDGSLEVNEAIISCASAIINAVKLLLEACIDAQEEIVSRGRGSMSRALFYKKNNRWTEGLISASKQVAYATGILIRMADGVLAGTNSSEELIVASNEVASATAQLVSSSRVKSDLMSQSHLNLEEASRKVTSSCKMLVTKVRSLLLSDESNKTVDYSQLTAHENRTAELEQQVEILKLESALSHARKRLGEIRKFSYRDEES +>1005962_dl-1_MATog_MATa-MATalpha|gene_index=1|name=MATa1|role=core_MAT +MQFIILNEPSLDSQRREGNLASENCVFARDIRKEGVKVLEDSLRSERNALLAIGAGGAVDRVERHYRRLLDGWEAAIMEIRSNDKYESLWRGFAIEKAEVETEMRKVEKQWPGELDVYKECFVSECFDKKKRRHIPESSKELLEKAFKVKRFPNSKERERIARECGISPLQVRVWFTNKRARSKSRA +>1005962_dl-1_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT +MFLAFFVIARVGLQNLCLQRKFPPHGDSAKMALDGLNLSFLTHLPQIPTTSPLLKRLLSEYGAIDNGNDSSNKVAPKKSRRHRVQKQKKRLNGFMAFRSFYSRNIANYNSQKALSQDLADAWNREKHQQIWSLYAIQYNHSKSKEPFSIWLEMKLNKKLRKNNSDDPTTRREINIMSDIVVEDVFQECSS +>1005962_dl-1_MATog_MATa-MATalpha|gene_index=3|name=MATalpha2|role=core_MAT +MSSYEEQCSAPDLLLLLDRLIDSITESDLSLEDELYWDSHVHSLMAVITHTVSSPSGTPMDDMLGQIQERTKCLIYILMERQIRAARLEQLLLDYISCKPHDKFCKSSMESFTTERTIEYTRDCPPYAAVTTSQPGYKTEKRSKRFPKTAQMELENWYTENEDNPYLSKRDLQQLVHKTGLCAPQVRNWVSNRRRKERTLTISKELSDLLNQDTDCSPNDVV +>1005962_dl-1_MATog_MATa-MATalpha|gene_index=4|name=dic1|role=flanking_conserved +MNSDKSTKSIAPSANFPFWYGGAASMFACLFTHPLDLAKVRLQTAKVPGDSLVSLAFKIIKTEGVLAAYAGLTASLLRQATYSTARFGVYEKLKEIMTDPTRGQASTFQLLAASMIAGAVGGVVGNPADVVNIRMQNDNSLPESQRRHYKHALDGLLKITREENLTALFRGLGPNLARGILMTASQVVSYDVAKKLLVENLSMDPKTKATHFSASLIAGLVATTVCSPADVLKTRIMNSSGTGQSSFGILKDAISREGLGFMFRGWTPAFIRLGPHTILTFIALEELRRLKIGL +>460519_cbs-7435_MATkp_MATa|gene_index=0|name=dic1|role=flanking_conserved +MTQINRESNDDSTMQYERIPPAKGVFPFWYGGAASMFACLFTHPLDLAKVRLQTASQPGQNLLTIAIRIISSEGILGAYSGLSASLLRQATYSTTRFGIYEALKDYLTKANNNQDLSTAILLPCSMLAGGIGGLVGNPSDVVNIRMQNDSSLPKPARRNYRNALHGLARMAKEEGLGSWFRGLLPNLTRGVLMTASQVVSYDVAKKFLVKKLSFDETTRATHFSASLMAGLVATTVCSPADVVKTRIMNSAEKHQSIITVLTTAMRKEGPGFLFRGWFPSFIRLGPHTILTFVALEQLRTWRIAM +>460519_cbs-7435_MATkp_MATa|gene_index=1|name=MATa2|role=core_MAT +MTVTTFLSSSFDSVAFAMTCVSDKSYKTTAGKGLSGKKFNLSTHRPRNKFIISKSIFSKVIQRYYPDLSFEENSKIASYLWKHRFGCFDKYYEYLQIEESKFTSLVTSKIDQLAFKAVPTEKTTSQCTFRFSSSPKRRRTVNLNILKPLCKRVYSQQFHSPLTGITTQDIFVAEENNV +>460519_cbs-7435_MATkp_MATa|gene_index=2|name=MATa1|role=core_MAT +MSGNTFREITAACLLSMILSTDDYTKPATSCHMHQLTAPDLSDYSLLDALFVTCDRALEYQALTYRLQASMEDAMKIIESARYQTKDLPTLDNIFKTFYKTLLDTIESIEATGTSTLLSDFTHQISFFNIDPSVISLSDETKECAYSFFSDSLHHHPVKRTRKTISKEVKKILEEAFKAKAAPNTKERLLIAQRCALTPLQVRMWFTNKRTRNKIKQRLQAQSHP +>460519_cbs-7435_MATkp_MATa|gene_index=3|name=sla2|role=flanking_conserved +MSRQEADLKVSIKKACSTEEAAPKRKHVRACIVFTWDHRSSKAFYNGLRLLPIQNDEIPLFKSLITIHKVLQEGHPSAIKEGIKNRDWIQSLGHVFPGDGMKRYGRLIREYDRYLIRKIDFHNSHKGFNGTFEYEEYVSLKTVSDPNEGYEAIMDLMVLQDSINDLQRLLFASIDSSSHSELKISALVPLIAESYGIFKFITSMLRGMCHSLGHDDEALQPLIERFISQYSDLYDFYAECSYVKYLTSLVNIPKLPFEAPDLFNWDETDELKPRILAEEPSLQVSSKAPSEEFGTPTEVIHSQPTAGTDLWAQSNALKQQYEQEQQLLEQERQQQLLEQQHQQQQQLEYWEKQKELQEQQQLYAQQQLESDQLQRQVQGRVGELERDLLILRGQFDRDQLMLRQYDERVKALETELSSTTQNAQQQLGAKEELLGNIQEQAAQWKSKYDSLAKLYSQLREEHLNLLSKFKTAQLKASSAREAIDKREKIERDLKAKNIELADLIRERDRARLDLERSKSDKNSETERLEARLREQETKLADIEKLHSSELKSFLSQHNKEIEELQNQLQASSLSESANERLKALEAQLQEKDDELAIAHQTMEATIKELTGQQSIQNSAIDEQIDAILLEHIDKLTEVIDAILTSGVQRIQDGLFELDSPMQAGNQNSSPEYLSSIIEKSSNLATEFTSSFNGFIADGPNGDHVSVIQTITEFTTSIVDLLLNCKGVVRLASSDQEAEALLNSARDVAEESESFIVSLYSSSLKGLSDQEKTDKAIEGNVDIQQELQTLSSLVEKLISSQVNINVNDNVGELVDREMAHAAETIAKASDHLTDLLTNAKQDISTIDMKINNSILSAAIAVTKAIILLIKTATDCQNEIVNHGRGSSSRTSFYKKHNKWTEGLISASKSVAYSTNSLIQIADGVLSSTSSPEQLIVACNDVAASTAQLVAASRVKASFMSKTQDKLELASKSVTSACRSLVRQVQEILSQKDKEELEIDYSKLSAHENKTVQMEQQVEILKLETALQNARRRLGEIRRFGYHADEE +>460519_cbs-7435_MATkp_MATalpha|gene_index=0|name=sla2|role=flanking_conserved +MSRQEADLKVSIKKACSTEEAAPKRKHVRACIVFTWDHRSSKAFYNGLRLLPIQNDEIPLFKSLITIHKVLQEGHPSAIKEGIKNRDWIQSLGHVFPGDGMKRYGRLIREYDRYLIRKIDFHNSHKGFNGTFEYEEYVSLKTVSDPNEGYEAIMDLMVLQDSINDLQRLLFASIDSSSHSELKISALVPLIAESYGIFKFITSMLRGMCHSLGHDDEALQPLIERFISQYSDLYDFYAECSYVKYLTSLVNIPKLPFEAPDLFNWDETDELKPRILAEEPSLQVSSKAPSEEFGTPTEVIHSQPTAGTDLWAQSNALKQQYEQEQQLLEQERQQQLLEQQHQQQQQLEYWEKQKELQEQQQLYAQQQLESDQLQRQVQGRVGELERDLLILRGQFDRDQLMLRQYDERVKALETELSSTTQNAQQQLGAKEELLGNIQEQAAQWKSKYDSLAKLYSQLREEHLNLLSKFKTAQLKASSAREAIDKREKIERDLKAKNIELADLIRERDRARLDLERSKSDKNSETERLEARLREQETKLADIEKLHSSELKSFLSQHNKEIEELQNQLQASSLSESANERLKALEAQLQEKDDELAIAHQTMEATIKELTGQQSIQNSAIDEQIDAILLEHIDKLTEVIDAILTSGVQRIQDGLFELDSPMQAGNQNSSPEYLSSIIEKSSNLATEFTSSFNGFIADGPNGDHVSVIQTITEFTTSIVDLLLNCKGVVRLASSDQEAEALLNSARDVAEESESFIVSLYSSSLKGLSDQEKTDKAIEGNVDIQQELQTLSSLVEKLISSQVNINVNDNVGELVDREMAHAAETIAKASDHLTDLLTNAKQDISTIDMKINNSILSAAIAVTKAIILLIKTATDCQNEIVNHGRGSSSRTSFYKKHNKWTEGLISASKSVAYSTNSLIQIADGVLSSTSSPEQLIVACNDVAASTAQLVAASRVKASFMSKTQDKLELASKSVTSACRSLVRQVQEILSQKDKEELEIDYSKLSAHENKTVQMEQQVEILKLETALQNARRRLGEIRRFGYHADE +>460519_cbs-7435_MATkp_MATalpha|gene_index=1|name=MATalpha1|role=core_MAT +MLPPQPKSFKGIQKPFKCSQYAHSTLDNGNMLQHTKHPELVTYQLETPRTRSLQQIESHLLQETTLGIKRTGENQYSEKRTKSSRSYMSKRINAFIAFRSYYSRQVNDYNKQISISRLLSVAWKNENKELWRSYALLYNSSNSNIPFVDWLQTKGPKNSKRTSTVTKSFISWNELLSTRNKIEDVFLDLQ +>460519_cbs-7435_MATkp_MATalpha|gene_index=2|name=MATalpha2|role=core_MAT +MISQLLRVHKTLMRILQGISHNALHSNWTSICNQIGSSQRKLSSLLEQGIDQNDQTLREILVQINRMCRAIALMLENKRMLKNDVEIILQQILDSNSTERKRRLPREKVRILENWFADHFQHPYATQQDFDELVHLTSLSKTQIRNWISNKRRKERSSTVSTELLQALNKSPS +>460519_cbs-7435_MATkp_MATalpha|gene_index=3|name=dic1|role=flanking_conserved +MTQINRESNDDSTMQYERIPPAKGVFPFWYGGAASMFACLFTHPLDLAKVRLQTASQPGQNLLTIAIRIISSEGILGAYSGLSASLLRQATYSTTRFGIYEALKDYLTKANNNQDLSTAILLPCSMLAGGIGGLVGNPSDVVNIRMQNDSSLPKPARRNYRNALHGLARMAKEEGLGSWFRGLLPNLTRGVLMTASQVVSYDVAKKFLVKKLSFDETTRATHFSASLMAGLVATTVCSPADVVKTRIMNSAEKHQSIITVLTTAMRKEGPGFLFRGWFPSFIRLGPHTILTFVALEQLRTWRIAM +>460519_gs115_MATkp_MATalpha|gene_index=0|name=dic1|role=flanking_conserved +MTQINRESNDDSTMQYERIPPAKGVFPFWYGGAASMFACLFTHPLDLAKVRLQTASQPGQNLLTIAIRIISSEGILGAYSGLSASLLRQATYSTTRFGIYEALKDYLTKANNNQDLSTAILLPCSMLAGGIGGLVGNPSDVVNIRMQNDSSLPKPARRNYRNALHGLARMAKEEGLGSWFRGLLPNLTRGVLMTASQVVSYDVAKKFLVKKLSFDETTRATHFSASLMAGLVATTVCSPADVVKTRIMNSAEKHQSIITVLTTAMRKEGPGFLFRGWFPSFIRLGPHTILTFVALEQLRTWRIAM +>460519_gs115_MATkp_MATalpha|gene_index=1|name=MATalpha2|role=core_MAT +MISQLLRVHKTLMRILQGISHNALHSNWTSICNQIGSSQRKLSSLLEQGIDQNDQTLREILVQINRMCRAIALMLENKRMLKNDVEIILQQILDSNSTERKRRLPREKVRILENWFADHFQHPYATQQDFDELVHLTSLSKTQIRNWISNKRRKERSSTVSTELLQALNKSPS +>460519_gs115_MATkp_MATalpha|gene_index=3|name=sla2|role=flanking_conserved +MSRQEADLKVSIKKACSTEEAAPKRKHVRACIVFTWDHRSSKAFYNGLRLLPIQNDEIPLFKSLITIHKVLQEGHPSAIKEGIKNRDWIQSLGHVFPGDGMKRYGRLIREYDRYLIRKIDFHNSHKGFNGTFEYEEYVSLKTVSDPNEGYEAIMDLMVLQDSINDLQRLLFASIDSSSHSELKISALVPLIAESYGIFKFITSMLRGMCHSLGHDDEALQPLIERFISQYSDLYDFYAECSYVKYLTSLVNIPKLPFEAPDLFNWDETDELKPRILAEEPSLQVSSKAPSEEFGTPTEVIHSQPTAGTDLWAQSNALKQQYEQEQQLLEQERQQQLLEQQHQQQQQLEYWEKQKELQEQQQLYAQQQLESDQLQRQVQGRVGELERDLLILRGQFDRDQLMLRQYDERVKALETELSSTTQNAQQQLGAKEELLGNIQEQAAQWKSKYDSLAKLYSQLREEHLNLLSKFKTAQLKASSAREAIDKREKIERDLKAKNIELADLIRERDRARLDLERSKSDKNSETERLEARLREQETKLADIEKLHSSELKSFLSQHNKEIEELQNQLQASSLSESANERLKALEAQLQEKDDELAIAHQTMEATIKELTGQQSIQNSAIDEQIDAILLEHIDKLTEVIDAILTSGVQRIQDGLFELDSPMQAGNQNSSPEYLSSIIEKSSNLATEFTSSFNGFIADGPNGDHVSVIQTITEFTTSIVDLLLNCKGVVRLASSDQEAEALLNSARDVAEESESFIVSLYSSSLKGLSDQEKTDKAIEGNVDIQQELQTLSSLVEKLISSQVNINVNDNVGELVDREMAHAAETIAKASDHLTDLLTNAKQDISTIDMKINNSILSAAIAVTKAIILLIKTATDCQNEIVNHGRGSSSRTSFYKKHNKWTEGLISASKSVAYSTNSLIQIADGVLSSTSSPEQLIVACNDVAASTAQLVAASRVKASFMSKTQDKLELASKSVTSACRSLVRQVQEILSQKDKEELEIDYSKLSAHENKTVQMEQQVEILKLETALQNARRRLGEIRRFGYHADE +>460523_cbs-4732_MATog_MATa-MATalpha|gene_index=0|name=dic1|role=flanking_conserved +MEVCITTQSIDNGVGAASMFACLFTHPLDLAKVRLQTAKVPGDSLVSLAYKIVKTEGVLAAYAGLSASLLRQATYSTARFGVYEKLKGIMTDPTKGQASTFQLLAASMIAGAVGGVVGNPADVVNIRMQNDNSLPESQRRHYKHALDGLLKITREENITALFRGLGPNLARGILMTASQVVSYDVAKKLLVENLSMDPKTKATHFSASLIAGLVATTVCSPADVLKTRIMNSSGTGQSSFGILKDAISREGLGFMFRGWTPAFIRLGPHTILTFIALEELRRLKIGL +>460523_cbs-4732_MATog_MATa-MATalpha|gene_index=1|name=MATalpha2|role=core_MAT +MDDMLTKIQERTKCLIYILMERQIRAARLEQLLLDYISCKPHDKLCKSSMEGFTTERSLKYTRDCPQYAAVTTSQPRYRIEKRSKRFPKTAQMELENWYTENEDNPYLSKRDLQQLVHKTGLCAPQVRNWVSNRRRKERTLTISKELSDLLNQDTRCSPNDVV +>460523_cbs-4732_MATog_MATa-MATalpha|gene_index=2|name=MATalpha1|role=core_MAT +MMFHVLCFFGNRTSRVANLCLQLKFPPHNDSPKMALDELNLSFLTHLPQIPTTSPLLKRLLTEYGAIDNGKDSLNKVAPKKSSRHRVQKEKKRLNGFMAFRSFYSRNIANYNSQKALSQDLADAWNREKHQQIWSLYAIQYNHSKSKEPFSRWLEMKLSNKLGKFNSDDPTTRREINVMSHIVVEDVFQECSSQY +>460523_cbs-4732_MATog_MATa-MATalpha|gene_index=3|name=MATa1|role=core_MAT +MQFTILNEPSLDSQRREGDLASENYVFGDIRKEGVRILEDSLRSERNALLAIGAGGAADRVKQHYRKLLDDWEAAIMEIRSNDKYESLCCGFAIEKAEVETEMRNTEELDVYKECLVSECFDKKKRRHIPESSKELLEKAFKVKRFPNSKERERIARECGISPLQVRVWFTNKRARSKSRA +>460523_cbs-4732_MATog_MATa-MATalpha|gene_index=4|name=sla2|role=flanking_conserved +QMLQQAMDDTMQELAEQHQAIEKEAETRVLRLIDTLLKVSTDRLREFVFNLESPVYSNTDIPTAEYLGTMLEKVSHLSTQFSTTMTDYIADNMRGDSESGLIKAITEFTDSIGNLFSNVKAVLRDRKDDVQEILVEGAKDLAHMVELFFESMLSDHLLKLEIHERTDRVITGNINVQEVIQSLMQVVEVFRDPGRKSPVSSDELGYFLDKELANTQAAVEKAADLLESMSTRHKLEVQEGGSLEVNEAIISCASAIINAVKLLLEACIEAQEEIVSRGKGSLSRALFYKKNNRWTEGLISASKQVAYATGILIRMADGVLAGTNSSEELIVASNEVASATAQLVSSSRVKSDLMSQSHLNLEEASRKVTSSCKMLVTKVRSLLLTDESNKTVDYSQLTAHENRTAELEQQVEILKLESALSQARKRLGEIRKFSYRDEES +>28985_nrrl-y-1140_MATsc_HMLalpha|gene_index=0|name=MATALPHA1|role=core_MAT +MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIPAPPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTKTKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGIDKQWLYEIVQYEECLTPTTKKPYVENIYNSGFKQRIDSPNQKDITFSQSDNSADWLVDPIFFDTEFLATSFDRTNLIISDCYSLMNSV +>28985_nrrl-y-1140_MATsc_HMLalpha|gene_index=1|name=MATALPHA2|role=core_MAT +MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLENNDDYNKIESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKGKMREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNILN +>28985_nrrl-y-1140_MATsc_MATa|gene_index=0|name=sla2|role=flanking_conserved +MSREEQTLEKSIKKALSGGDVAPKRKHVRACIVYTWDHKSSKTFFNLLKLQPYATDELQLFKALVLLHKVLQEGHPSALVEGIRNIDWIESLSRIFSVDSDDGSKYGSSRMRYIGDEYAKAIGEYVFFLVEKLQFHKSHKGFNGIFEYEEYVSLVSVSDPNEGYETVLDLMNLEDVADNLQKLIFAGISNRKSGFGSFSSGLDCRGAVLIPLVSETYGIFKFVTSMMKALYKQMGDYDALSGLFDRYTEQCARLNEFYFDCNTVQPLKNLITIPTLPSDPMSRIIDDEDDAEVNDVVFEKRSKSSVSSLPSRTPTRENLRDPSPVHEAPPVARPAEVRSLSQPAAPVVPIATGVVMPVVTGYSQPPLQVVPTGAEFWSIPSTSAPTRSVVASHDDLLIEQQKQQQIQQQQYALQLEHQKQLQLQQEQQALLQQRIQQQEMEKEALIQQKTASLQNDIMSFKNQYERDQVMLEQYDKRVQKLESELESVKEFKEKYQSLAKLYSQLRQEHLNILKKMKKTQDDLAEAESEVKKLKSSALSNVGIRNNNKGESEREEAKDRSGMILKSLVESSIKSLQDPIASLDVSDLATDLSNAFIDGDINTIVNILPEFVSLLLRCPQEMQTIAEDFLRCLSSAKQTDSVINANIAFQEKLKRLGEIRQYSYRYGDSDEV +>28985_nrrl-y-1140_MATsc_MATa|gene_index=1|name=MATA1|role=core_MAT +MCDNDMADIQSKLSSFCEEIRALALKEGYNLEGDKSPSSKPYFMSWPKEIDVNHPNFAFFTKLQFQYDKSLETILNSCYLQELQLDPTRIIETLQQHFNNSILRYADIENISDVKDESPMSFDTEHECTDTSEDISDKSEISSTNSDNPIQNCYPTYKRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKRMRAKKHTTGKGTKRKSKKYPS +>28985_nrrl-y-1140_MATsc_MATa|gene_index=2|name=MATA2|role=core_MAT +MANSTLRRTTFFKLTTTEDEDTIPKLLQPNNNSVAFPNLKRTGKAFTNDTIKENTKKYTRPRNQFVLMRTLFNRRVNNHILQYYNKSKLEKKMFTLTSKITSELWNESSPDLKSYFSLLATLEENWHKYTHYCSWDRNSAQTLSMEPIELSQVRPRLISSLTVGAGSSVSTYTLRELLLVRKIKSRKRKTTTLTQDSSPTTKFKYKFKKQPKTKMNSNLSKLRFKSKQPPTPPEENSNVFKKRYTSENRIIEDLFLM +>381046_cbs-6340_MATsc_HMLalpha|gene_index=0|name=MATALPHA1|role=core_MAT +MNSTKPSFKVLIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQAIPKPPNTLINLVRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWLEENYQQSYEESELDSECMAKRSQPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSLNSLPFFEEHNRTTDWMLSSILQCDQVPYYPN +>381046_cbs-6340_MATsc_HMLalpha|gene_index=1|name=MATALPHA2|role=core_MAT +MSHISVSSLLNLPVFQASHQEKATSPITSQSCLVASGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPILNS +>4932_s288c_MATsc_HMRa|gene_index=0|name=MATA2|role=core_MAT +MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE +>4932_s288c_MATsc_HMRa|gene_index=1|name=MATA1|role=core_MAT +MDDICSMAENINRTLFNILGTEIDEINLNTNNLYNFIMESNLTKVEQHTLHKNISNNRLEIYHHIKKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK +>4932_s288c_MATsc_MATalpha|gene_index=0|name=MATALPHA2|role=core_MAT +MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE +>4932_s288c_MATsc_MATalpha|gene_index=1|name=MATALPHA1|role=core_MAT +MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFLNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL +>4956_da2_MATsc_MATalpha|gene_index=0|name=cha1|role=flanking_variable +RNATPSLEHENIIYPKRAQVAS +>4956_da2_MATsc_MATalpha|gene_index=1|name=alpha2|role=core_MAT +MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSENEQFEKDKAELEKILPSLNILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESKQGTEELNE +>4956_da2_MATsc_MATalpha|gene_index=2|name=alpha1|role=core_MAT +MNTKSFRGFKSNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFVEWVDQRYERESCI +>4956_da2_MATsc_MATalpha|gene_index=3|name=sla2|role=flanking_conserved +SSNSNSGMSYGNVVNEEPRPVISGDVRLAIYLSRQCISNYNQPVSVLSISQLCNEVASQFLNSTPHIPTIIQLTHQITTLLQHNPSPLLAQASQLYFQALLSPSQQDIINANTNLQQLLTN +>4959_cbs767_MTL_A|gene_index=2|name=MTLalpha1|role=core_MAT +MTSEVAKVIPKRFTSRFTVSKTGKRSNSNIKNEAIDIGRQRKVKSMQVVFFTELPSLPTPSIDLQEILIRFNQATRNCAGDSSWGSQLFDMKVPTRKSRIRCKKTRCLNGFMAFRSFYSRSIYNVEHQRELSTLLGKLWKNEPNKAIWNRYAIEYNSQAINQDFVDWLFKALGLEVETFPIPYTSTVRNESWTFSSRNNENAVEDIYYIGTV +>4959_cbs767_MTL_A|gene_index=0|name=MTLA1|role=core_MAT +MEGYTKSHDVVVEVPENENIKAYTTRVESGHISEPSSSNGSNLTLNVKNEYENISSDGKVIDRYQLLKEKGYSHGFLLEEASISVTCETPDPHLQQQRKVSRFGREVHENTNVFPNKKGSYKCDSEASNRFLENVFKTNSYPTSKERHIIAKKCGLSPTQVGAWFTNRRNVSE +>4959_cbs767_MTL_A|gene_index=1|name=MTLA2|role=core_MAT +MSLSPDKIFTFCFKLPRRIDIPVESNQPTTKKNFKIKELTTTNSYPSISINIKQYVSFTSEKYIEASRKPTAKDKKTAITRGSFRTRNKFIIARNLLCRLVKHEKALSSTEISKVVSLVWKESNKSLHDYFEYLSLLETYWYDKLMSSYGNSTLQATATAAVSIRLSSVPYENLCASCYNKHKQKKTLNYDYSKSAKFRVHKDFKEKKKTFLTIKDHSKKLEKLSDAFRINQCTITTNFGIVTEDMFFNSL +>1173061_cbs615-84_MATdc_B|gene_index=0|name=MATB|role=core_MAT +MPEFKRFRFRHHKISCPSTTKNESKFLFCPQFIDFSAPKNGSEECRHTETMLAIPPPSSELLKALDELRTLQCSVQKKGIIRSRRRKPNTNMAKKVSRINGFTAFKSYYSQNITSVCQGTISSKLSKVWQIEKNQDVWDNYARHYRRYQRKEPEHFCVWLLRATQNNSIDKQKTHSFTKLNDGDENLDIEALCFNLNEDSFTKDLITTQSSGDLNPYSNYGFDTLDFITDSSKVSSDNIESSNMNDYMDGLSPESCESISPFDIIDSTFSEPTSNHYDYMFIDSPSDSLLEDFFSDKNVVSDKNCKQPFVPLELNKDQFLPMPELWVSLNSEYSLSKLS +>1173061_clib918_MATdc_A|gene_index=0|name=sla2|role=flanking_conserved +MATLSKAEAELTVHIKKATNPEETAPKRKHVRQCIIYTWDNHSGRAFWNGMKIQPLQNDEVQVFKALITIHKVLQEGHPSVLREAQQNRSWLESLARGAHAGRHTYAKLIYEYVGLLLKKLNFHKNHPDFNGTFEYEEYISLRNIDDPNEGYQAIVDLMDLQDAIDNFQRLIIASLKHGRPNECRISALIPLVAESYGIYRFTTTMLRAMHATTNDDDALEPLRSRYYSQHQRLLEFYYDCSSLKYLTSVITIPTLSQDPPNLYGENPEEGEAPALPKRPISEVASLATGATTAPSTTDLTPEPVVDFWSTPQGQQQLQQQQLQQQQYEEEQRRLAAQREAELQQQQMLHLQQQQQFEEQQRMQAEQQRLAQEALLRDQYQRQADGRAAELERDILNLRGQYERDQLMLEQYDRRVKGLEGELQQVIANTNLQSQSKDDMIRSLQEQVNSLKSKYDVLAKLYSQLRQEHLDKLKELKLLKVKAASAQEAIEKREKLERDIKAKNIELADLIRERDRARYDLDKSRGNQKDVIEKLERQLRLTEDKLADAERSKGADLSLLISKHNRELADLEEALKAKQSVLDNYANRSFDDSDLKLKLAEKDDELEILQETVDSMEAALKEMSLNHNEADQALEEQIDEVLKEHLSKLNSIIDSVLESSAERVQESLFEFESPMQAGNQNSTPEYLLSIVEKASTSATDFATSFNNFIIDGPNGDYSGIISTATILSSVIPDVLNNAKGLTRLARDDTVADNIISYARLAAVAVEDFFSGVQSNKLAQLSDEDKTDKVINFNIDVQTHLQSLSQVSEKLTPRAGTHLNGSGDLGDLVDREMARAAEAIESANAKLNELLSRPKDPKFSVFDLKIHEAILAAAIAVTTAIAALIKAASDCQQEIVAQGKGASSRTAFYKKHNRWTEGLISAAKSVAASTNVLIETADGVLSGNHTPEQLIVASNEVASSTAQLVAASRVKASYMSKTQDRLEGASKAVTSACRSLVNQVQDILSKKQQKEENDVDYSKLTPHVLKTTEMEQQVEILKLENSLNSARKRLGEIRKYSYVDDEDEE +>1173061_clib918_MATdc_A|gene_index=1|name=MATA|role=core_MAT +MNSFLETPALILYSRKSQLPKKSEKSENVMKRIFSPDSFPSSTSKFNDPREKKKIMSDFLFYDGANNTFSETQAPPRKRKNSTEDKPIPRPTNSFICARSMLHKMFERLNISTIECSNLMSDIWKNYNDDLFKHYFRYLSFLEACWHTSVYPNYRYNPRKKLPSPKPSSCALKKYSKSIIKKRPVKTRAKSSGSTNMMPIKINSCTPGFSFNTEAPRRNYELEIIISELMKEEQLYFGMPIIETAPTSVNCKPFQIDDFSDNFLAFSYLYDEGMRDMSGAR +>4952_clib122_MATyl_B|gene_index=0|name=apn2|role=flanking_conserved +MRFVTFNICGINNVLSYHPWNEQRSFEHMFAVLKADVICLQETKLQPHLLKREHALVPGYDSYWSFSNTKKGYSGVAVYVKHGIKVLKAEEGLTGQLVSPDSKKGLTYQQLYERQRERDGSSKSCIGAYPEGNPQRLFQVDSEGRSLVLDLGFCVVFGLYCPSTATEGEERDAYRDDYFGLLEERVNLLVEAGREVVVMGDLNVARELYDSAEGMQALHKAKHITLPTLGDKEEGRFVEVFEKLNPGQCKSWREAKVGRRVFHRLVPDLLQDSCRNKHPNRPDMYTCWNVMMNYRPGNFGSRIDYVLASKGLKVEDADILPHLEGSDHCPVYAEVREPDACQEKDNRATQGAANQTKQASSSAPNSFRPKLFHRTNKQFVQTTSVMSMFRAQTPPTKGITKPKAPSKSTAKKQAAISSFFQKPDPEAAVVSTCVSDVHTKPLGQSQSPAVSPNIESTYQGCDAGAHATREGEDTRPQMATRLDLPEPTEYLDIAERVEEAEKVASQWSKIMTKKPAPVCAHNLPAVLRTTRKKGPNQGKHFWVCGQNHSLQLVGDSYKASADPDAKGSQDDTSARCNFFQWK +>4952_clib122_MATyl_B|gene_index=1|name=matb2|role=core_MAT +MKETRDLLFYNENSIDFNFSPEEMDTHQMMCVNNDSQQDTSFLTATTCIFDFQKDIYDDQNLMSFDPFFPQQRDMALWIASVGNGAIDWSTKPQLTLSKKIPDVVNEKGEEITPADLQRHYADKHVAKLPDHSCDLYYLLFKHAKFEATTLRIPLSLLNDNGTGALGPFDEIRSLTDEEQRLLTLLKTISHYSWVTKHATKDCTGQLLDLCKEGLQLVESIQVNKTFNGVILHILVAYFGRRSTALRDEFQLHKLFLEQRLDIELEILAQHGGADAIDSEKLRKVKKLSELWEWFNAIPYNHHPSVSQIEFIASQIGEKVSFVKSWVANKRRTGAKKRSKKPAPSTQIRPALKVFLEKKPFVSRQVV +>4952_clib122_MATyl_B|gene_index=2|name=matb1|role=core_MAT +MRQDEYHIKQRIFSISKAAITMIKIKTEHKVVKARTPKKMKPGMARFRIQAVPIINQNNNAYLSEISFEEKLEPVPPMYPELQKVLDYIHSRKVPFDGSSGPYPPSSRRQVVNGYVAFKLYHHVPHTDLSAIDITHLLQGPWRACPDRHIWTKYADHYRSRGRDVAFKTWLLSVTSPAPEKGLIIQPQTQSEQGYNFSSSSDFSSSPEHSETLPVSSGEPSTPVDPFLIEFDQGIAEKEASFTSPCNQNYDLDFSQLQPLSIRVPYFNQYASSSNSGLDVDYFDGSTLDTPSYIDTFITPLH +>4952_clib122_MATyl_B|gene_index=3|name=sla2|role=flanking_conserved +MSSNRAEVDLNVNIKKATNTDESAPKRKHVRACIVYTHDHRSSKAFWNGIRIQPLQTDDVMVFKALITIHKVLQEGHPSALRDAQANVNFIQSLARGNNYTGPNQGNHGYGKLISEYVRFLMQKLTFHKYHPAFNGMFEYEDYISLRTVNDPNEGYEAIMNLMTLQDGVDDFQRLVFSSLQRSRSNECKISSLVPMIAESYGIYRFVISMLRAMHVSTGNDEALESLRQRFYSQHDRLRDFYYDCSTLKYLRSIVTIPQLGKNPPNLLEEEDGPGLPQRPKSVAETRSVSPEPAPLPVATPTPSIPAEAQPIENFWSQDALLAQQQYDAEQERLRQQQAMEEERIRQMQMQQQQQFEMQQRQQMEAQQRAQEQLMADQMARHAQGRMAELERDILALRGQYDQDQLMLEQYDGRVKALEAELNQLQQTAHQSAQAKDDLIESLQQQITMWRQKYETLAKRYSSMREEYLALLKKLKATQQKAASAKEAIEKAEKLERDMRHKNIELADLIKERDRARYDLDRAKGGNKEDVERLERELRMAQDKLADKDRSTGADLSLLLSKHNRELSELENALKMKQRALDERGDDSDLLRRLEEKEIEYEALNEAFNSLALHQEQQGNNSNGGSTPLAALHSIIDALLESGSQRVQDALFELESPMQAGNQNSTPEYLLSVIEKASESASAFATSFNNFLADETDGDYAEIIKTVNIYSTAVENVLSNSKGLTRLAKDDASADALVNFARESAEATERNFIGLLSEIIEDFPLDDKMERVITLNMNVQTALQHLTKLAERMAPKTNINMSGDLGDLVEREMAKAADAIAAASAKLGDLLKFNQSDPLKSTTDLQLHEAAIQAAQAVINAIAALIRAATDAQNEIVAQGRGTSSRAQFYKKNNKWTEGLISAAKSVAASTNILIEKADGTLRRTSGLEELIVASNNVAASTAQLVAASRVKATFMSKTQDKLEECSKVVTSACRNLVKQVQEILNKKFGELDEKVDYAALSKHEFKTTEMEQQVEILKLENDLQGARKRLGQMRKVAYLHQDEEESIPGQED +>4952_w29_MATyl_A|gene_index=0|name=sla2|role=flanking_conserved +MSSNRAEVDLNVNIKKATNTDESAPKRKHVRACIVYTHDHRSSKAFWNGIRIQPLQTDDVMVFKALITIHKVLQEGHPSALRDAQANVNFIQSLARGNNYTGPNQGNHGYGKLISEYVRFLMQKLTFHKYHPAFNGMFEYEDYISLRTVNDPNEGYEAIMNLMTLQDGVDDFQRLVFSSLQRSRSNECKISSLVPMIAESYGIYRFVISMLRAMHVSTGNDEALESLRQRFYSQHDRLRDFYYDCSTLKYLRSIVTIPQLGKNPPNLLEEEDGPGLPQRPKSVAETRSVSPEPAPLPVATPTPSIPAEAQPIENFWSQDALLAQQQYDAEQERLRQQQAMEEERIRQMQMQQQQQFEMQQRQQMEAQQRAQEQLMADQMARHAQGRMAELERDILALRGQYDQDQLMLEQYDGRVKALEAELNQLQQTAHQSAQAKDDLIESLQQQITMWRQKYETLAKRYSSMREEYLALLKKLKATQQKAASAKEAIEKAEKMERDMRHKNIELADLIKERDRARYDLDRAKGGNKEDVERLERELRMAQDKLADKDRSTGADLSLLLSKHNRELSELENALKMKQRALDERGDDSDLLRRLEEKEIEYEALNEAFNSLALHQEQQGNNSNGGSTPLAALHSIIDALLESGSQRVQDALFELESPMQAGNQNSTPEYLLSVIEKASESASAFATSFNNFLADETDGDYAEIIKTVNIYSTAVENVLSNSKGLTRLAKDDASADALVNFARESAEATERNFIGLLSEIIEDFPLDDKMERVITLNMNVQTALQHLTKLAERMAPKTNINMSGDLGDLVEREMAKAADAIAAAASAKLGDLLKFNQSDPLKSTTDLQLHEAAIQAAQAVINAIAALIRAATDAQNEIVAQGRGTSSRAQFYKKNNKWTEGLISAAKSVAASTNILIEKADGTLRRTSGLEELIVASNNVAASTAQLVAASRVKATFMSKTQDKLEECSKVVTSACRNLVKQVQEILNKKFGELDEKVDYAALSKHEFKTTEMEQQVEILKLENDLQGARKRLGQMRKVAYLHQDEEESIPGQED +>4952_w29_MATyl_A|gene_index=1|name=mata1|role=core_MAT +MPSRTPTDIWRCQRLILAARKGETTCQALHEQSIEISSSLKWFEEISEWMSKFPESGLYISTTIWTFLEGVPNEHRIKYDRLIRHYITYIQQLVPARLVTAYLDSLFKICSHPTRTERRIIGEHCGISLHQVTQWFTNRRFREPKTDSPDDGSTRFIPSPMTSPGSIDECSFPESP +>4952_w29_MATyl_A|gene_index=2|name=mata2|role=core_MAT +MENTILHIHSFQLPQTEQPYPEAMLFDRDTSDSRTVLTQKPNGLEISLNFLQYDGHKGLFIRQDSRTNEPEYIEPKVLKPRNSYILFRNATSRCSQSIDPNSAFVSRVSSYIWGSGIPNPIVRRWFKYMGFFEALYHEVDYPEYIPNKLPKSPKKPKVQKGATKSKKKGAKGKNKVTALQVLVGPTVGVGGRMTVSPMTAFFSNNSHVTCYDPNFVLDTPTREFLMMPLDDITLPSQGPRSDSQEQHVPRQPPDGQDYFDILDIDDFVSPYDDLTTRSFTNRQLFKHATLG +>4952_w29_MATyl_A|gene_index=3|name=apn2|role=flanking_conserved +RDAYRDDYFGLLEERVNLLVEAGREVVVMGDLNVARELYDSAEGMQALHKAKHITLPTLGDKEEGRFVEVFEKLNPGQCKSWREAKVGRRVFHRLVPDLLQDSCRNKHPNRPDMYTCWNVMMNYRPGNFGSRIDYVLASKGLKVEDADILPHLEGSDHCPVYAEVREPDACQEKDNRATQGAANQTKQASSSAPNSFRPKLFHRTNKQFVQTTSVMSMFRAQTPPTKGITKPKAPSKSTAKKQAAISSFFQKPDPEAAVVSTCVSDVHTKPLGQSQSPAVSPNIESTYQGCDAGAHATREGEDTRPQMATRLDLPEPTEYLDIAERVEEAEKVASQWSKIMTKKPAPVCAHNLPAVLRTTRKKGPNQGKHFWVCGQNHSLQLVGDSYKASADPDAKGSQDDTSARCNFFQWK diff --git a/results/2026-10-29_ss_records/ss_models.slurm b/results/2026-10-29_ss_records/ss_models.slurm new file mode 100644 index 00000000..fe4105a3 --- /dev/null +++ b/results/2026-10-29_ss_records/ss_models.slurm @@ -0,0 +1,15 @@ +#!/bin/bash +#SBATCH -p exfab -A exfab -c 8 --mem 24G -t 04:00:00 -J ss-stringtie +#SBATCH -o /bigdata/stajichlab/jstajich/projects/MATPredict/logs/ss_stringtie_%j.log +# Transcript models (StringTie) and ORFs (TransDecoder) from the merged S. schoenii RNA-seq alignment (non-stranded library). +set -euo pipefail +W=/bigdata/stajichlab/jstajich/projects/MATPredict/results/2026-10-29_ss_records/work; cd $W +set +eu; source /etc/profile 2>/dev/null; module load stringtie/3.0.3 transdecoder/5.5.0 gffread/0.12.7; set -eu +stringtie all.bam -p 8 -o stringtie.gtf -l SS +gffread -g genome.fa -w transcripts.fa stringtie.gtf +gffread stringtie.gtf -T -o /dev/null 2>/dev/null || true +rm -rf td; mkdir td; cd td +TransDecoder.LongOrfs -t ../transcripts.fa -m 60 > /dev/null +TransDecoder.Predict -t ../transcripts.fa --single_best_only > /dev/null +cp transcripts.fa.transdecoder.pep transcripts.fa.transdecoder.gff3 .. 2>/dev/null || cp *.transdecoder.* .. +touch $W/../DONE2 diff --git a/results/2026-10-29_ss_records/ss_rnaseq.slurm b/results/2026-10-29_ss_records/ss_rnaseq.slurm new file mode 100644 index 00000000..0337408c --- /dev/null +++ b/results/2026-10-29_ss_records/ss_rnaseq.slurm @@ -0,0 +1,29 @@ +#!/bin/bash +#SBATCH -p exfab -A exfab -c 8 --mem 32G -t 08:00:00 -J ss-models +#SBATCH -o /bigdata/stajichlab/jstajich/projects/MATPredict/logs/ss_models_%j.log +# S. schoenii (GCA_054953955.1, strain GDD12): public RNA-seq (PRJNA1364152) mapped to the assembly, and the curated +# Saccharomycotina MAT proteins aligned with miniprot, to build gene models for the MAT loci (the paper's GTF is not public). +set -euo pipefail +D=/bigdata/stajichlab/jstajich/projects/MATPredict/results/2026-10-29_ss_records +W=$D/work; mkdir -p $W; cd $W +set +eu; source /etc/profile 2>/dev/null; module load hisat2/2.2.1 samtools/1.19.2; set -eu +export PATH=/bigdata/stajichlab/jstajich/projects/MATPredict/.pixi/envs/default/bin:$PATH +ASM=https://ftp.ncbi.nlm.nih.gov/genomes/all/GCA/054/953/955/GCA_054953955.1_ASM5495395v1/GCA_054953955.1_ASM5495395v1_genomic.fna.gz +[ -s genome.fa ] || curl -sL $ASM | zcat > genome.fa +samtools faidx genome.fa +miniprot -t8 -d genome.mpi genome.fa +miniprot -t8 --gff -P SS genome.mpi $D/refs.faa > miniprot_all.gff 2> miniprot.log +[ -s idx.1.ht2 ] || hisat2-build -p 8 -q genome.fa idx > /dev/null +for RUN in SRR37453601 SRR37453602 SRR37453603; do + P=${RUN:0:6}; L=00${RUN: -1} + for m in 1 2; do curl -sL --retry 5 --retry-all-errors -C - ftp.sra.ebi.ac.uk/vol1/fastq/$P/$L/$RUN/${RUN}_$m.fastq.gz -o ${RUN}_$m.fastq.gz; done + [ -s $RUN.bam ] || hisat2 --dta -p 8 --max-intronlen 5000 --summary-file $RUN.hisat2.txt -x idx -1 ${RUN}_1.fastq.gz -2 ${RUN}_2.fastq.gz | samtools sort -@4 -o $RUN.bam - + samtools index $RUN.bam +done +samtools merge -f -@4 all.bam SRR3745360?.bam; samtools index all.bam +# per-base depth and spliced-read junctions over every contig carrying an MAT call +for R in CM143126.1 CM143127.1 CM143128.1 CM143129.1 CM143130.1 CM143131.1; do + samtools depth -a -r $R all.bam | awk -v r=$R '$3>0' > depth_$R.tsv + samtools view all.bam $R | awk '$6 ~ /N/{print $3,$4,$6}' > spliced_$R.txt +done +touch $D/DONE diff --git a/src/MATPredict/detect/family_status.py b/src/MATPredict/detect/family_status.py index f40503a7..0f05ec7a 100644 --- a/src/MATPredict/detect/family_status.py +++ b/src/MATPredict/detect/family_status.py @@ -11,13 +11,24 @@ 1. **Cross-calls.** Two families calling overlapping loci (overlap of 0.9 or more of the shorter locus, on one contig) are one locus. The call from the family whose `taxonomic_scope` contains the - genome is kept. If neither or both families are scoped to it, the call whose best core gene has the - higher identity is kept (curator's decision, 2026-10-29: the confidence tier is not comparable across - families, so it no longer decides). When the best identities are within `NEAR_TIE_POINTS` (3), the - call from the family that declares no `confirm_outside_scope` rule is kept, else the better score - (locus class, tier, polished genes, genes found, family name), and the kept call is flagged - `family_unconfirmed` (reason `cross_call_near_tie`). The other call is not lost: it is recorded - on the kept call as `cross_call`. + genome is kept. Where neither family is scoped to it, the family is decided ONCE FOR THE GENOME + (curator's decision, 2026-10-29, after an independent evaluation of the 3-point near-tie margin of the + first draft, `results/2026-10-29_near_tie/`): each family's mean over the genome's unscoped cross-called + loci of the best core-gene identity is computed, and the family with the higher mean is kept in every + such locus (equal means: the smaller family name). There is no margin and no preference for either + family. The confidence tier is not comparable across families and does not decide. Every such kept call + carries `family_ambiguous` (both identities, their gap, the genome means), because a best-hit identity + against a different reference protein of each family is an uncertain score. The other call is not lost: + it is recorded on the kept call as `cross_call`. + FLANK RULE (curator's decision, 2026-10-30, #188): in a group with no scoped family, a call from a family that + declares `confirm_outside_scope` (MTL) in a genome outside its scope, with fewer than `min_flank_genes` of its + declared flank genes within `window_bp` of a core gene, cannot win against a family in the group whose own + flank gene (a `flanking_conserved` or `flanking_variable` gene, such as SLA2 or DIC1 beside a MATsc call) is + present. The unsupported call is set aside as `cross_call` (`flank_rule: true`), is not counted in the genome + means, and the kept call's `family_ambiguous` carries the reason `cross_call_flank_rule`. Evidence: Saccharomycopsis, + Barnettozyma, Ambrosiozyma and Petasospora loci called MTL carry SLA2 or DIC1 beside the MAT genes and none of + PAP1/OBP1/PIK1 (results/2026-10-29_near_tie/), and the published S. schoenii architecture is SLA2-MAT. Where no + competitor has a flank gene, or the MTL call is supported or in scope, the identity rule decides as before. 2. **Family status.** A call from a family that declares `confirm_outside_scope` (MTL) in a genome outside its scope is `family_unconfirmed` (reason `_outside_scope`). It becomes `family_confirmed` when at least `min_flank_genes` of the declared flank genes (PAP1, OBP1, PIK1) @@ -39,9 +50,6 @@ CROSS_FAMILY_POLICIES = (POLICY_OFF, POLICY_ON) DEFAULT_CROSS_FAMILY_POLICY = POLICY_OFF -#: Best-core-identity difference (percentage points) at or below which two cross-called families are a near tie. -NEAR_TIE_POINTS = 3.0 - #: Fraction of the shorter locus that two calls must share to count as one locus. MIN_OVERLAP = 0.9 @@ -106,45 +114,91 @@ def _best_core_identity(r) -> float: def _note(r) -> dict: return {"family": f"{r.family_key.phylum}:{r.family_key.locus_name}", "idiomorph": r.idiomorph, "confidence": r.confidence, "locus_class": r.locus_class, "contig": r.contig, - "start": r.start, "end": r.end, "genes_found": list(r.genes_found)} + "start": r.start, "end": r.end, "genes_found": list(r.genes_found), + # the evidence of the call that was set aside, so the two families can be compared gene for gene after the run + "gene_evidence": [{"gene": e.gene_name, "role": e.role, "identity": round(e.identity, 2) if e.identity is not None else None, + "coverage": round(e.coverage, 2) if e.coverage is not None else None, "status": str(e.status)} + for e in r.gene_evidence if e.lost_to is None]} + + +def _family_name(r) -> str: + return f"{r.family_key.phylum}:{r.family_key.locus_name}" + + +def _has_flank_gene(r) -> bool: + """The call carries a flank gene of its own family (SLA2, DIC1 for MATsc; PAP1, OBP1, PIK1 for MTL).""" + return any(e.role in ("flanking_conserved", "flanking_variable") and e.lost_to is None for e in r.gene_evidence) def resolve_cross_calls(results: list, families: list, lineage: set[int]) -> list: - """`results` with each cross-family group reduced to one call; the others ride on it as `cross_call`.""" + """`results` with each cross-family group reduced to one call; the others ride on it as `cross_call`. + + A group with a family scoped to the genome keeps that family's best call. The other groups (no scoped family) are decided + together: the family with the higher mean best core-gene identity over the genome's unscoped groups wins each of them.""" by_key = {f.key: f for f in families} def in_scope(r) -> bool: family = by_key.get(r.family_key) return bool(lineage and family and lineage & set(family.taxonomic_scope)) - def needs_confirmation(r) -> bool: + def unsupported(r) -> bool: + """An out-of-scope call of a family with a flank rule that the rule does not confirm.""" family = by_key.get(r.family_key) - return bool(getattr(family, "confirm_outside_scope", None)) + rule = getattr(family, "confirm_outside_scope", None) + if not rule or not lineage or lineage & set(family.taxonomic_scope): + return False + return len(flank_support(r, list(rule["flank_genes"]), int(rule.get("window_bp", 15000)))) < int(rule.get("min_flank_genes", 2)) + + def eligible(g: list[int]) -> tuple[list[int], list[int]]: + """(members that may win, members set aside by the flank rule) of a group with no scoped family.""" + weak = [i for i in g if unsupported(results[i])] + rest = [i for i in g if i not in weak] + if weak and any(_has_flank_gene(results[i]) for i in rest): + return rest, weak + return list(g), [] + + groups = _groups(results) + unscoped = [g for g in groups if not any(in_scope(results[i]) for i in g)] + pooled: dict[str, list[float]] = {} + for g in unscoped: + may_win, _ = eligible(g) + for fam in {_family_name(results[i]) for i in may_win}: + pooled.setdefault(fam, []).append(max(_best_core_identity(results[i]) for i in may_win if _family_name(results[i]) == fam)) + means = {fam: sum(v) / len(v) for fam, v in pooled.items()} drop: set[int] = set() - kept: dict[int, list[dict]] = {} - for group in _groups(results): + kept: dict[int, tuple[list[dict], dict | None]] = {} + for group in groups: scoped = [i for i in group if in_scope(results[i])] - near_tie = False + ambiguous = None + set_aside: list[int] = [] if scoped: best = min(scoped, key=lambda i: _score(results[i])) else: - top = max(_best_core_identity(results[i]) for i in group) - close = [i for i in group if top - _best_core_identity(results[i]) <= NEAR_TIE_POINTS] - near_tie = len(close) > 1 - pool = [i for i in close if not needs_confirmation(results[i])] or close - best = min(pool, key=lambda i: _score(results[i])) if near_tie else close[0] + may_win, set_aside = eligible(group) + here = {_family_name(results[i]) for i in may_win} + winner = min(here, key=lambda f: (-means[f], f)) + best = min((i for i in may_win if _family_name(results[i]) == winner), key=lambda i: _score(results[i])) + ident = {f: round(max(_best_core_identity(results[i]) for i in group if _family_name(results[i]) == f), 2) + for f in sorted({_family_name(results[i]) for i in group})} + rest = [v for f, v in ident.items() if f != winner] + ambiguous = {"reason": "cross_call_flank_rule" if set_aside else "cross_call_unscoped", "kept_family": winner, "identities": ident, + "gap": round(ident[winner] - max(rest), 2) if rest else None, + "genome_mean_identity": {f: round(means[f], 2) for f in sorted(here)}, + "genome_loci": {f: len(pooled[f]) for f in sorted(here)}} + if set_aside: + ambiguous["flank_rule_set_aside"] = sorted({_family_name(results[i]) for i in set_aside}) notes = [] for i in sorted(group): if i != best: note = _note(results[i]) note["best_core_identity"] = round(_best_core_identity(results[i]), 2) - if near_tie: - note["near_tie"] = True + if not scoped and i in set_aside: + note["flank_rule"] = True notes.append(note) - kept[best] = notes + kept[best] = (notes, ambiguous) drop.update(i for i in group if i != best) - return [replace(r, cross_call=kept[i]) if i in kept else r for i, r in enumerate(results) if i not in drop] + return [replace(r, cross_call=kept[i][0], family_ambiguous=kept[i][1]) if i in kept else r for i, r in enumerate(results) if i not in drop] def _gap(a, b) -> int: @@ -170,9 +224,6 @@ def flag_family_status(results: list, families: list, lineage: set[int]) -> list for r in results: family = by_key.get(r.family_key) rule = getattr(family, "confirm_outside_scope", None) - if any(c.get("near_tie") for c in r.cross_call) and not (rule and lineage and not lineage & set(family.taxonomic_scope)): - out.append(replace(r, family_status={"status": STATUS_UNCONFIRMED, "reason": "cross_call_near_tie"})) - continue if not rule or not lineage or lineage & set(family.taxonomic_scope): out.append(r) continue diff --git a/src/MATPredict/detect/pipeline.py b/src/MATPredict/detect/pipeline.py index ca7c7f56..1ecf0c07 100644 --- a/src/MATPredict/detect/pipeline.py +++ b/src/MATPredict/detect/pipeline.py @@ -421,6 +421,10 @@ class DetectionResult: cassette: dict | None = None """`--cross-family-policy on` only: this call is one of two cassettes (MATa and MATalpha) of a family that declares `cassette_report`; which one is expressed is not determined (`family_status`). None otherwise.""" + family_ambiguous: dict | None = None + """`--cross-family-policy on` only: this locus was called by two families and neither is scoped to the genome; the family was + decided once for the genome by the higher mean best core-gene identity. Holds the identities of both families, their gap and + the genome means. None otherwise.""" cross_call: list = field(default_factory=list) """`--cross-family-policy on` only: the overlapping calls of other families folded into this one.""" verification: dict | None = None diff --git a/src/MATPredict/detect/report.py b/src/MATPredict/detect/report.py index 12988f0b..5c4ca28d 100644 --- a/src/MATPredict/detect/report.py +++ b/src/MATPredict/detect/report.py @@ -200,6 +200,8 @@ def write_detection_gff3( attrs += ";cassette=" + r.cassette["idiomorph"] + "_cassette" if getattr(r, "cross_call", None): attrs += ";cross_call=" + ",".join(c["family"] for c in r.cross_call) + if getattr(r, "family_ambiguous", None): + attrs += ";family_ambiguous=" + "|".join(f"{f}:{v}" for f, v in r.family_ambiguous["identities"].items()) lines.append("\t".join([ contig, "MATPredict", "MAT_locus", str(start), str(end), ".", ".", ".", attrs, ])) @@ -357,6 +359,7 @@ def _result_doc(r: DetectionResult) -> dict: **({"family_status": r.family_status} if getattr(r, "family_status", None) else {}), **({"cross_call": list(r.cross_call)} if getattr(r, "cross_call", None) else {}), **({"cassette": r.cassette} if getattr(r, "cassette", None) else {}), + **({"family_ambiguous": r.family_ambiguous} if getattr(r, "family_ambiguous", None) else {}), # Same-locus calls folded into this one (curator's ruling 2026-09-27; # see `locus_merge`). Empty list when unmerged. "merged_from": r.merged_from, diff --git a/tests/detect/test_family_status.py b/tests/detect/test_family_status.py index 4d9e15f1..aa6b60c3 100644 --- a/tests/detect/test_family_status.py +++ b/tests/detect/test_family_status.py @@ -48,11 +48,12 @@ def test_cross_call_keeps_the_family_scoped_to_the_genome(): assert out[0].cross_call[0]["family"] == "Ascomycota:MTL" -def test_cross_call_without_gene_evidence_is_a_near_tie_and_keeps_the_family_without_a_rule(): +def test_cross_call_without_gene_evidence_has_equal_means_and_keeps_the_smaller_family_name(): sc, mtl = _call(SC, 100, 5000, confidence="medium"), _call(MTL, 120, 5000, confidence="high") out = fs.resolve_cross_calls([sc, mtl], FAMILIES, {OTHER}) assert [r.family_key for r in out] == [SC] - assert out[0].cross_call[0]["family"] == "Ascomycota:MTL" and out[0].cross_call[0]["near_tie"] is True + assert out[0].cross_call[0]["family"] == "Ascomycota:MTL" and "near_tie" not in out[0].cross_call[0] + assert out[0].family_ambiguous["kept_family"] == "Ascomycota:MATsc" and out[0].family_ambiguous["gap"] == 0.0 def test_cross_call_needs_90_percent_overlap_on_the_same_contig(): @@ -160,19 +161,104 @@ def test_higher_core_identity_wins_not_the_tier(): assert out[0].cross_call[0]["best_core_identity"] == 50.0 and "near_tie" not in out[0].cross_call[0] -def test_near_tie_keeps_the_family_without_a_confirmation_rule_and_flags_it(): +def test_there_is_no_margin_a_small_gap_is_decided_by_identity_and_flagged_ambiguous(): sc, mtl = _scored(SC, 100, 5000, 48.0, "medium"), _scored(MTL, 100, 5000, 50.0, "high") out = fs.apply([sc, mtl], FAMILIES, {OTHER}, "on") - assert [r.family_key for r in out] == [SC] - assert out[0].family_status == {"status": fs.STATUS_UNCONFIRMED, "reason": "cross_call_near_tie"} - assert out[0].cross_call[0]["near_tie"] is True + assert [r.family_key for r in out] == [MTL] # 2 points higher wins; no preference for the family without a rule + amb = out[0].family_ambiguous + assert amb == {"reason": "cross_call_unscoped", "kept_family": "Ascomycota:MTL", + "identities": {"Ascomycota:MATsc": 48.0, "Ascomycota:MTL": 50.0}, "gap": 2.0, + "genome_mean_identity": {"Ascomycota:MATsc": 48.0, "Ascomycota:MTL": 50.0}, + "genome_loci": {"Ascomycota:MATsc": 1, "Ascomycota:MTL": 1}} + # the flank rule is a separate flag: MTL outside Serinales without PAP1, OBP1, PIK1 is unconfirmed + assert out[0].family_status["status"] == fs.STATUS_UNCONFIRMED and out[0].family_status["reason"] == "mtl_outside_scope" -def test_exactly_equal_identity_is_a_near_tie(): +def test_exactly_equal_identity_keeps_the_smaller_family_name(): sc, mtl = _scored(SC, 100, 5000, 50.0, "medium"), _scored(MTL, 100, 5000, 50.0, "high") assert [r.family_key for r in fs.resolve_cross_calls([sc, mtl], FAMILIES, {OTHER})] == [SC] +def test_the_family_is_decided_once_for_the_genome_by_the_mean_identity(): + # locus 1: MATsc 60 vs MTL 58 (per locus MATsc); locus 2: MATsc 40 vs MTL 55 (per locus MTL); means MATsc 50, MTL 56.5 + calls = [_scored(SC, 100, 5000, 60.0), _scored(MTL, 100, 5000, 58.0), _scored(SC, 100, 5000, 40.0), _scored(MTL, 100, 5000, 55.0)] + from dataclasses import replace + calls = [replace(c, contig="c1") if i < 2 else replace(c, contig="c2", gene_evidence=[replace(c.gene_evidence[0], contig="c2")]) for i, c in enumerate(calls)] + out = fs.resolve_cross_calls(calls, FAMILIES, {OTHER}) + assert sorted((r.contig, r.family_key.locus_name) for r in out) == [("c1", "MTL"), ("c2", "MTL")] # one family for the genome + assert all(r.family_ambiguous["genome_mean_identity"] == {"Ascomycota:MATsc": 50.0, "Ascomycota:MTL": 56.5} for r in out) + assert all(r.family_ambiguous["genome_loci"] == {"Ascomycota:MATsc": 2, "Ascomycota:MTL": 2} for r in out) + + +def test_a_scoped_decision_records_no_ambiguity_whatever_the_identities(): + from dataclasses import replace + one = [_scored(SC, 100, 5000, 30.0), _scored(MTL, 100, 5000, 90.0)] + two = [replace(c, contig="c2", gene_evidence=[replace(c.gene_evidence[0], contig="c2")]) for c in (_scored(SC, 100, 5000, 40.0), _scored(MTL, 100, 5000, 45.0))] + out = fs.resolve_cross_calls(one + two, FAMILIES, {SACCHAROMYCETACEAE}) + assert sorted((r.contig, r.family_key.locus_name) for r in out) == [("c1", "MATsc"), ("c2", "MATsc")] + assert all(r.family_ambiguous is None for r in out) + + +def test_a_third_family_group_is_decided_apart_from_the_scoped_group(): + from dataclasses import replace + og = FamilyKey("Ascomycota", "MATog") + fams = FAMILIES + [_family(og, [12345])] + one = [_scored(SC, 100, 5000, 30.0), _scored(MTL, 100, 5000, 90.0)] # SC is scoped: MATsc wins, no ambiguity + two = [replace(c, contig="c2", gene_evidence=[replace(c.gene_evidence[0], contig="c2")]) for c in (_scored(MTL, 100, 5000, 40.0), _scored(og, 100, 5000, 45.0))] + out = {r.contig: r for r in fs.resolve_cross_calls(one + two, fams, {SACCHAROMYCETACEAE})} + assert out["c1"].family_key == SC and out["c1"].family_ambiguous is None + assert out["c2"].family_key == og and out["c2"].family_ambiguous["genome_loci"] == {"Ascomycota:MATog": 1, "Ascomycota:MTL": 1} # c1 did not enter the means + + def test_scope_still_beats_identity(): sc, mtl = _scored(SC, 100, 5000, 30.0, "low"), _scored(MTL, 100, 5000, 90.0, "high") assert [r.family_key for r in fs.resolve_cross_calls([sc, mtl], FAMILIES, {SACCHAROMYCETACEAE})] == [SC] + + +# ---- the flank rule (curator, 2026-10-30): an unsupported out-of-scope MTL call cannot win against a family with its own flank gene +def _with_flank(call, name, role="flanking_conserved", start=None, end=None): + from dataclasses import replace + g = _gene(name, role, start if start is not None else call.start, end if end is not None else call.start + 100) + return replace(call, gene_evidence=call.gene_evidence + [g], genes_found=call.genes_found + [name]) + + +def test_an_mtl_call_without_flank_support_loses_to_a_family_with_its_own_flank_gene_whatever_the_identity(): + sc, mtl = _with_flank(_scored(SC, 100, 5000, 40.0, "medium"), "sla2"), _scored(MTL, 100, 5000, 70.0) + out = fs.resolve_cross_calls([sc, mtl], FAMILIES, {OTHER}) + assert [r.family_key for r in out] == [SC] + assert out[0].cross_call[0]["family"] == "Ascomycota:MTL" and out[0].cross_call[0]["flank_rule"] is True + amb = out[0].family_ambiguous + assert amb["reason"] == "cross_call_flank_rule" and amb["flank_rule_set_aside"] == ["Ascomycota:MTL"] + assert amb["identities"] == {"Ascomycota:MATsc": 40.0, "Ascomycota:MTL": 70.0} + + +def test_an_mtl_call_with_two_flank_genes_keeps_the_identity_rule(): + mtl = _with_flank(_with_flank(_scored(MTL, 100, 5000, 70.0), "PAP1", "flanking_variable", 100, 200), "OBP1", "flanking_variable", 300, 400) + sc = _with_flank(_scored(SC, 100, 5000, 40.0, "medium"), "sla2") + out = fs.resolve_cross_calls([sc, mtl], FAMILIES, {OTHER}) + assert [r.family_key for r in out] == [MTL] and out[0].family_ambiguous["reason"] == "cross_call_unscoped" + assert "flank_rule" not in out[0].cross_call[0] + + +def test_no_competitor_flank_gene_means_no_rule(): + sc, mtl = _scored(SC, 100, 5000, 40.0, "medium"), _scored(MTL, 100, 5000, 70.0) + out = fs.resolve_cross_calls([sc, mtl], FAMILIES, {OTHER}) + assert [r.family_key for r in out] == [MTL] and out[0].family_ambiguous["reason"] == "cross_call_unscoped" + + +def test_an_mtl_call_inside_serinales_is_never_set_aside(): + sc, mtl = _with_flank(_scored(SC, 100, 5000, 40.0, "medium"), "sla2"), _scored(MTL, 100, 5000, 70.0) + out = fs.resolve_cross_calls([sc, mtl], FAMILIES, {SERINALES}) + assert [r.family_key for r in out] == [MTL] and out[0].family_ambiguous is None + + +def test_a_set_aside_call_is_not_counted_in_the_genome_mean(): + from dataclasses import replace + # locus 1: the rule sets MTL (90) aside; locus 2 is a plain identity decision. Means: MATsc (40+50)/2 = 45, MTL 55 over locus 2 only. + l1 = [_with_flank(_scored(SC, 100, 5000, 40.0), "sla2"), _scored(MTL, 100, 5000, 90.0)] + l2 = [replace(c, contig="c2", gene_evidence=[replace(g, contig="c2") for g in c.gene_evidence]) + for c in (_scored(SC, 100, 5000, 50.0), _scored(MTL, 100, 5000, 55.0))] + out = fs.resolve_cross_calls(l1 + l2, FAMILIES, {OTHER}) + assert {r.contig: r.family_key.locus_name for r in out} == {"c1": "MATsc", "c2": "MTL"} + c2 = next(r for r in out if r.contig == "c2") + assert c2.family_ambiguous["genome_mean_identity"] == {"Ascomycota:MATsc": 45.0, "Ascomycota:MTL": 55.0} # 90 is not in the MTL mean